F472618

General Info

Members Datasets Scaffolds Average Seq Length
651 363 622 135

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0513740|Ga0436361_0513740_318_779
Length 153
Sequence VLAASASTRRSPFANRDWLMQLANYLFFTTTCEQALAFYTRCGLGRVTEMVRYGTVMPAPTAAMQGKVMHSRFEGPGVLFYASDNHDAEPMRGSAHMLMMDGREATDQLFAQLAEGGTITTPLGIQPWGDYYGKLTDRFGVQWMLNCPVRSGS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2519899620 Rhizobium sp. Pop5 Isolate Nodule
4 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
5 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
6 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
7 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
10 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
11 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
12 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
13 2818991436 Collimonas arenae 515 Isolate Unclassified
14 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
15 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
16 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
17 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
18 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
19 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
20 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
21 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
22 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
23 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
24 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
25 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
26 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
302 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
303 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
325 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
326 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
327 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
328 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
329 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
332 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
333 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
338 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
339 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
340 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
341 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
342 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
343 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
344 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
345 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
351 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
352 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
353 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
354 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
355 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
356 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
357 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
358 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
359 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
360 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
361 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
362 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
363 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.55
Metatranscriptomes 0
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.12
Nodule 2.46
Rhizoplane 3.99
Rhizosphere 58.83
Stem 0
Stem Tuber 0
Unclassified 12.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000021 3300002737 Bacteria 248155
2 JGI25162J39368_1024205 3300002737 Bacteria 548
3 JGI25154J39366_1000336 3300002738 Bacteria 27003
4 JGI25150J39212_1003233 3300002774 Bacteria 3851
5 JGI25151J46595_10042539 3300003187 Bacteria 1635
6 JGI25165J46597_1000049 3300003214 Bacteria 248154
7 JGI25153J46596_10011363 3300003215 Bacteria 3939
8 rootL2_10121150 3300003322 Bacteria 2689
9 rootL2_10164609 3300003322 Bacteria 2368
10 rootL2_10369363 3300003322 Bacteria 1996
11 rootH1_10080528 3300003323 Bacteria 1682
12 rootH1_10114272 3300003323 Unclassified 1575
13 rootH1_10264619 3300003323 Unclassified 1911
14 Ga0055538_1000023 3300003751 Bacteria 248154
15 Ga0055539_1000030 3300003752 Bacteria 248154
16 Ga0055539_1016061 3300003752 Bacteria 909
17 Ga0055533_1000039 3300003756 Bacteria 248154
18 Ga0055525_1000048 3300003759 Bacteria 248154
19 Ga0055526_1000016 3300003771 Bacteria 213710
20 Ga0055536_1000955 3300003781 Bacteria 18500
21 Ga0055536_1001688 3300003781 Bacteria 13068
22 Ga0055530_10005038 3300003791 Bacteria 6493
23 Ga0055540_1000747 3300003792 Bacteria 22059
24 Ga0055540_1056135 3300003792 Bacteria 798
25 Ga0055531_10001032 3300003794 Bacteria 22059
26 Ga0055531_10004663 3300003794 Bacteria 8223
27 Ga0055541_1000021 3300003841 Bacteria 248154
28 Ga0065714_10002968 3300005288 Bacteria 9262
29 Ga0068869_101472821 3300005334 Unclassified 604
30 Ga0070660_100613701 3300005339 Unclassified 910
31 Ga0070689_100910818 3300005340 Unclassified 778
32 Ga0070661_100001480 3300005344 Bacteria 16303
33 Ga0070659_100000895 3300005366 Bacteria 21810
34 Ga0070709_10000528 3300005434 Bacteria 22521
35 Ga0070714_100034186 3300005435 Bacteria 4255
36 Ga0070713_100032274 3300005436 Bacteria 4181
37 Ga0070713_100250661 3300005436 Bacteria 1615
38 Ga0070713_100629439 3300005436 Bacteria 1021
39 Ga0070710_10001256 3300005437 Bacteria 12043
40 Ga0070711_100030122 3300005439 Bacteria 3590
41 Ga0070711_100137967 3300005439 Bacteria 1825
42 Ga0070708_100318396 3300005445 Bacteria 1465
43 Ga0070663_100232573 3300005455 Bacteria 1452
44 Ga0070662_100007793 3300005457 Bacteria 6957
45 Ga0070662_100048463 3300005457 Bacteria 3060
46 Ga0070665_100473765 3300005548 Bacteria 1263
47 Ga0068857_100056676 3300005577 Bacteria 3478
48 Ga0068854_101667120 3300005578 Bacteria 582
49 Ga0068852_100759879 3300005616 Bacteria 982
50 Ga0068864_100257592 3300005618 Bacteria 1622
51 Ga0068863_100789565 3300005841 Bacteria 947
52 Ga0068858_100432405 3300005842 Bacteria 1267
53 Ga0068858_100544098 3300005842 Bacteria 1124
54 Ga0068858_100663878 3300005842 Bacteria 1013
55 Ga0068860_100000179 3300005843 Bacteria 102844
56 Ga0068860_100775176 3300005843 Bacteria 972
57 Ga0068860_100818248 3300005843 Bacteria 945
58 Ga0070717_10482164 3300006028 Bacteria 1120
59 Ga0070717_10580942 3300006028 Bacteria 1016
60 Ga0070717_11418695 3300006028 Bacteria 630
61 Ga0070717_11841154 3300006028 Bacteria 547
62 Ga0075365_10074516 3300006038 Bacteria 2289
63 Ga0075365_10206026 3300006038 Bacteria 1378
64 Ga0075368_10134895 3300006042 Bacteria 1027
65 Ga0075363_100184635 3300006048 Bacteria 1188
66 Ga0075364_11215812 3300006051 Bacteria 511
67 Ga0075432_10457847 3300006058 Unclassified 561
68 Ga0070716_100001221 3300006173 Bacteria 11304
69 Ga0070712_100261448 3300006175 Bacteria 1387
70 Ga0070712_100471873 3300006175 Bacteria 1048
71 Ga0075362_10047263 3300006177 Bacteria 1916
72 Ga0075362_10355365 3300006177 Bacteria 734
73 Ga0075367_10120521 3300006178 Bacteria 1616
74 Ga0075369_10123611 3300006186 Bacteria 1172
75 Ga0075369_10217565 3300006186 Bacteria 884
76 Ga0075366_10030991 3300006195 Bacteria 3146
77 Ga0075366_10293718 3300006195 Bacteria 994
78 Ga0075366_10489726 3300006195 Bacteria 760
79 Ga0097621_100184321 3300006237 Bacteria 1805
80 Ga0097621_101405964 3300006237 Bacteria 661
81 Ga0075370_10147138 3300006353 Bacteria 1379
82 Ga0075370_10388347 3300006353 Bacteria 836
83 Ga0068871_100124373 3300006358 Bacteria 2182
84 Ga0068871_100275006 3300006358 Bacteria 1472
85 Ga0099826_10051757 3300006948 Bacteria 2751
86 Ga0105251_10443489 3300009011 Bacteria 601
87 Ga0105244_10003202 3300009036 Bacteria 11867
88 Ga0105244_10095015 3300009036 Bacteria 1463
89 Ga0105240_11289286 3300009093 Bacteria 771
90 Ga0105240_11936418 3300009093 Bacteria 613
91 Ga0105245_11228246 3300009098 Bacteria 798
92 Ga0105245_12718418 3300009098 Bacteria 548
93 Ga0105247_10027595 3300009101 Bacteria 3432
94 Ga0105243_10064752 3300009148 Bacteria 2934
95 Ga0105243_10250772 3300009148 Bacteria 1580
96 Ga0105243_10552293 3300009148 Bacteria 1101
97 Ga0105242_10989008 3300009176 Bacteria 848
98 Ga0105242_11907683 3300009176 Bacteria 635
99 Ga0105248_10880740 3300009177 Bacteria 1011
100 Ga0105237_10011043 3300009545 Bacteria 9576
101 Ga0105237_10468076 3300009545 Bacteria 1266
102 Ga0105237_11202102 3300009545 Bacteria 765
103 Ga0105237_12677886 3300009545 Bacteria 510
104 Ga0105238_10150563 3300009551 Bacteria 2302
105 Ga0105238_10734567 3300009551 Bacteria 1000
106 Ga0105238_11178667 3300009551 Bacteria 790
107 Ga0105249_10468458 3300009553 Bacteria 1301
108 Ga0105239_10106059 3300010375 Bacteria 3112
109 Ga0105239_10327382 3300010375 Bacteria 1728
110 Ga0105239_11016642 3300010375 Unclassified 953
111 Ga0105239_12153575 3300010375 Bacteria 648
112 Ga0105246_10154937 3300011119 Bacteria 1739
113 Ga0105246_10616919 3300011119 Bacteria 939
114 Ga0157370_10849610 3300013104 Bacteria 829
115 Ga0157369_10206589 3300013105 Bacteria 2059
116 Ga0157374_10230305 3300013296 Bacteria 1820
117 Ga0157378_10768075 3300013297 Bacteria 988
118 Ga0157372_11782249 3300013307 Bacteria 708
119 Ga0157375_10207867 3300013308 Bacteria 2114
120 Ga0163163_11239018 3300014325 Bacteria 808
