F472618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 363 | 622 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0513740|Ga0436361_0513740_318_779 |
| Length | 153 |
| Sequence | VLAASASTRRSPFANRDWLMQLANYLFFTTTCEQALAFYTRCGLGRVTEMVRYGTVMPAPTAAMQGKVMHSRFEGPGVLFYASDNHDAEPMRGSAHMLMMDGREATDQLFAQLAEGGTITTPLGIQPWGDYYGKLTDRFGVQWMLNCPVRSGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 4 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 5 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 6 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 7 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 8 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 9 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 10 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 11 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 12 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 13 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 14 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 15 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 16 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 17 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 18 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 19 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 20 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 21 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 22 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 23 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 24 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 25 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 26 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 27 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 33 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 34 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 176 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 177 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 200 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 201 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 204 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 289 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 290 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 293 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 294 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 295 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 302 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 303 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 309 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 321 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 322 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 323 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 326 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 329 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 330 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 331 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 332 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 339 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 340 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 341 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 343 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 344 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 349 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 350 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 357 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 359 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 360 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 361 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 362 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 363 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.55 |
| Metatranscriptomes | 0 |
| Isolates | 4.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.12 |
| Nodule | 2.46 |
| Rhizoplane | 3.99 |
| Rhizosphere | 58.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000021 | 3300002737 | Bacteria | 248155 |
| 2 | JGI25162J39368_1024205 | 3300002737 | Bacteria | 548 |
| 3 | JGI25154J39366_1000336 | 3300002738 | Bacteria | 27003 |
| 4 | JGI25150J39212_1003233 | 3300002774 | Bacteria | 3851 |
| 5 | JGI25151J46595_10042539 | 3300003187 | Bacteria | 1635 |
| 6 | JGI25165J46597_1000049 | 3300003214 | Bacteria | 248154 |
| 7 | JGI25153J46596_10011363 | 3300003215 | Bacteria | 3939 |
| 8 | rootL2_10121150 | 3300003322 | Bacteria | 2689 |
| 9 | rootL2_10164609 | 3300003322 | Bacteria | 2368 |
| 10 | rootL2_10369363 | 3300003322 | Bacteria | 1996 |
| 11 | rootH1_10080528 | 3300003323 | Bacteria | 1682 |
| 12 | rootH1_10114272 | 3300003323 | Unclassified | 1575 |
| 13 | rootH1_10264619 | 3300003323 | Unclassified | 1911 |
| 14 | Ga0055538_1000023 | 3300003751 | Bacteria | 248154 |
| 15 | Ga0055539_1000030 | 3300003752 | Bacteria | 248154 |
| 16 | Ga0055539_1016061 | 3300003752 | Bacteria | 909 |
| 17 | Ga0055533_1000039 | 3300003756 | Bacteria | 248154 |
| 18 | Ga0055525_1000048 | 3300003759 | Bacteria | 248154 |
| 19 | Ga0055526_1000016 | 3300003771 | Bacteria | 213710 |
| 20 | Ga0055536_1000955 | 3300003781 | Bacteria | 18500 |
| 21 | Ga0055536_1001688 | 3300003781 | Bacteria | 13068 |
| 22 | Ga0055530_10005038 | 3300003791 | Bacteria | 6493 |
| 23 | Ga0055540_1000747 | 3300003792 | Bacteria | 22059 |
| 24 | Ga0055540_1056135 | 3300003792 | Bacteria | 798 |
| 25 | Ga0055531_10001032 | 3300003794 | Bacteria | 22059 |
| 26 | Ga0055531_10004663 | 3300003794 | Bacteria | 8223 |
| 27 | Ga0055541_1000021 | 3300003841 | Bacteria | 248154 |
| 28 | Ga0065714_10002968 | 3300005288 | Bacteria | 9262 |
| 29 | Ga0068869_101472821 | 3300005334 | Unclassified | 604 |
| 30 | Ga0070660_100613701 | 3300005339 | Unclassified | 910 |
| 31 | Ga0070689_100910818 | 3300005340 | Unclassified | 778 |
| 32 | Ga0070661_100001480 | 3300005344 | Bacteria | 16303 |
| 33 | Ga0070659_100000895 | 3300005366 | Bacteria | 21810 |
| 34 | Ga0070709_10000528 | 3300005434 | Bacteria | 22521 |
| 35 | Ga0070714_100034186 | 3300005435 | Bacteria | 4255 |
| 36 | Ga0070713_100032274 | 3300005436 | Bacteria | 4181 |
| 37 | Ga0070713_100250661 | 3300005436 | Bacteria | 1615 |
| 38 | Ga0070713_100629439 | 3300005436 | Bacteria | 1021 |
| 39 | Ga0070710_10001256 | 3300005437 | Bacteria | 12043 |
| 40 | Ga0070711_100030122 | 3300005439 | Bacteria | 3590 |
| 41 | Ga0070711_100137967 | 3300005439 | Bacteria | 1825 |
| 42 | Ga0070708_100318396 | 3300005445 | Bacteria | 1465 |
| 43 | Ga0070663_100232573 | 3300005455 | Bacteria | 1452 |
| 44 | Ga0070662_100007793 | 3300005457 | Bacteria | 6957 |
| 45 | Ga0070662_100048463 | 3300005457 | Bacteria | 3060 |
| 46 | Ga0070665_100473765 | 3300005548 | Bacteria | 1263 |
| 47 | Ga0068857_100056676 | 3300005577 | Bacteria | 3478 |
| 48 | Ga0068854_101667120 | 3300005578 | Bacteria | 582 |
| 49 | Ga0068852_100759879 | 3300005616 | Bacteria | 982 |
| 50 | Ga0068864_100257592 | 3300005618 | Bacteria | 1622 |
| 51 | Ga0068863_100789565 | 3300005841 | Bacteria | 947 |
| 52 | Ga0068858_100432405 | 3300005842 | Bacteria | 1267 |
| 53 | Ga0068858_100544098 | 3300005842 | Bacteria | 1124 |
| 54 | Ga0068858_100663878 | 3300005842 | Bacteria | 1013 |
| 55 | Ga0068860_100000179 | 3300005843 | Bacteria | 102844 |
| 56 | Ga0068860_100775176 | 3300005843 | Bacteria