121 Ga0163163_13070920 3300014325 Bacteria 521
122 Ga0182008_10000357 3300014497 Bacteria 35568
123 Ga0182008_10100424 3300014497 Bacteria 1430
124 Ga0182008_10106835 3300014497 Bacteria 1385
125 Ga0182008_10146581 3300014497 Bacteria 1183
126 Ga0182008_10421689 3300014497 Bacteria 720
127 Ga0157379_10882479 3300014968 Bacteria 848
128 Ga0157379_11006937 3300014968 Bacteria 794
129 Ga0182006_1000002 3300015261 Bacteria 887990
130 Ga0182006_1006174 3300015261 Bacteria 5599
131 Ga0182006_1036027 3300015261 Bacteria 1969
132 Ga0182006_1083138 3300015261 Bacteria 1165
133 Ga0182007_10000072 3300015262 Bacteria 81814
134 Ga0182007_10009811 3300015262 Bacteria 3823
135 Ga0182007_10010709 3300015262 Bacteria 3608
136 Ga0182007_10011212 3300015262 Bacteria 3497
137 Ga0182005_1000029 3300015265 Bacteria 214132
138 Ga0182005_1000822 3300015265 Bacteria 13991
139 Ga0163161_10016825 3300017792 Bacteria 5112
140 Ga0163161_10456040 3300017792 Bacteria 1034
141 Ga0213876_10051756 3300021384 Bacteria 2170
142 Ga0209784_100004 3300025224 Bacteria 1378156
143 Ga0209566_100004 3300025225 Bacteria 1531866
144 Ga0209674_100006 3300025226 Bacteria 1531866
145 Ga0209672_114835 3300025228 Unclassified 890
146 Ga0209563_100009 3300025230 Bacteria 1378156
147 Ga0207427_100291 3300025231 Bacteria 35604
148 Ga0209437_100004 3300025233 Bacteria 1378156
149 Ga0209437_120323 3300025233 Bacteria 818
150 Ga0207425_1000474 3300025245 Bacteria 25484
151 Ga0209646_1000049 3300025246 Bacteria 301924
152 Ga0209677_100005 3300025253 Bacteria 1378156
153 Ga0209677_100744 3300025253 Bacteria 16516
154 Ga0209148_1041928 3300025254 Bacteria 629
155 Ga0209233_1000005 3300025261 Bacteria 1531866
156 Ga0209676_1000573 3300025292 Bacteria 55423
157 Ga0209676_1016075 3300025292 Bacteria 2722
158 Ga0209025_1005303 3300025294 Bacteria 10586
159 Ga0209564_1000002 3300025295 Bacteria 1636803
160 Ga0209758_1000265 3300025297 Bacteria 104078
161 Ga0209758_1001248 3300025297 Bacteria 31567
162 Ga0209050_1000460 3300025298 Bacteria 72933
163 Ga0209050_1020279 3300025298 Bacteria 2479
164 Ga0209051_1000441 3300025303 Bacteria 56405
165 Ga0209051_1002360 3300025303 Bacteria 13662
166 Ga0209257_1000057 3300025304 Bacteria 396985
167 Ga0209257_1014049 3300025304 Bacteria 3485
168 Ga0209257_1015575 3300025304 Bacteria 3152
169 Ga0207655_1004248 3300025728 Bacteria 10252
170 Ga0207692_10002227 3300025898 Bacteria 7421
171 Ga0207710_10032482 3300025900 Bacteria 2286
172 Ga0207647_10053319 3300025904 Bacteria 2492
173 Ga0207699_10001550 3300025906 Bacteria 10891
174 Ga0207695_11663707 3300025913 Bacteria 519
175 Ga0207671_10047788 3300025914 Bacteria 3167
176 Ga0207671_10155811 3300025914 Bacteria 1767
177 Ga0207671_10976133 3300025914 Bacteria 668
178 Ga0207693_10011501 3300025915 Bacteria 7158
179 Ga0207663_10153952 3300025916 Bacteria 1615
180 Ga0207663_10838099 3300025916 Bacteria 733
181 Ga0207657_10258138 3300025919 Bacteria 1387
182 Ga0207681_10888725 3300025923 Bacteria 746
183 Ga0207694_10316369 3300025924 Bacteria 1287
184 Ga0207700_10007535 3300025928 Bacteria 6660
185 Ga0207700_10134144 3300025928 Bacteria 2026
186 Ga0207664_10048422 3300025929 Bacteria 3342
187 Ga0207690_10002574 3300025932 Bacteria 10949
188 Ga0207690_10020905 3300025932 Unclassified 4051
189 Ga0207690_10781534 3300025932 Bacteria 788
190 Ga0207706_10005400 3300025933 Bacteria 11913
191 Ga0207706_10011853 3300025933 Bacteria 7937
192 Ga0207686_10307030 3300025934 Bacteria 1180
193 Ga0207709_10070630 3300025935 Bacteria 2215
194 Ga0207665_10026654 3300025939 Bacteria 3816
195 Ga0207679_10000864 3300025945 Bacteria 19388
196 Ga0207703_10182211 3300026035 Bacteria 1854
197 Ga0207703_10459407 3300026035 Bacteria 1191
198 Ga0207639_10245652 3300026041 Bacteria 1559
199 Ga0207639_10269547 3300026041 Bacteria 1493
200 Ga0207702_10784301 3300026078 Bacteria 942
201 Ga0207641_10320474 3300026088 Bacteria 1470
202 Ga0207641_10508519 3300026088 Bacteria 1171
203 Ga0207648_10124715 3300026089 Bacteria 2265
204 Ga0207674_10051822 3300026116 Bacteria 4187
205 Ga0207674_10607723 3300026116 Bacteria 1056
206 Ga0207683_11569114 3300026121 Bacteria 607
207 Ga0209813_10021403 3300027866 Bacteria 1818
208 Ga0209974_10076132 3300027876 Bacteria 1149
209 Ga0268266_10201458 3300028379 Bacteria 1822
210 Ga0268266_10634331 3300028379 Bacteria 1028
211 Ga0268264_10000153 3300028381 Bacteria 157298
212 Ga0268264_10996464 3300028381 Bacteria 844
213 Ga0265318_10149805 3300028577 Unclassified 856
214 Ga0307517_10378181 3300028786 Bacteria 758
215 Ga0307511_10000014 3300030521 Bacteria 127602
216 Ga0307511_10087724 3300030521 Bacteria 2133
217 Ga0307511_10097613 3300030521 Bacteria 1950
218 Ga0265330_10027227 3300031235 Bacteria 2583
219 Ga0265330_10064250 3300031235 Bacteria 1594
220 Ga0265332_10291061 3300031238 Bacteria 674
221 Ga0265325_10010454 3300031241 Bacteria 5374
222 Ga0265325_10012010 3300031241 Bacteria 4962
223 Ga0265340_10109808 3300031247 Bacteria 1276
224 Ga0265340_10188851 3300031247 Bacteria 929
225 Ga0265339_10113185 3300031249 Bacteria 1402
226 Ga0265331_10070112 3300031250 Unclassified 1641
227 Ga0265316_10048680 3300031344 Bacteria 3344
228 Ga0265316_10070861 3300031344 Bacteria 2688
229 Ga0307513_10430301 3300031456 Bacteria 1048
230 Ga0307509_10033194 3300031507 Bacteria 5681
231 Ga0307509_10304114 3300031507 Bacteria 1341
232 Ga0307508_10000009 3300031616 Bacteria 256966
233 Ga0307508_10069917 3300031616 Bacteria 3082
234 Ga0307508_10138116 3300031616 Bacteria 2040
235 Ga0265314_10109135 3300031711 Bacteria 1762
236 Ga0265342_10045287 3300031712 Bacteria 2649
237 Ga0307516_10014988 3300031730 Bacteria 8173
238 Ga0307516_10095616 3300031730 Bacteria 2793
239 Ga0307507_10023098 3300033179 Bacteria 6842
240 Ga0307507_10245614 3300033179 Bacteria 1164
241 Ga0307510_10008632 3300033180 Bacteria 12144
242 Ga0307510_10397309 3300033180 Bacteria 822
243 Ga0373934_0010218 3300035086 Bacteria 3523
244 Ga0373923_0100922 3300035111 Bacteria 1272
245 Ga0373936_0253631 3300035113 Bacteria 786
246 Ga0373953_0006562 3300035117 Bacteria 3842
247 Ga0373954_0000584 3300035118 Bacteria 13828
248 Ga0373954_0003159 3300035118 Bacteria 6963
249 Ga0373956_0002897 3300035119 Bacteria 6946
250 Ga0373957_0007168 3300035120 Bacteria 3555
251 Ga0373943_0209587 3300035170 Bacteria 1082
252 Ga0373955_0001386 3300035172 Bacteria 10297
253 Ga0373955_0012385 3300035172 Bacteria 4098
254 Ga0373924_0008307 3300035410 Bacteria 3768
255 Ga0373935_0022754 3300035692 Bacteria 3847
256 Ga0373935_0141768 3300035692 Bacteria 1624
257 Ga0373935_0428964 3300035692 Bacteria 952
258 Ga0373927_0192203 3300035695 Bacteria 1339
259 Ga0373927_0309828 3300035695 Bacteria 1039
260 Ga0373933_0005542 3300035724 Bacteria 6877
261 Ga0373933_0019974 3300035724 Bacteria 3792
262 Ga0373947_0023741 3300035725 Bacteria 3569
263 Ga0373937_0002028 3300036401 Bacteria 16914
264 Ga0373937_0014040 3300036401 Bacteria 7063
265 Ga0373925_0030797 3300037068 Bacteria 3939
266 Ga0395905_1587039 3300037471 Bacteria 559
267 Ga0436364_0086439 3300037853 Bacteria 554
268 Ga0436364_0947489 3300037853 Bacteria 4359
269 Ga0436365_1319655 3300039437 Bacteria 5117
270 Ga0436360_0101928 3300039438 Bacteria 814
271 Ga0436360_0321371 3300039438 Unclassified 1176
272 Ga0436360_1279581 3300039438 Bacteria 1286
273 Ga0436361_0432098 3300039447 Unclassified 570
274 Ga0436361_0513740 3300039447 Bacteria 868
275 Ga0436363_0623699 3300039450 Bacteria 559
276 Ga0436363_0688018 3300039450 Unclassified 1060
277 Ga0451833_0262796 3300041491 Bacteria 545
278 Ga0451839_0308465 3300041496 Bacteria 714
279 Ga0451845_0774461 3300041501 Bacteria 514
280 Ga0451853_3820061 3300041512 Bacteria 677
281 Ga0439458_0111805 3300042157 Bacteria 715
282 Ga0450893_0013950 3300042532 Bacteria 1343
283 Ga0451577_0000060 3300042876 Bacteria 268725
284 Ga0466965_0096073 3300044683 Unclassified 1512
285 Ga0466966_0025507 3300044684 Bacteria 3860
286 Ga0453684_0000211 3300044712 Bacteria 254993
287 Ga0466959_0018721 3300045049 Bacteria 5086
288 Ga0495592_0017995 3300046454 Bacteria 5368
289 Ga0495592_0023669 3300046454 Bacteria 4672
290 Ga0495592_0023775 3300046454 Bacteria 4661
291 Ga0495592_0078974 3300046454 Bacteria 2383
292 Ga0495590_0132311 3300046457 Bacteria 897
293 Ga0495629_0002194 3300046459 Bacteria 15062
294 Ga0495629_0004909 3300046459 Bacteria 10038
295 Ga0495629_0035323 3300046459 Bacteria 3532
296 Ga0495638_0005109 3300046460 Bacteria 9828
297 Ga0495641_0178272 3300046461 Bacteria 951
298 Ga0495651_0001006 3300046462 Bacteria 21897
299 Ga0495651_0001421 3300046462 Bacteria 18588
300 Ga0495651_0018674 3300046462 Bacteria 5372
301 Ga0495651_0281771 3300046462 Bacteria 1122
302 Ga0495651_0325787 3300046462 Bacteria 1022
303 Ga0495651_0327431 3300046462 Bacteria 1019
304 Ga0495653_0011823 3300046463 Bacteria 7128
305 Ga0495653_0030435 3300046463 Bacteria 4300
306 Ga0495653_0081016 3300046463 Bacteria 2399
307 Ga0495653_0297618 3300046463 Bacteria 1053
308 Ga0495582_0266714 3300046473 Unclassified 982
309 Ga0495605_0094144 3300046474 Bacteria 1384
310 Ga0495639_0025899 3300046475 Bacteria 2589
311 Ga0495662_0001507 3300046476 Bacteria 11559
312 Ga0495664_0003228 3300046477 Bacteria 8854
313 Ga0495664_0058143 3300046477 Bacteria 2300
314 Ga0495664_0381706 3300046477 Bacteria 847
315 Ga0495664_0454880 3300046477 Bacteria 766
316 Ga0495607_0256339 3300046501 Bacteria 840
317 Ga0495583_0012479 3300046506 Bacteria 4804
318 Ga0495606_0005632 3300046507 Bacteria 11878
319 Ga0495606_0285248 3300046507 Bacteria 901
320 Ga0495608_0002889 3300046511 Bacteria 12309
321 Ga0495608_0004042 3300046511 Bacteria 10529
322 Ga0495608_0019067 3300046511 Bacteria 4728
323 Ga0495608_0133989 3300046511 Bacteria 1584
324 Ga0495608_0282323 3300046511 Bacteria 1030
325 Ga0495608_0409078 3300046511 Unclassified 829
326 Ga0495616_0110719 3300046513 Bacteria 1276
327 Ga0495618_0000741 3300046514 Bacteria 22826
328 Ga0495618_0104302 3300046514 Bacteria 1815
329 Ga0495618_0373857 3300046514 Bacteria 875
330 Ga0495618_0425228 3300046514 Bacteria 809
331 Ga0495628_0005140 3300046516 Bacteria 11501
332 Ga0495628_0008625 3300046516 Bacteria 8734
333 Ga0495628_0020789 3300046516 Bacteria 5408
334 Ga0495628_0292072 3300046516 Bacteria 1208
335 Ga0495628_0418137 3300046516 Bacteria 977
336 Ga0495630_1205493 3300046517 Bacteria 572
337 Ga0495648_0026027 3300046524 Bacteria 3947
338 Ga0495648_0428635 3300046524 Unclassified 584
339 Ga0495652_0025881 3300046529 Bacteria 5184
340 Ga0495652_0027255 3300046529 Bacteria 5036
341 Ga0495652_0038419 3300046529 Bacteria 4147
342 Ga0495652_0112553 3300046529 Bacteria 2186
343 Ga0495652_0380727 3300046529 Bacteria 1003
344 Ga0495654_0151989 3300046530 Bacteria 1023
345 Ga0495665_0056090 3300046531 Bacteria 2080
346 Ga0495640_0005375 3300046533 Bacteria 10189
347 Ga0495640_0012625 3300046533 Bacteria 6448
348 Ga0495640_0016059 3300046533 Bacteria 5612
349 Ga0495640_0025251 3300046533 Bacteria 4312
350 Ga0495587_0007946 3300046536 Bacteria 6853
351 Ga0495587_0010989 3300046536 Bacteria 5743
352 Ga0495587_0022631 3300046536 Bacteria 3868
353 Ga0495597_0166986 3300046542 Bacteria 895
354 Ga0495645_0016180 3300046543 Bacteria 5319
355 Ga0495645_0033417 3300046543 Bacteria 3753
356 Ga0495645_0050856 3300046543 Bacteria 3015
357 Ga0495622_0029475 3300046557 Bacteria 2564
358 Ga0495622_0050878 3300046557 Bacteria 1922
359 Ga0495667_0000654 3300046559 Bacteria 22139
360 Ga0495667_0066680 3300046559 Bacteria 2352
361 Ga0495667_0123246 3300046559 Bacteria 1673
362 Ga0495667_0127106 3300046559 Bacteria 1644
363 Ga0495656_0177920 3300046615 Bacteria 1044
364 Ga0495668_0018238 3300046616 Bacteria 4056
365 Ga0495668_0032038 3300046616 Bacteria 2960
366 Ga0495668_0232852 3300046616 Bacteria 1009
367 Ga0495634_0004062 3300046642 Bacteria 11588
368 Ga0495634_0275094 3300046642 Bacteria 1024
369 Ga0495634_0291976 3300046642 Unclassified 988
370 Ga0495634_0326124 3300046642 Bacteria 923
371 Ga0495634_0724284 3300046642 Bacteria 571
372 Ga0495625_0031122 3300046660 Bacteria 3972
373 Ga0495625_0085262 3300046660 Bacteria 2193
374 Ga0495625_0142343 3300046660 Bacteria 1617
375 Ga0495625_0227528 3300046660 Bacteria 1219
376 Ga0495625_0263694 3300046660 Bacteria 1114
377 Ga0495635_0001817 3300046663 Bacteria 14418
378 Ga0495635_0001940 3300046663 Bacteria 14058
379 Ga0495635_0003108 3300046663 Bacteria 11421
380 Ga0495635_0037386 3300046663 Bacteria 3361
381 Ga0495635_0187665 3300046663 Unclassified 1404
382 Ga0495588_0125166 3300046674 Bacteria 1355
383 Ga0495588_0183715 3300046674 Bacteria 1105
384 Ga0495657_0020044 3300046675 Bacteria 4813
385 Ga0495657_0021323 3300046675 Bacteria 4649
386 Ga0495657_0026418 3300046675 Bacteria 4111
387 Ga0495657_0027076 3300046675 Bacteria 4051
388 Ga0495657_0039925 3300046675 Bacteria 3222
389 Ga0495657_0253319 3300046675 Bacteria 1059
390 Ga0495599_0005427 3300046678 Bacteria 7619
391 Ga0495599_0006485 3300046678 Bacteria 7062
392 Ga0495599_0012882 3300046678 Bacteria 5161
393 Ga0495599_0239185 3300046678 Bacteria 1107
394 Ga0495623_0003554 3300046679 Bacteria 10313
395 Ga0495623_0011556 3300046679 Bacteria 5715
396 Ga0495623_0013037 3300046679 Bacteria 5383
397 Ga0495623_0449811 3300046679 Bacteria 686
398 Ga0495646_0001331 3300046680 Bacteria 14585
399 Ga0495646_0015943 3300046680 Bacteria 4769
400 Ga0495646_0028720 3300046680 Bacteria 3481
401 Ga0495646_0038820 3300046680 Bacteria 2938
402 Ga0495647_0231884 3300046681 Bacteria 817
403 Ga0495658_0009649 3300046683 Bacteria 4813
404 Ga0495658_0056970 3300046683 Bacteria 2231
405 Ga0495669_0209859 3300046684 Bacteria 932
406 Ga0495613_0109643 3300046689 Bacteria 1990
407 Ga0495613_0174371 3300046689 Bacteria 1525
408 Ga0495613_0218520 3300046689 Bacteria 1338
409 Ga0495613_0333364 3300046689 Bacteria 1045
410 Ga0495624_0009016 3300046690 Bacteria 6933
411 Ga0495624_0014746 3300046690 Bacteria 5292
412 Ga0495670_0186519 3300046691 Unclassified 1096
413 Ga0495671_0039479 3300046692 Bacteria 2383
414 Ga0495649_0051765 3300046694 Bacteria 2226
415 Ga0495600_0017015 3300046809 Bacteria 4621
416 Ga0495600_0033575 3300046809 Bacteria 3331
417 Ga0495600_0040439 3300046809 Bacteria 3036
418 Ga0495600_0042899 3300046809 Bacteria 2949
419 Ga0495600_0167162 3300046809 Bacteria 1420
420 Ga0495600_0420431 3300046809 Unclassified 829
421 Ga0495660_0251165 3300046810 Bacteria 820
422 Ga0495581_0279515 3300047315 Bacteria 976
423 Ga0495604_0001231 3300047317 Bacteria 20971
424 Ga0495604_0001719 3300047317 Bacteria 17960
425 Ga0495604_0007296 3300047317 Bacteria 8752
426 Ga0495604_0052710 3300047317 Bacteria 3148
427 Ga0495604_0092930 3300047317 Bacteria 2233
428 Ga0495604_0114097 3300047317 Bacteria 1965
429 Ga0495674_0002137 3300047319 Bacteria 19412
430 Ga0495674_0014903 3300047319 Bacteria 7274
431 Ga0495674_0093233 3300047319 Bacteria 2570
432 Ga0495674_0299855 3300047319 Bacteria 1313
433 Ga0495676_0008971 3300047321 Bacteria 9127
434 Ga0495676_0054832 3300047321 Bacteria 3166
435 Ga0495676_0416836 3300047321 Unclassified 889
436 Ga0495680_0002906 3300047322 Bacteria 17209
437 Ga0495680_0018086 3300047322 Bacteria 5997
438 Ga0495680_0036768 3300047322 Bacteria 3927
439 Ga0495683_0079575 3300047323 Bacteria 1600
440 Ga0495675_0005020 3300047444 Bacteria 8051
441 Ga0495675_0017647 3300047444 Bacteria 4525
442 Ga0495673_0292572 3300047469 Bacteria 585
443 Ga0495684_0002299 3300047471 Bacteria 15301
444 Ga0495684_0003481 3300047471 Bacteria 12321
445 Ga0495684_0147368 3300047471 Bacteria 1762
446 Ga0495686_0100894 3300047472 Bacteria 1741
447 Ga0495593_0008924 3300047673 Bacteria 5819
448 Ga0495602_0011794 3300048088 Bacteria 9027
449 Ga0495602_0027242 3300048088 Bacteria 5495
450 Ga0495602_0027935 3300048088 Bacteria 5411
451 Ga0495602_0342640 3300048088 Unclassified 1081
452 Ga0495602_0690488 3300048088 Bacteria 693
453 Ga0495602_0755679 3300048088 Bacteria 656
454 Ga0495614_0325475 3300048089 Bacteria 713
455 Ga0496100_0255821 3300048903 Bacteria 1297
456 Ga0496100_0280065 3300048903 Bacteria 1243
457 Ga0496100_0792492 3300048903 Bacteria 742
458 Ga0496102_1392705 3300048905 Bacteria 620
459 Ga0496103_0448429 3300048906 Bacteria 828
460 Ga0496104_0008588 3300048907 Bacteria 9085
461 Ga0496105_0009824 3300048908 Bacteria 7498
462 Ga0496106_0001072 3300048909 Bacteria 20176
463 Ga0496106_0516321 3300048909 Bacteria 959
464 Ga0496107_0255517 3300048910 Bacteria 1304
465 Ga0496107_0520346 3300048910 Bacteria 882
466 Ga0496108_0544537 3300048911 Bacteria 1013
467 Ga0496109_0735387 3300048912 Bacteria 924
468 Ga0496110_0150999 3300048913 Bacteria 2104
469 Ga0496111_0344873 3300048914 Bacteria 1103
470 Ga0496111_0363004 3300048914 Bacteria 1072
471 Ga0496112_0024034 3300048915 Bacteria 5832
472 Ga0496112_0706831 3300048915 Bacteria 936
473 Ga0496112_0803401 3300048915 Bacteria 865
474 Ga0496113_0005589 3300048916 Bacteria 7860
475 Ga0496113_0103834 3300048916 Bacteria 2205
476 Ga0496114_0201129 3300048917 Bacteria 1745
477 Ga0496114_0351545 3300048917 Bacteria 1304
478 Ga0496115_0065521 3300048918 Bacteria 2934
479 Ga0496115_0182379 3300048918 Bacteria 1735
480 Ga0496115_0546085 3300048918 Bacteria 927
481 Ga0496116_0055736 3300048919 Bacteria 2595
482 Ga0496117_0000001 3300048920 Bacteria 2526244
483 Ga0496117_0019280 3300048920 Bacteria 5610
484 Ga0496117_0075953 3300048920 Bacteria 2230
485 Ga0496117_0113493 3300048920 Bacteria 1682
486 Ga0496118_0000008 3300048921 Bacteria 644537
487 Ga0496118_0002820 3300048921 Bacteria 22739
488 Ga0496118_0037839 3300048921 Bacteria 3876
489 Ga0496118_0096156 3300048921 Bacteria 2019
490 Ga0496118_0112142 3300048921 Bacteria 1806
491 Ga0496118_0292525 3300048921 Bacteria 899
492 Ga0496119_0004149 3300048922 Bacteria 14581
493 Ga0496119_0027920 3300048922 Bacteria 3865
494 Ga0496119_0426901 3300048922 Unclassified 628
495 Ga0496120_0010110 3300048923 Bacteria 6611
496 Ga0496120_0020017 3300048923 Bacteria 4264
497 Ga0496121_0001728 3300048924 Bacteria 35654
498 Ga0496121_0002189 3300048924 Bacteria 30586
499 Ga0496121_0002860 3300048924 Bacteria 25453
500 Ga0496121_0023933 3300048924 Bacteria 5857
501 Ga0496121_0087579 3300048924 Bacteria 2444
502 Ga0496121_0104555 3300048924 Bacteria 2175
503 Ga0496121_0140140 3300048924 Bacteria 1795
504 Ga0496121_0222977 3300048924 Bacteria 1326
505 Ga0496122_0005214 3300048925 Bacteria 15597
506 Ga0496123_0009019 3300048926 Bacteria 9047
507 Ga0496123_0289613 3300048926 Bacteria 787
508 Ga0496124_0000916 3300048927 Bacteria 47613
509 Ga0496124_0119508 3300048927 Bacteria 2108
510 Ga0496124_0255698 3300048927 Bacteria 1292
511 Ga0496124_0324533 3300048927 Bacteria 1101
512 Ga0496125_0042013 3300048928 Bacteria 3901
513 Ga0496125_0087442 3300048928 Bacteria 2354
514 Ga0496125_0146749 3300048928 Bacteria 1629
515 Ga0496126_0005239 3300048929 Bacteria 14926
516 Ga0496126_0024537 3300048929 Bacteria 5819
517 Ga0496126_0036557 3300048929 Bacteria 4590
518 Ga0496126_0917427 3300048929 Bacteria 663
519 Ga0495682_0021623 3300049460 Bacteria 2409
520 Ga0501069_0219032 3300049585 Bacteria 1106
521 Ga0501069_0366020 3300049585 Bacteria 851
522 Ga0501207_011694 3300049654 Bacteria 1310
523 Ga0501230_060471 3300049667 Unclassified 766
524 Ga0501263_000853 3300049760 Unclassified 2605
525 nmdc:mga03683_279212_c1 3300050489 Bacteria 780
526 nmdc:mga03683_7659_c1 3300050489 Bacteria 3760
527 nmdc:mga03n38_172766_c1 3300050490 Bacteria 1102
528 nmdc:mga03n38_632483_c1 3300050490 Bacteria 612
529 nmdc:mga00v17_23257_c1 3300050491 Bacteria 3584
530 nmdc:mga00v17_232777_c1 3300050491 Bacteria 1194
531 nmdc:mga00v17_840509_c1 3300050491 Bacteria 583
532 nmdc:mga0yw44_84439_c1 3300050492 Bacteria 1996
533 nmdc:mga0k408_11011_c1 3300050493 Bacteria 4910
534 nmdc:mga0k408_161193_c1 3300050493 Bacteria 1336
535 nmdc:mga06z11_386344_c1 3300050494 Bacteria 841
536 nmdc:mga06z11_39616_c1 3300050494 Bacteria 2346
537 nmdc:mga04h51_33427_c1 3300050495 Bacteria 1637
538 nmdc:mga04h51_442527_c1 3300050495 Bacteria 549
539 nmdc:mga07m45_216703_c1 3300050496 Bacteria 1113
540 nmdc:mga07m45_477621_c1 3300050496 Bacteria 722
541 nmdc:mga0sz30_110790_c1 3300050516 Unclassified 910
542 nmdc:mga0sz30_27992_c1 3300050516 Bacteria 2317
543 Ga0495601_0004876 3300053077 Bacteria 7788
544 Ga0495601_0006948 3300053077 Bacteria 6629
545 Ga0495601_0014495 3300053077 Bacteria 4751
546 Ga0495601_0927372 3300053077 Bacteria 549
547 Ga0495612_0005438 3300053078 Bacteria 5265
548 Ga0495612_0160381 3300053078 Bacteria 982
549 Ga0500610_0074907 3300053079 Bacteria 1765
550 Ga0495655_0015942 3300053083 Bacteria 1608
551 Ga0495595_0002007 3300053084 Bacteria 7907
552 Ga0495595_0005927 3300053084 Bacteria 4956
553 Ga0495595_0173339 3300053084 Bacteria 1068
554 Ga0495619_0004943 3300053085 Bacteria 8466
555 Ga0495619_0031133 3300053085 Bacteria 3455
556 Ga0495619_0129026 3300053085 Bacteria 1737
557 Ga0495619_0238668 3300053085 Unclassified 1260
558 Ga0495619_0532972 3300053085 Bacteria 806
559 Ga0495619_0810358 3300053085 Bacteria 633
560 Ga0500644_0537206 3300053088 Bacteria 516
561 Ga0500646_0002045 3300053090 Bacteria 5262
562 Ga0500583_0000783 3300053092 Bacteria 9219
563 Ga0500651_0299680 3300053093 Bacteria 922
564 Ga0500566_0000394 3300053094 Bacteria 24254
565 Ga0500566_0131216 3300053094 Bacteria 1340
566 Ga0500640_002770 3300053095 Bacteria 5900
567 Ga0500556_0062317 3300053104 Bacteria 1376
568 Ga0500571_000024 3300053110 Bacteria 52195
569 Ga0500572_000156 3300053111 Bacteria 23706
570 Ga0500591_139102 3300053115 Bacteria 962
571 Ga0500593_000323 3300053117 Bacteria 19241
572 Ga0500595_001575 3300053119 Bacteria 12051
573 Ga0500595_001671 3300053119 Bacteria 11662
574 Ga0500595_030879 3300053119 Bacteria 1801
575 Ga0500595_087074 3300053119 Bacteria 908
576 Ga0500607_000025 3300053121 Bacteria 95473
577 Ga0500608_039947 3300053122 Bacteria 2247
578 Ga0500608_094009 3300053122 Bacteria 1397
579 Ga0500614_000121 3300053123 Bacteria 18796
580 Ga0500642_0018075 3300053130 Unclassified 2718
581 Ga0500642_0239975 3300053130 Bacteria 835
582 Ga0500642_0437289 3300053130 Bacteria 564
583 Ga0500658_0009176 3300053134 Bacteria 3650
584 Ga0500559_0001182 3300053136 Bacteria 15606
585 Ga0500559_0037155 3300053136 Bacteria 2110
586 Ga0500564_052772 3300053138 Bacteria 1857
587 Ga0500573_0091598 3300053140 Bacteria 1716
588 Ga0500574_000848 3300053141 Bacteria 4167
589 Ga0500574_179982 3300053141 Bacteria 606
590 Ga0500577_0028657 3300053142 Bacteria 1920
591 Ga0500577_0256715 3300053142 Bacteria 760
592 Ga0500577_0284874 3300053142 Bacteria 720
593 Ga0500585_187648 3300053144 Bacteria 697
594 Ga0500586_031001 3300053145 Bacteria 1762
595 Ga0500590_018783 3300053148 Bacteria 3580
596 Ga0500590_098043 3300053148 Bacteria 1412
597 Ga0500603_000224 3300053150 Bacteria 14919
598 Ga0500603_085693 3300053150 Bacteria 919
599 Ga0500604_0004510 3300053151 Bacteria 3692
600 Ga0500604_0110061 3300053151 Bacteria 914
601 Ga0500616_0002571 3300053153 Bacteria 14937
602 Ga0500616_0004212 3300053153 Bacteria 10366
603 Ga0500619_000430 3300053154 Bacteria 7590
604 Ga0500619_278490 3300053154 Bacteria 545
605 Ga0500620_004709 3300053155 Bacteria 3078
606 Ga0500622_0300843 3300053156 Bacteria 684
607 Ga0500627_0077220 3300053158 Bacteria 1481
608 Ga0500630_000834 3300053159 Bacteria 14264
609 Ga0500638_005764 3300053162 Bacteria 4984
610 Ga0500638_075341 3300053162 Bacteria 1608
611 Ga0500639_002819 3300053163 Bacteria 8743
612 Ga0500636_0018057 3300053177 Bacteria 4170
613 Ga0500636_0063306 3300053177 Bacteria 2155
614 Ga0500636_0304305 3300053177 Unclassified 783
615 Ga0500649_070145 3300053722 Bacteria 1447
616 Ga0500552_005361 3300053733 Bacteria 1394
617 Ga0500552_035465 3300053733 Bacteria 789
618 Ga0500596_000685 3300053735 Bacteria 6593
619 Ga0500596_001137 3300053735 Bacteria 5360
620 Ga0500596_017239 3300053735 Bacteria 1083
621 Ga0500601_009020 3300053737 Bacteria 1111
622 Ga0500661_040734 3300055283 Bacteria 823

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 3005416602 3005417420 126
2 iso_pu_bacteria 8005314921 8005315791 126
3 iso_pu_bacteria 2519899620 2520380232 127
4 iso_pu_bacteria 2523231067 2523470840 127
5 iso_pu_bacteria 2582581307 2585276653 127
6 iso_pu_bacteria 2615840698 2616554272 127
7 iso_pu_bacteria 2643221672 2644399138 127
8 iso_pu_bacteria 2738543031 2739351415 127
9 iso_pu_bacteria 2775507266 2778175457 127
10 iso_pu_bacteria 2841846520 2841847419 127
11 iso_pu_bacteria 2842124991 2842126551 127
12 iso_pu_bacteria 2852387548 2852388517 127
13 iso_pu_bacteria 2919171160 2919175987 127
14 iso_pu_bacteria 2937822353 2937824464 127
15 iso_pu_bacteria 2945945610 2945946265 127
16 3300046454 Ga0495592_0023775 Ga0495592_0023775_3874_4260 128
17 3300046462 Ga0495651_0001421 Ga0495651_0001421_2051_2437 128
18 3300046463 Ga0495653_0297618 Ga0495653_0297618_84_470 128
19 3300046477 Ga0495664_0058143 Ga0495664_0058143_1398_1784 128
20 3300046511 Ga0495608_0282323 Ga0495608_0282323_93_479 128
21 3300046516 Ga0495628_0292072 Ga0495628_0292072_546_932 128
22 3300046529 Ga0495652_0038419 Ga0495652_0038419_1659_2045 128
23 3300046533 Ga0495640_0025251 Ga0495640_0025251_2933_3319 128
24 3300046536 Ga0495587_0007946 Ga0495587_0007946_1762_2148 128
25 3300046559 Ga0495667_0127106 Ga0495667_0127106_1212_1598 128
26 3300046642 Ga0495634_0326124 Ga0495634_0326124_445_831 128
27 3300046663 Ga0495635_0037386 Ga0495635_0037386_2691_3077 128
28 3300046675 Ga0495657_0020044 Ga0495657_0020044_538_924 128
29 3300046678 Ga0495599_0239185 Ga0495599_0239185_376_762 128
30 3300046679 Ga0495623_0003554 Ga0495623_0003554_235_621 128
31 3300046680 Ga0495646_0028720 Ga0495646_0028720_1921_2307 128
32 3300046689 Ga0495613_0333364 Ga0495613_0333364_467_853 128
33 3300046809 Ga0495600_0033575 Ga0495600_0033575_1479_1865 128
34 3300047317 Ga0495604_0001719 Ga0495604_0001719_9189_9575 128
35 3300047319 Ga0495674_0014903 Ga0495674_0014903_1371_1757 128
36 3300047322 Ga0495680_0018086 Ga0495680_0018086_3850_4236 128
37 3300048088 Ga0495602_0027935 Ga0495602_0027935_3172_3558 128
38 3300053085 Ga0495619_0129026 Ga0495619_0129026_109_495 128
39 iso_pu_bacteria 2503198000 2503201535 128
40 iso_pu_bacteria 2756170246 2756675465 128
41 iso_pu_bacteria 2791355123 2792749242 128
42 3300048903 Ga0496100_0255821 Ga0496100_0255821_599_988 129
43 3300048915 Ga0496112_0024034 Ga0496112_0024034_2950_3339 129
44 3300048916 Ga0496113_0103834 Ga0496113_0103834_309_698 129
45 3300005434 Ga0070709_10000528 Ga0070709_100005284 130
46 3300005435 Ga0070714_100034186 Ga0070714_1000341863 130
47 3300005436 Ga0070713_100032274 Ga0070713_1000322744 130
48 3300005436 Ga0070713_100250661 Ga0070713_1002506613 130
49 3300005437 Ga0070710_10001256 Ga0070710_100012563 130
50 3300005439 Ga0070711_100030122 Ga0070711_1000301222 130
51 3300006028 Ga0070717_11841154 Ga0070717_118411541 130
52 3300006038 Ga0075365_10074516 Ga0075365_100745163 130
53 3300006038 Ga0075365_10206026 Ga0075365_102060263 130
54 3300006051 Ga0075364_11215812 Ga0075364_112158121 130
55 3300006173 Ga0070716_100001221 Ga0070716_1000012213 130
56 3300006175 Ga0070712_100261448 Ga0070712_1002614483 130
57 3300006175 Ga0070712_100471873 Ga0070712_1004718732 130
58 3300006177 Ga0075362_10047263 Ga0075362_100472633 130
59 3300006186 Ga0075369_10123611 Ga0075369_101236111 130
60 3300006186 Ga0075369_10217565 Ga0075369_102175651 130
61 3300009148 Ga0105243_10552293 Ga0105243_105522932 130
62 3300009176 Ga0105242_10989008 Ga0105242_109890082 130
63 3300009551 Ga0105238_10734567 Ga0105238_107345672 130
64 3300009553 Ga0105249_10468458 Ga0105249_104684582 130
65 3300010375 Ga0105239_12153575 Ga0105239_121535751 130
66 3300013297 Ga0157378_10768075 Ga0157378_107680752 130
67 3300025898 Ga0207692_10002227 Ga0207692_100022276 130
68 3300025906 Ga0207699_10001550 Ga0207699_100015504 130
69 3300025915 Ga0207693_10011501 Ga0207693_100115014 130
70 3300025916 Ga0207663_10153952 Ga0207663_101539523 130
71 3300025923 Ga0207681_10888725 Ga0207681_108887252 130
72 3300025928 Ga0207700_10007535 Ga0207700_100075354 130
73 3300025928 Ga0207700_10134144 Ga0207700_101341443 130
74 3300025929 Ga0207664_10048422 Ga0207664_100484223 130
75 3300025939 Ga0207665_10026654 Ga0207665_100266544 130
76 3300028379 Ga0268266_10634331 Ga0268266_106343312 130
77 3300039438 Ga0436360_1279581 Ga0436360_1279581_53_481 130
78 3300041496 Ga0451839_0308465 Ga0451839_0308465_95_487 130
79 3300046616 Ga0495668_0232852 Ga0495668_0232852_411_803 130
80 3300048924 Ga0496121_0222977 Ga0496121_0222977_147_539 130
81 3300049585 Ga0501069_0366020 Ga0501069_0366020_285_677 130
82 3300050489 nmdc:mga03683_7659_c1 nmdc:mga03683_7659_c1_2803_3195 130
83 3300050491 nmdc:mga00v17_232777_c1 nmdc:mga00v17_232777_c1_31_423 130
84 3300050491 nmdc:mga00v17_840509_c1 nmdc:mga00v17_840509_c1_152_544 130
85 3300050492 nmdc:mga0yw44_84439_c1 nmdc:mga0yw44_84439_c1_266_658 130
86 3300050516 nmdc:mga0sz30_27992_c1 nmdc:mga0sz30_27992_c1_613_1005 130
87 3300053151 Ga0500604_0110061 Ga0500604_0110061_330_722 130
88 3300053155 Ga0500620_004709 Ga0500620_004709_258_650 130
89 3300053158 Ga0500627_0077220 Ga0500627_0077220_399_791 130
90 iso_pu_bacteria 2513237094 2513640747 130
91 iso_pu_bacteria 2818991436 2819541604 130
92 iso_pu_bacteria 2844002411 2844007422 130
93 iso_pu_bacteria 2844315083 2844315959 130
94 iso_pu_bacteria 2903727486 2903731908 130
95 iso_pu_bacteria 2906602504 2906606151 130
96 iso_pu_bacteria 8019648815 8019653096 130
97 iso_pu_bacteria 8056967851 8056970735 130
98 3300002737 JGI25162J39368_1024205 JGI25162J39368_10242052 131
99 3300002738 JGI25154J39366_1000336 JGI25154J39366_10003362 131
100 3300003215 JGI25153J46596_10011363 JGI25153J46596_100113632 131
101 3300003322 rootL2_10164609 rootL2_101646095 131
102 3300003323 rootH1_10264619 rootH1_102646191 131
103 3300003771 Ga0055526_1000016 Ga0055526_1000016114 131
104 3300003781 Ga0055536_1000955 Ga0055536_100095510 131
105 3300003781 Ga0055536_1001688 Ga0055536_10016885 131
106 3300003791 Ga0055530_10005038 Ga0055530_100050385 131
107 3300003792 Ga0055540_1000747 Ga0055540_100074714 131
108 3300003792 Ga0055540_1056135 Ga0055540_10561351 131
109 3300003794 Ga0055531_10001032 Ga0055531_1000103214 131
110 3300003794 Ga0055531_10004663 Ga0055531_100046632 131
111 3300005288 Ga0065714_10002968 Ga0065714_1000296813 131
112 3300005334 Ga0068869_101472821 Ga0068869_1014728211 131
113 3300005339 Ga0070660_100613701 Ga0070660_1006137012 131
114 3300005457 Ga0070662_100048463 Ga0070662_1000484632 131
115 3300005577 Ga0068857_100056676 Ga0068857_1000566762 131
116 3300005578 Ga0068854_101667120 Ga0068854_1016671201 131
117 3300005616 Ga0068852_100759879 Ga0068852_1007598792 131
118 3300005842 Ga0068858_100663878 Ga0068858_1006638782 131
119 3300006058 Ga0075432_10457847 Ga0075432_104578471 131
120 3300006195 Ga0075366_10030991 Ga0075366_100309918 131
121 3300006237 Ga0097621_100184321 Ga0097621_1001843212 131
122 3300006353 Ga0075370_10147138 Ga0075370_101471382 131
123 3300006353 Ga0075370_10388347 Ga0075370_103883472 131
124 3300006358 Ga0068871_100275006 Ga0068871_1002750063 131
125 3300006948 Ga0099826_10051757 Ga0099826_100517572 131
126 3300009011 Ga0105251_10443489 Ga0105251_104434891 131
127 3300009036 Ga0105244_10003202 Ga0105244_100032028 131
128 3300009036 Ga0105244_10095015 Ga0105244_100950151 131
129 3300009098 Ga0105245_12718418 Ga0105245_127184181 131
130 3300009148 Ga0105243_10064752 Ga0105243_100647525 131
131 3300009148 Ga0105243_10250772 Ga0105243_102507721 131
132 3300009176 Ga0105242_11907683 Ga0105242_119076832 131
133 3300009545 Ga0105237_12677886 Ga0105237_126778861 131
134 3300011119 Ga0105246_10154937 Ga0105246_101549372 131
135 3300013104 Ga0157370_10849610 Ga0157370_108496101 131
136 3300014497 Ga0182008_10000357 Ga0182008_100003576 131
137 3300014497 Ga0182008_10100424 Ga0182008_101004241 131
138 3300014497 Ga0182008_10146581 Ga0182008_101465812 131
139 3300015261 Ga0182006_1000002 Ga0182006_100000262 131
140 3300015261 Ga0182006_1006174 Ga0182006_10061748 131
141 3300015262 Ga0182007_10000072 Ga0182007_1000007215 131
142 3300015262 Ga0182007_10011212 Ga0182007_100112122 131
143 3300015265 Ga0182005_1000029 Ga0182005_1000029117 131
144 3300017792 Ga0163161_10016825 Ga0163161_100168254 131
145 3300025228 Ga0209672_114835 Ga0209672_1148352 131
146 3300025233 Ga0209437_120323 Ga0209437_1203232 131
147 3300025246 Ga0209646_1000049 Ga0209646_1000049140 131
148 3300025292 Ga0209676_1000573 Ga0209676_100057337 131
149 3300025292 Ga0209676_1016075 Ga0209676_10160753 131
150 3300025295 Ga0209564_1000002 Ga0209564_10000021293 131
151 3300025297 Ga0209758_1000265 Ga0209758_100026594 131
152 3300025298 Ga0209050_1000460 Ga0209050_100046056 131
153 3300025298 Ga0209050_1020279 Ga0209050_10202792 131
154 3300025303 Ga0209051_1000441 Ga0209051_100044116 131
155 3300025303 Ga0209051_1002360 Ga0209051_100236015 131
156 3300025304 Ga0209257_1000057 Ga0209257_1000057382 131
157 3300025304 Ga0209257_1014049 Ga0209257_10140496 131
158 3300025304 Ga0209257_1015575 Ga0209257_10155752 131
159 3300025728 Ga0207655_1004248 Ga0207655_10042483 131
160 3300025932 Ga0207690_10781534 Ga0207690_107815342 131
161 3300025933 Ga0207706_10011853 Ga0207706_100118539 131
162 3300025935 Ga0207709_10070630 Ga0207709_100706303 131
163 3300026089 Ga0207648_10124715 Ga0207648_101247152 131
164 3300026116 Ga0207674_10051822 Ga0207674_100518224 131
165 3300027876 Ga0209974_10076132 Ga0209974_100761322 131
166 3300031235 Ga0265330_10064250 Ga0265330_100642501 131
167 3300031241 Ga0265325_10010454 Ga0265325_100104544 131
168 3300031247 Ga0265340_10109808 Ga0265340_101098082 131
169 3300031247 Ga0265340_10188851 Ga0265340_101888511 131
170 3300031249 Ga0265339_10113185 Ga0265339_101131852 131
171 3300031344 Ga0265316_10048680 Ga0265316_100486803 131
172 3300031616 Ga0307508_10138116 Ga0307508_101381163 131
173 3300031711 Ga0265314_10109135 Ga0265314_101091352 131
174 3300042532 Ga0450893_0013950 Ga0450893_0013950_790_1185 131
175 3300046459 Ga0495629_0035323 Ga0495629_0035323_2580_2975 131
176 3300046460 Ga0495638_0005109 Ga0495638_0005109_7427_7822 131
177 3300046473 Ga0495582_0266714 Ga0495582_0266714_481_876 131
178 3300046476 Ga0495662_0001507 Ga0495662_0001507_7565_7960 131
179 3300046511 Ga0495608_0409078 Ga0495608_0409078_46_441 131
180 3300046524 Ga0495648_0428635 Ga0495648_0428635_163_558 131
181 3300046530 Ga0495654_0151989 Ga0495654_0151989_449_844 131
182 3300046557 Ga0495622_0029475 Ga0495622_0029475_22_417 131
183 3300046615 Ga0495656_0177920 Ga0495656_0177920_323_718 131
184 3300046642 Ga0495634_0291976 Ga0495634_0291976_327_722 131
185 3300046660 Ga0495625_0085262 Ga0495625_0085262_419_814 131
186 3300046660 Ga0495625_0142343 Ga0495625_0142343_449_844 131
187 3300046660 Ga0495625_0227528 Ga0495625_0227528_495_893 131
188 3300046663 Ga0495635_0187665 Ga0495635_0187665_648_1043 131
189 3300046674 Ga0495588_0183715 Ga0495588_0183715_297_692 131
190 3300046675 Ga0495657_0026418 Ga0495657_0026418_2047_2442 131
191 3300046809 Ga0495600_0420431 Ga0495600_0420431_272_667 131
192 3300047317 Ga0495604_0007296 Ga0495604_0007296_6670_7065 131
193 3300047321 Ga0495676_0008971 Ga0495676_0008971_2842_3237 131
194 3300048088 Ga0495602_0342640 Ga0495602_0342640_673_1068 131
195 3300048906 Ga0496103_0448429 Ga0496103_0448429_64_459 131
196 3300048914 Ga0496111_0344873 Ga0496111_0344873_20_415 131
197 3300048920 Ga0496117_0000001 Ga0496117_0000001_2018469_2018864 131
198 3300048920 Ga0496117_0075953 Ga0496117_0075953_1324_1779 131
199 3300048920 Ga0496117_0113493 Ga0496117_0113493_31_426 131
200 3300048921 Ga0496118_0000008 Ga0496118_0000008_136762_137157 131
201 3300048921 Ga0496118_0037839 Ga0496118_0037839_3152_3607 131
202 3300048921 Ga0496118_0096156 Ga0496118_0096156_1409_1804 131
203 3300048922 Ga0496119_0027920 Ga0496119_0027920_2293_2688 131
204 3300048924 Ga0496121_0001728 Ga0496121_0001728_16844_17299 131
205 3300048924 Ga0496121_0002860 Ga0496121_0002860_10217_10612 131
206 3300048924 Ga0496121_0140140 Ga0496121_0140140_240_635 131
207 3300048925 Ga0496122_0005214 Ga0496122_0005214_3028_3423 131
208 3300048926 Ga0496123_0009019 Ga0496123_0009019_662_1057 131
209 3300048926 Ga0496123_0289613 Ga0496123_0289613_238_633 131
210 3300048927 Ga0496124_0119508 Ga0496124_0119508_893_1288 131
211 3300048927 Ga0496124_0324533 Ga0496124_0324533_544_999 131
212 3300048928 Ga0496125_0042013 Ga0496125_0042013_2707_3102 131
213 3300048928 Ga0496125_0087442 Ga0496125_0087442_1854_2249 131
214 3300049585 Ga0501069_0219032 Ga0501069_0219032_350_751 131
215 3300050493 nmdc:mga0k408_11011_c1 nmdc:mga0k408_11011_c1_3386_3781 131
216 3300050495 nmdc:mga04h51_442527_c1 nmdc:mga04h51_442527_c1_28_423 131
217 3300050496 nmdc:mga07m45_216703_c1 nmdc:mga07m45_216703_c1_422_817 131
218 3300053085 Ga0495619_0238668 Ga0495619_0238668_308_703 131
219 3300053110 Ga0500571_000024 Ga0500571_000024_16798_17193 131
220 3300053117 Ga0500593_000323 Ga0500593_000323_9252_9647 131
221 3300053122 Ga0500608_094009 Ga0500608_094009_921_1316 131
222 3300053138 Ga0500564_052772 Ga0500564_052772_643_1038 131
223 3300053141 Ga0500574_179982 Ga0500574_179982_190_585 131
224 3300053142 Ga0500577_0284874 Ga0500577_0284874_31_429 131
225 3300053148 Ga0500590_018783 Ga0500590_018783_2570_2965 131
226 3300053153 Ga0500616_0004212 Ga0500616_0004212_6756_7154 131
227 3300053177 Ga0500636_0018057 Ga0500636_0018057_17_412 131
228 3300053177 Ga0500636_0304305 Ga0500636_0304305_47_442 131
229 iso_pu_bacteria 2529292951 2530648540 131
230 iso_pu_bacteria 8057575449 8057579907 131
231 3300003752 Ga0055539_1016061 Ga0055539_10160611 132
232 3300005340 Ga0070689_100910818 Ga0070689_1009108182 132
233 3300005455 Ga0070663_100232573 Ga0070663_1002325731 132
234 3300005548 Ga0070665_100473765 Ga0070665_1004737652 132
235 3300005841 Ga0068863_100789565 Ga0068863_1007895652 132
236 3300005842 Ga0068858_100432405 Ga0068858_1004324052 132
237 3300005843 Ga0068860_100000179 Ga0068860_10000017973 132
238 3300005843 Ga0068860_100775176 Ga0068860_1007751762 132
239 3300006042 Ga0075368_10134895 Ga0075368_101348953 132
240 3300006048 Ga0075363_100184635 Ga0075363_1001846352 132
241 3300006177 Ga0075362_10355365 Ga0075362_103553651 132
242 3300006178 Ga0075367_10120521 Ga0075367_101205212 132
243 3300006358 Ga0068871_100124373 Ga0068871_1001243733 132
244 3300009093 Ga0105240_11936418 Ga0105240_119364182 132
245 3300009098 Ga0105245_11228246 Ga0105245_112282461 132
246 3300009101 Ga0105247_10027595 Ga0105247_100275956 132
247 3300009545 Ga0105237_10011043 Ga0105237_100110434 132
248 3300009545 Ga0105237_10468076 Ga0105237_104680762 132
249 3300009545 Ga0105237_11202102 Ga0105237_112021021 132
250 3300009551 Ga0105238_10150563 Ga0105238_101505633 132
251 3300009551 Ga0105238_11178667 Ga0105238_111786672 132
252 3300010375 Ga0105239_10106059 Ga0105239_101060595 132
253 3300010375 Ga0105239_10327382 Ga0105239_103273822 132
254 3300011119 Ga0105246_10616919 Ga0105246_106169191 132
255 3300013105 Ga0157369_10206589 Ga0157369_102065893 132
256 3300013296 Ga0157374_10230305 Ga0157374_102303052 132
257 3300013307 Ga0157372_11782249 Ga0157372_117822492 132
258 3300014325 Ga0163163_11239018 Ga0163163_112390182 132
259 3300014497 Ga0182008_10421689 Ga0182008_104216892 132
260 3300017792 Ga0163161_10456040 Ga0163161_104560401 132
261 3300025253 Ga0209677_100744 Ga0209677_10074411 132
262 3300025254 Ga0209148_1041928 Ga0209148_10419282 132
263 3300025900 Ga0207710_10032482 Ga0207710_100324823 132
264 3300025914 Ga0207671_10047788 Ga0207671_100477883 132
265 3300025914 Ga0207671_10155811 Ga0207671_101558112 132
266 3300025914 Ga0207671_10976133 Ga0207671_109761331 132
267 3300025924 Ga0207694_10316369 Ga0207694_103163692 132
268 3300026035 Ga0207703_10182211 Ga0207703_101822113 132
269 3300026041 Ga0207639_10245652 Ga0207639_102456522 132
270 3300026041 Ga0207639_10269547 Ga0207639_102695472 132
271 3300026078 Ga0207702_10784301 Ga0207702_107843012 132
272 3300026088 Ga0207641_10508519 Ga0207641_105085192 132
273 3300026116 Ga0207674_10607723 Ga0207674_106077232 132
274 3300026121 Ga0207683_11569114 Ga0207683_115691141 132
275 3300027866 Ga0209813_10021403 Ga0209813_100214033 132
276 3300028379 Ga0268266_10201458 Ga0268266_102014582 132
277 3300028381 Ga0268264_10000153 Ga0268264_1000015376 132
278 3300028381 Ga0268264_10996464 Ga0268264_109964642 132
279 3300028577 Ga0265318_10149805 Ga0265318_101498051 132
280 3300030521 Ga0307511_10087724 Ga0307511_100877242 132
281 3300030521 Ga0307511_10097613 Ga0307511_100976133 132
282 3300031235 Ga0265330_10027227 Ga0265330_100272274 132
283 3300031238 Ga0265332_10291061 Ga0265332_102910611 132
284 3300031241 Ga0265325_10012010 Ga0265325_100120106 132
285 3300031250 Ga0265331_10070112 Ga0265331_100701122 132
286 3300031344 Ga0265316_10070861 Ga0265316_100708614 132
287 3300031507 Ga0307509_10033194 Ga0307509_100331948 132
288 3300031507 Ga0307509_10304114 Ga0307509_103041143 132
289 3300031616 Ga0307508_10000009 Ga0307508_1000000967 132
290 3300031616 Ga0307508_10069917 Ga0307508_100699172 132
291 3300031712 Ga0265342_10045287 Ga0265342_100452874 132
292 3300031730 Ga0307516_10014988 Ga0307516_1001498812 132
293 3300031730 Ga0307516_10095616 Ga0307516_100956165 132
294 3300033179 Ga0307507_10023098 Ga0307507_100230985 132
295 3300033180 Ga0307510_10008632 Ga0307510_1000863214 132
296 3300035086 Ga0373934_0010218 Ga0373934_0010218_806_1210 132
297 3300035111 Ga0373923_0100922 Ga0373923_0100922_593_997 132
298 3300035113 Ga0373936_0253631 Ga0373936_0253631_243_647 132
299 3300035117 Ga0373953_0006562 Ga0373953_0006562_1346_1750 132
300 3300035118 Ga0373954_0000584 Ga0373954_0000584_7246_7650 132
301 3300035119 Ga0373956_0002897 Ga0373956_0002897_4442_4846 132
302 3300035120 Ga0373957_0007168 Ga0373957_0007168_586_990 132
303 3300035170 Ga0373943_0209587 Ga0373943_0209587_501_962 132
304 3300035172 Ga0373955_0012385 Ga0373955_0012385_3087_3491 132
305 3300035410 Ga0373924_0008307 Ga0373924_0008307_2030_2434 132
306 3300035692 Ga0373935_0141768 Ga0373935_0141768_408_812 132
307 3300035692 Ga0373935_0428964 Ga0373935_0428964_512_916 132
308 3300035695 Ga0373927_0192203 Ga0373927_0192203_762_1223 132
309 3300035724 Ga0373933_0019974 Ga0373933_0019974_1575_1979 132
310 3300036401 Ga0373937_0014040 Ga0373937_0014040_2848_3252 132
311 3300037068 Ga0373925_0030797 Ga0373925_0030797_423_827 132
312 3300037471 Ga0395905_1587039 Ga0395905_1587039_139_537 132
313 3300039450 Ga0436363_0623699 Ga0436363_0623699_110_514 132
314 3300041491 Ga0451833_0262796 Ga0451833_0262796_21_425 132
315 3300041501 Ga0451845_0774461 Ga0451845_0774461_43_447 132
316 3300041512 Ga0451853_3820061 Ga0451853_3820061_107_505 132
317 3300046454 Ga0495592_0017995 Ga0495592_0017995_3229_3633 132
318 3300046459 Ga0495629_0002194 Ga0495629_0002194_1813_2217 132
319 3300046462 Ga0495651_0018674 Ga0495651_0018674_2886_3290 132
320 3300046463 Ga0495653_0081016 Ga0495653_0081016_1686_2090 132
321 3300046477 Ga0495664_0381706 Ga0495664_0381706_180_584 132
322 3300046511 Ga0495608_0002889 Ga0495608_0002889_3229_3633 132
323 3300046514 Ga0495618_0373857 Ga0495618_0373857_248_652 132
324 3300046516 Ga0495628_0005140 Ga0495628_0005140_8422_8826 132
325 3300046529 Ga0495652_0025881 Ga0495652_0025881_2698_3102 132
326 3300046533 Ga0495640_0012625 Ga0495640_0012625_2337_2741 132
327 3300046536 Ga0495587_0022631 Ga0495587_0022631_579_983 132
328 3300046543 Ga0495645_0016180 Ga0495645_0016180_1860_2264 132
329 3300046557 Ga0495622_0050878 Ga0495622_0050878_1050_1454 132
330 3300046559 Ga0495667_0066680 Ga0495667_0066680_1556_1960 132
331 3300046616 Ga0495668_0018238 Ga0495668_0018238_1144_1560 132
332 3300046642 Ga0495634_0724284 Ga0495634_0724284_71_532 132
333 3300046660 Ga0495625_0263694 Ga0495625_0263694_160_606 132
334 3300046663 Ga0495635_0001940 Ga0495635_0001940_8537_8941 132
335 3300046675 Ga0495657_0039925 Ga0495657_0039925_1686_2090 132
336 3300046678 Ga0495599_0012882 Ga0495599_0012882_2656_3060 132
337 3300046679 Ga0495623_0011556 Ga0495623_0011556_3229_3633 132
338 3300046680 Ga0495646_0015943 Ga0495646_0015943_2683_3087 132
339 3300046689 Ga0495613_0109643 Ga0495613_0109643_626_1030 132
340 3300046809 Ga0495600_0167162 Ga0495600_0167162_707_1111 132
341 3300047317 Ga0495604_0114097 Ga0495604_0114097_310_714 132
342 3300047319 Ga0495674_0093233 Ga0495674_0093233_1019_1423 132
343 3300047322 Ga0495680_0036768 Ga0495680_0036768_1252_1656 132
344 3300047444 Ga0495675_0005020 Ga0495675_0005020_7466_7870 132
345 3300047471 Ga0495684_0003481 Ga0495684_0003481_7074_7478 132
346 3300047673 Ga0495593_0008924 Ga0495593_0008924_3844_4248 132
347 3300048088 Ga0495602_0027242 Ga0495602_0027242_1261_1665 132
348 3300048088 Ga0495602_0755679 Ga0495602_0755679_115_513 132
349 3300048903 Ga0496100_0792492 Ga0496100_0792492_50_472 132
350 3300048905 Ga0496102_1392705 Ga0496102_1392705_172_570 132
351 3300048909 Ga0496106_0001072 Ga0496106_0001072_1895_2299 132
352 3300048910 Ga0496107_0520346 Ga0496107_0520346_339_743 132
353 3300048917 Ga0496114_0351545 Ga0496114_0351545_345_806 132
354 3300048918 Ga0496115_0182379 Ga0496115_0182379_351_755 132
355 3300048919 Ga0496116_0055736 Ga0496116_0055736_368_772 132
356 3300048920 Ga0496117_0019280 Ga0496117_0019280_1740_2144 132
357 3300048921 Ga0496118_0002820 Ga0496118_0002820_13567_13971 132
358 3300048921 Ga0496118_0112142 Ga0496118_0112142_694_1116 132
359 3300048923 Ga0496120_0020017 Ga0496120_0020017_1561_1959 132
360 3300048924 Ga0496121_0002189 Ga0496121_0002189_6999_7403 132
361 3300048924 Ga0496121_0087579 Ga0496121_0087579_188_649 132
362 3300048924 Ga0496121_0104555 Ga0496121_0104555_22_420 132
363 3300048927 Ga0496124_0000916 Ga0496124_0000916_19898_20302 132
364 3300048929 Ga0496126_0005239 Ga0496126_0005239_12571_12975 132
365 3300048929 Ga0496126_0024537 Ga0496126_0024537_2511_2972 132
366 3300048929 Ga0496126_0917427 Ga0496126_0917427_159_557 132
367 3300050489 nmdc:mga03683_279212_c1 nmdc:mga03683_279212_c1_305_703 132
368 3300050490 nmdc:mga03n38_172766_c1 nmdc:mga03n38_172766_c1_547_945 132
369 3300050490 nmdc:mga03n38_632483_c1 nmdc:mga03n38_632483_c1_187_585 132
370 3300050491 nmdc:mga00v17_23257_c1 nmdc:mga00v17_23257_c1_1253_1651 132
371 3300050494 nmdc:mga06z11_39616_c1 nmdc:mga06z11_39616_c1_1550_1948 132
372 3300050495 nmdc:mga04h51_33427_c1 nmdc:mga04h51_33427_c1_392_790 132
373 3300050496 nmdc:mga07m45_477621_c1 nmdc:mga07m45_477621_c1_258_656 132
374 3300053077 Ga0495601_0014495 Ga0495601_0014495_2665_3069 132
375 3300053078 Ga0495612_0160381 Ga0495612_0160381_121_519 132
376 3300053079 Ga0500610_0074907 Ga0500610_0074907_1164_1562 132
377 3300053084 Ga0495595_0002007 Ga0495595_0002007_3845_4249 132
378 3300053085 Ga0495619_0004943 Ga0495619_0004943_5994_6398 132
379 3300053088 Ga0500644_0537206 Ga0500644_0537206_107_505 132
380 3300053119 Ga0500595_030879 Ga0500595_030879_777_1181 132
381 3300053130 Ga0500642_0018075 Ga0500642_0018075_1005_1415 132
382 3300053136 Ga0500559_0037155 Ga0500559_0037155_483_887 132
383 3300053140 Ga0500573_0091598 Ga0500573_0091598_1208_1612 132
384 3300053142 Ga0500577_0256715 Ga0500577_0256715_95_493 132
385 3300053145 Ga0500586_031001 Ga0500586_031001_807_1205 132
386 3300053150 Ga0500603_085693 Ga0500603_085693_398_859 132
387 3300053162 Ga0500638_075341 Ga0500638_075341_1028_1432 132
388 3300053177 Ga0500636_0063306 Ga0500636_0063306_239_643 132
389 3300053735 Ga0500596_000685 Ga0500596_000685_5763_6167 132
390 iso_pu_bacteria 2906378014 2906383768 132
391 3300005344 Ga0070661_100001480 Ga0070661_10000148017 133
392 3300005366 Ga0070659_100000895 Ga0070659_10000089511 133
393 3300006195 Ga0075366_10489726 Ga0075366_104897261 133
394 3300013308 Ga0157375_10207867 Ga0157375_102078674 133
395 3300025919 Ga0207657_10258138 Ga0207657_102581383 133
396 3300025932 Ga0207690_10020905 Ga0207690_100209053 133
397 3300025945 Ga0207679_10000864 Ga0207679_100008642 133
398 3300026088 Ga0207641_10320474 Ga0207641_103204742 133
399 3300028786 Ga0307517_10378181 Ga0307517_103781812 133
400 3300031456 Ga0307513_10430301 Ga0307513_104303013 133
401 3300039438 Ga0436360_0101928 Ga0436360_0101928_58_462 133
402 3300039447 Ga0436361_0513740 Ga0436361_0513740_318_779 133
403 3300042157 Ga0439458_0111805 Ga0439458_0111805_238_639 133
404 3300042876 Ga0451577_0000060 Ga0451577_0000060_147207_147608 133
405 3300044712 Ga0453684_0000211 Ga0453684_0000211_70651_71052 133
406 3300046810 Ga0495660_0251165 Ga0495660_0251165_166_597 133
407 3300050493 nmdc:mga0k408_161193_c1 nmdc:mga0k408_161193_c1_657_1058 133
408 3300053154 Ga0500619_278490 Ga0500619_278490_47_448 133
409 3300055283 Ga0500661_040734 Ga0500661_040734_38_439 133
410 3300002737 JGI25162J39368_1000021 JGI25162J39368_1000021202 134
411 3300002774 JGI25150J39212_1003233 JGI25150J39212_10032333 134
412 3300003187 JGI25151J46595_10042539 JGI25151J46595_100425392 134
413 3300003214 JGI25165J46597_1000049 JGI25165J46597_100004921 134
414 3300003322 rootL2_10121150 rootL2_101211502 134
415 3300003322 rootL2_10369363 rootL2_103693632 134
416 3300003323 rootH1_10080528 rootH1_100805281 134
417 3300003323 rootH1_10114272 rootH1_101142721 134
418 3300003751 Ga0055538_1000023 Ga0055538_1000023202 134
419 3300003752 Ga0055539_1000030 Ga0055539_1000030202 134
420 3300003756 Ga0055533_1000039 Ga0055533_1000039202 134
421 3300003759 Ga0055525_1000048 Ga0055525_100004821 134
422 3300003841 Ga0055541_1000021 Ga0055541_100002121 134
423 3300005436 Ga0070713_100629439 Ga0070713_1006294391 134
424 3300005439 Ga0070711_100137967 Ga0070711_1001379673 134
425 3300005445 Ga0070708_100318396 Ga0070708_1003183962 134
426 3300005457 Ga0070662_100007793 Ga0070662_10000779311 134
427 3300005618 Ga0068864_100257592 Ga0068864_1002575923 134
428 3300005842 Ga0068858_100544098 Ga0068858_1005440982 134
429 3300005843 Ga0068860_100818248 Ga0068860_1008182483 134
430 3300006028 Ga0070717_10482164 Ga0070717_104821642 134
431 3300006028 Ga0070717_10580942 Ga0070717_105809422 134
432 3300006028 Ga0070717_11418695 Ga0070717_114186951 134
433 3300006195 Ga0075366_10293718 Ga0075366_102937182 134
434 3300006237 Ga0097621_101405964 Ga0097621_1014059641 134
435 3300009093 Ga0105240_11289286 Ga0105240_112892862 134
436 3300009177 Ga0105248_10880740 Ga0105248_108807402 134
437 3300010375 Ga0105239_11016642 Ga0105239_110166422 134
438 3300014325 Ga0163163_13070920 Ga0163163_130709201 134
439 3300014497 Ga0182008_10106835 Ga0182008_101068351 134
440 3300014968 Ga0157379_10882479 Ga0157379_108824792 134
441 3300014968 Ga0157379_11006937 Ga0157379_110069372 134
442 3300015261 Ga0182006_1036027 Ga0182006_10360273 134
443 3300015261 Ga0182006_1083138 Ga0182006_10831382 134
444 3300015262 Ga0182007_10009811 Ga0182007_100098115 134
445 3300015262 Ga0182007_10010709 Ga0182007_100107093 134
446 3300015265 Ga0182005_1000822 Ga0182005_10008224 134
447 3300021384 Ga0213876_10051756 Ga0213876_100517562 134
448 3300025224 Ga0209784_100004 Ga0209784_1000041244 134
449 3300025225 Ga0209566_100004 Ga0209566_1000041401 134
450 3300025226 Ga0209674_100006 Ga0209674_1000061401 134
451 3300025230 Ga0209563_100009 Ga0209563_1000091244 134
452 3300025231 Ga0207427_100291 Ga0207427_10029121 134
453 3300025233 Ga0209437_100004 Ga0209437_1000041244 134
454 3300025245 Ga0207425_1000474 Ga0207425_10004744 134
455 3300025253 Ga0209677_100005 Ga0209677_1000051244 134
456 3300025261 Ga0209233_1000005 Ga0209233_10000051401 134
457 3300025294 Ga0209025_1005303 Ga0209025_10053034 134
458 3300025297 Ga0209758_1001248 Ga0209758_100124815 134
459 3300025904 Ga0207647_10053319 Ga0207647_100533193 134
460 3300025913 Ga0207695_11663707 Ga0207695_116637071 134
461 3300025916 Ga0207663_10838099 Ga0207663_108380992 134
462 3300025932 Ga0207690_10002574 Ga0207690_100025745 134
463 3300025933 Ga0207706_10005400 Ga0207706_100054005 134
464 3300025934 Ga0207686_10307030 Ga0207686_103070302 134
465 3300026035 Ga0207703_10459407 Ga0207703_104594072 134
466 3300030521 Ga0307511_10000014 Ga0307511_100000149 134
467 3300033179 Ga0307507_10245614 Ga0307507_102456142 134
468 3300033180 Ga0307510_10397309 Ga0307510_103973091 134
469 3300035118 Ga0373954_0003159 Ga0373954_0003159_1340_1810 134
470 3300035172 Ga0373955_0001386 Ga0373955_0001386_8381_8851 134
471 3300035692 Ga0373935_0022754 Ga0373935_0022754_3303_3773 134
472 3300035695 Ga0373927_0309828 Ga0373927_0309828_497_967 134
473 3300035724 Ga0373933_0005542 Ga0373933_0005542_2609_3079 134
474 3300035725 Ga0373947_0023741 Ga0373947_0023741_696_1166 134
475 3300036401 Ga0373937_0002028 Ga0373937_0002028_2354_2824 134
476 3300037853 Ga0436364_0086439 Ga0436364_0086439_98_514 134
477 3300037853 Ga0436364_0947489 Ga0436364_0947489_221_637 134
478 3300039437 Ga0436365_1319655 Ga0436365_1319655_2614_3030 134
479 3300039438 Ga0436360_0321371 Ga0436360_0321371_133_549 134
480 3300039447 Ga0436361_0432098 Ga0436361_0432098_30_446 134
481 3300039450 Ga0436363_0688018 Ga0436363_0688018_607_1023 134
482 3300044683 Ga0466965_0096073 Ga0466965_0096073_1058_1468 134
483 3300044684 Ga0466966_0025507 Ga0466966_0025507_847_1269 134
484 3300045049 Ga0466959_0018721 Ga0466959_0018721_3585_4007 134
485 3300046454 Ga0495592_0023669 Ga0495592_0023669_353_823 134
486 3300046454 Ga0495592_0078974 Ga0495592_0078974_182_592 134
487 3300046457 Ga0495590_0132311 Ga0495590_0132311_154_558 134
488 3300046459 Ga0495629_0004909 Ga0495629_0004909_446_850 134
489 3300046461 Ga0495641_0178272 Ga0495641_0178272_223_627 134
490 3300046462 Ga0495651_0001006 Ga0495651_0001006_7719_8189 134
491 3300046462 Ga0495651_0281771 Ga0495651_0281771_557_967 134
492 3300046462 Ga0495651_0325787 Ga0495651_0325787_488_898 134
493 3300046462 Ga0495651_0327431 Ga0495651_0327431_257_661 134
494 3300046463 Ga0495653_0011823 Ga0495653_0011823_5319_5789 134
495 3300046463 Ga0495653_0030435 Ga0495653_0030435_2971_3381 134
496 3300046474 Ga0495605_0094144 Ga0495605_0094144_294_698 134
497 3300046475 Ga0495639_0025899 Ga0495639_0025899_768_1238 134
498 3300046477 Ga0495664_0003228 Ga0495664_0003228_3081_3551 134
499 3300046477 Ga0495664_0454880 Ga0495664_0454880_300_704 134
500 3300046501 Ga0495607_0256339 Ga0495607_0256339_387_791 134
501 3300046506 Ga0495583_0012479 Ga0495583_0012479_534_938 134
502 3300046507 Ga0495606_0005632 Ga0495606_0005632_3054_3458 134
503 3300046507 Ga0495606_0285248 Ga0495606_0285248_125_595 134
504 3300046511 Ga0495608_0004042 Ga0495608_0004042_6187_6657 134
505 3300046511 Ga0495608_0019067 Ga0495608_0019067_1901_2311 134
506 3300046511 Ga0495608_0133989 Ga0495608_0133989_38_442 134
507 3300046513 Ga0495616_0110719 Ga0495616_0110719_139_543 134
508 3300046514 Ga0495618_0000741 Ga0495618_0000741_14322_14792 134
509 3300046514 Ga0495618_0104302 Ga0495618_0104302_1168_1578 134
510 3300046514 Ga0495618_0425228 Ga0495618_0425228_207_611 134
511 3300046516 Ga0495628_0008625 Ga0495628_0008625_227_697 134
512 3300046516 Ga0495628_0020789 Ga0495628_0020789_2809_3219 134
513 3300046516 Ga0495628_0418137 Ga0495628_0418137_19_423 134
514 3300046517 Ga0495630_1205493 Ga0495630_1205493_46_450 134
515 3300046524 Ga0495648_0026027 Ga0495648_0026027_2072_2476 134
516 3300046529 Ga0495652_0027255 Ga0495652_0027255_2369_2839 134
517 3300046529 Ga0495652_0112553 Ga0495652_0112553_165_569 134
518 3300046529 Ga0495652_0380727 Ga0495652_0380727_271_681 134
519 3300046531 Ga0495665_0056090 Ga0495665_0056090_268_738 134
520 3300046533 Ga0495640_0005375 Ga0495640_0005375_4941_5411 134
521 3300046533 Ga0495640_0016059 Ga0495640_0016059_1875_2279 134
522 3300046536 Ga0495587_0010989 Ga0495587_0010989_2800_3270 134
523 3300046542 Ga0495597_0166986 Ga0495597_0166986_387_791 134
524 3300046543 Ga0495645_0033417 Ga0495645_0033417_1099_1569 134
525 3300046543 Ga0495645_0050856 Ga0495645_0050856_919_1329 134
526 3300046559 Ga0495667_0000654 Ga0495667_0000654_6822_7292 134
527 3300046559 Ga0495667_0123246 Ga0495667_0123246_1041_1445 134
528 3300046616 Ga0495668_0032038 Ga0495668_0032038_2011_2415 134
529 3300046642 Ga0495634_0004062 Ga0495634_0004062_2469_2939 134
530 3300046642 Ga0495634_0275094 Ga0495634_0275094_140_544 134
531 3300046660 Ga0495625_0031122 Ga0495625_0031122_2857_3261 134
532 3300046663 Ga0495635_0001817 Ga0495635_0001817_12818_13222 134
533 3300046663 Ga0495635_0003108 Ga0495635_0003108_8539_9009 134
534 3300046674 Ga0495588_0125166 Ga0495588_0125166_492_899 134
535 3300046675 Ga0495657_0021323 Ga0495657_0021323_150_554 134
536 3300046675 Ga0495657_0027076 Ga0495657_0027076_258_728 134
537 3300046675 Ga0495657_0253319 Ga0495657_0253319_556_966 134
538 3300046678 Ga0495599_0005427 Ga0495599_0005427_1993_2463 134
539 3300046678 Ga0495599_0006485 Ga0495599_0006485_4586_4996 134
540 3300046679 Ga0495623_0013037 Ga0495623_0013037_4375_4845 134
541 3300046679 Ga0495623_0449811 Ga0495623_0449811_159_563 134
542 3300046680 Ga0495646_0001331 Ga0495646_0001331_10923_11393 134
543 3300046680 Ga0495646_0038820 Ga0495646_0038820_1555_1965 134
544 3300046681 Ga0495647_0231884 Ga0495647_0231884_155_625 134
545 3300046683 Ga0495658_0009649 Ga0495658_0009649_3902_4372 134
546 3300046683 Ga0495658_0056970 Ga0495658_0056970_1377_1787 134
547 3300046684 Ga0495669_0209859 Ga0495669_0209859_439_843 134
548 3300046689 Ga0495613_0174371 Ga0495613_0174371_956_1426 134
549 3300046689 Ga0495613_0218520 Ga0495613_0218520_655_1059 134
550 3300046690 Ga0495624_0009016 Ga0495624_0009016_498_968 134
551 3300046690 Ga0495624_0014746 Ga0495624_0014746_4759_5169 134
552 3300046691 Ga0495670_0186519 Ga0495670_0186519_646_1056 134
553 3300046692 Ga0495671_0039479 Ga0495671_0039479_320_724 134
554 3300046694 Ga0495649_0051765 Ga0495649_0051765_890_1294 134
555 3300046809 Ga0495600_0017015 Ga0495600_0017015_908_1378 134
556 3300046809 Ga0495600_0040439 Ga0495600_0040439_215_625 134
557 3300046809 Ga0495600_0042899 Ga0495600_0042899_1246_1650 134
558 3300047315 Ga0495581_0279515 Ga0495581_0279515_215_685 134
559 3300047317 Ga0495604_0001231 Ga0495604_0001231_12458_12928 134
560 3300047317 Ga0495604_0052710 Ga0495604_0052710_1254_1658 134
561 3300047317 Ga0495604_0092930 Ga0495604_0092930_1734_2144 134
562 3300047319 Ga0495674_0002137 Ga0495674_0002137_14499_14969 134
563 3300047319 Ga0495674_0299855 Ga0495674_0299855_97_501 134
564 3300047321 Ga0495676_0054832 Ga0495676_0054832_150_554 134
565 3300047321 Ga0495676_0416836 Ga0495676_0416836_40_510 134
566 3300047322 Ga0495680_0002906 Ga0495680_0002906_9981_10451 134
567 3300047323 Ga0495683_0079575 Ga0495683_0079575_28_432 134
568 3300047444 Ga0495675_0017647 Ga0495675_0017647_3367_3837 134
569 3300047469 Ga0495673_0292572 Ga0495673_0292572_137_541 134
570 3300047471 Ga0495684_0002299 Ga0495684_0002299_3268_3738 134
571 3300047471 Ga0495684_0147368 Ga0495684_0147368_83_487 134
572 3300047472 Ga0495686_0100894 Ga0495686_0100894_149_553 134
573 3300048088 Ga0495602_0011794 Ga0495602_0011794_2371_2841 134
574 3300048088 Ga0495602_0690488 Ga0495602_0690488_69_479 134
575 3300048089 Ga0495614_0325475 Ga0495614_0325475_181_585 134
576 3300048903 Ga0496100_0280065 Ga0496100_0280065_466_882 134
577 3300048907 Ga0496104_0008588 Ga0496104_0008588_8160_8564 134
578 3300048908 Ga0496105_0009824 Ga0496105_0009824_3138_3542 134
579 3300048909 Ga0496106_0516321 Ga0496106_0516321_486_902 134
580 3300048910 Ga0496107_0255517 Ga0496107_0255517_603_1019 134
581 3300048911 Ga0496108_0544537 Ga0496108_0544537_138_554 134
582 3300048912 Ga0496109_0735387 Ga0496109_0735387_69_485 134
583 3300048913 Ga0496110_0150999 Ga0496110_0150999_547_963 134
584 3300048914 Ga0496111_0363004 Ga0496111_0363004_307_723 134
585 3300048915 Ga0496112_0706831 Ga0496112_0706831_221_637 134
586 3300048915 Ga0496112_0803401 Ga0496112_0803401_227_631 134
587 3300048916 Ga0496113_0005589 Ga0496113_0005589_6674_7078 134
588 3300048917 Ga0496114_0201129 Ga0496114_0201129_1061_1465 134
589 3300048918 Ga0496115_0065521 Ga0496115_0065521_2331_2735 134
590 3300048918 Ga0496115_0546085 Ga0496115_0546085_130_546 134
591 3300048921 Ga0496118_0292525 Ga0496118_0292525_263_667 134
592 3300048922 Ga0496119_0004149 Ga0496119_0004149_364_768 134
593 3300048922 Ga0496119_0426901 Ga0496119_0426901_190_612 134
594 3300048923 Ga0496120_0010110 Ga0496120_0010110_4834_5238 134
595 3300048924 Ga0496121_0023933 Ga0496121_0023933_764_1168 134
596 3300048927 Ga0496124_0255698 Ga0496124_0255698_637_1041 134
597 3300048928 Ga0496125_0146749 Ga0496125_0146749_874_1278 134
598 3300048929 Ga0496126_0036557 Ga0496126_0036557_2832_3236 134
599 3300049460 Ga0495682_0021623 Ga0495682_0021623_1067_1471 134
600 3300049654 Ga0501207_011694 Ga0501207_011694_67_471 134
601 3300049667 Ga0501230_060471 Ga0501230_060471_310_714 134
602 3300049760 Ga0501263_000853 Ga0501263_000853_2041_2445 134
603 3300050494 nmdc:mga06z11_386344_c1 nmdc:mga06z11_386344_c1_138_545 134
604 3300050516 nmdc:mga0sz30_110790_c1 nmdc:mga0sz30_110790_c1_433_852 134
605 3300053077 Ga0495601_0004876 Ga0495601_0004876_7091_7561 134
606 3300053077 Ga0495601_0006948 Ga0495601_0006948_5813_6223 134
607 3300053077 Ga0495601_0927372 Ga0495601_0927372_51_455 134
608 3300053078 Ga0495612_0005438 Ga0495612_0005438_3803_4273 134
609 3300053083 Ga0495655_0015942 Ga0495655_0015942_377_781 134
610 3300053084 Ga0495595_0005927 Ga0495595_0005927_1313_1783 134
611 3300053084 Ga0495595_0173339 Ga0495595_0173339_372_788 134
612 3300053085 Ga0495619_0031133 Ga0495619_0031133_993_1463 134
613 3300053085 Ga0495619_0532972 Ga0495619_0532972_62_478 134
614 3300053085 Ga0495619_0810358 Ga0495619_0810358_181_585 134
615 3300053090 Ga0500646_0002045 Ga0500646_0002045_1150_1557 134
616 3300053092 Ga0500583_0000783 Ga0500583_0000783_8491_8898 134
617 3300053093 Ga0500651_0299680 Ga0500651_0299680_25_438 134
618 3300053094 Ga0500566_0000394 Ga0500566_0000394_1249_1659 134
619 3300053094 Ga0500566_0131216 Ga0500566_0131216_452_865 134
620 3300053095 Ga0500640_002770 Ga0500640_002770_3821_4231 134
621 3300053104 Ga0500556_0062317 Ga0500556_0062317_515_928 134
622 3300053111 Ga0500572_000156 Ga0500572_000156_1037_1447 134
623 3300053115 Ga0500591_139102 Ga0500591_139102_386_796 134
624 3300053119 Ga0500595_001575 Ga0500595_001575_5078_5488 134
625 3300053119 Ga0500595_001671 Ga0500595_001671_2243_2656 134
626 3300053119 Ga0500595_087074 Ga0500595_087074_492_896 134
627 3300053121 Ga0500607_000025 Ga0500607_000025_22703_23110 134
628 3300053122 Ga0500608_039947 Ga0500608_039947_552_962 134
629 3300053123 Ga0500614_000121 Ga0500614_000121_1252_1662 134
630 3300053130 Ga0500642_0239975 Ga0500642_0239975_141_554 134
631 3300053130 Ga0500642_0437289 Ga0500642_0437289_69_473 134
632 3300053134 Ga0500658_0009176 Ga0500658_0009176_3063_3476 134
633 3300053136 Ga0500559_0001182 Ga0500559_0001182_11227_11637 134
634 3300053141 Ga0500574_000848 Ga0500574_000848_2822_3232 134
635 3300053142 Ga0500577_0028657 Ga0500577_0028657_962_1375 134
636 3300053144 Ga0500585_187648 Ga0500585_187648_201_611 134
637 3300053148 Ga0500590_098043 Ga0500590_098043_164_574 134
638 3300053150 Ga0500603_000224 Ga0500603_000224_12384_12794 134
639 3300053151 Ga0500604_0004510 Ga0500604_0004510_1786_2211 134
640 3300053153 Ga0500616_0002571 Ga0500616_0002571_5399_5812 134
641 3300053154 Ga0500619_000430 Ga0500619_000430_6486_6896 134
642 3300053156 Ga0500622_0300843 Ga0500622_0300843_150_563 134
643 3300053159 Ga0500630_000834 Ga0500630_000834_9422_9832 134
644 3300053162 Ga0500638_005764 Ga0500638_005764_1368_1778 134
645 3300053163 Ga0500639_002819 Ga0500639_002819_1637_2047 134
646 3300053722 Ga0500649_070145 Ga0500649_070145_724_1128 134
647 3300053733 Ga0500552_005361 Ga0500552_005361_629_1039 134
648 3300053733 Ga0500552_035465 Ga0500552_035465_137_541 134
649 3300053735 Ga0500596_001137 Ga0500596_001137_4220_4630 134
650 3300053735 Ga0500596_017239 Ga0500596_017239_54_458 134
651 3300053737 Ga0500601_009020 Ga0500601_009020_257_667 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

20

146

0.84

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

145

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8881 1 130
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8631 1 130
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8334 1 129
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8328 1 130
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8216 1 129
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9735 77 129 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9022 76 130 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8692 7 130 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8606 77 129 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8491 7 130 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2S9QDR6-F1-model_v4 VOC family protein 0.9875 1 129
AF-A0A2S9GZS6-F1-model_v4 PhnB-like domain-containing protein 0.9848 1 131
AF-A0A6G8NPX8-F1-model_v4 PhnB-like domain-containing protein 0.9826 1 131
AF-A0A2S9GZS6-F1-model_v4 PhnB-like domain-containing protein 0.9774 1 131
AF-J3CI59-F1-model_v4 PhnB-like domain-containing protein 0.9738 39 129

Feature Viewer

pLDDT pTM Quality
93.83 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map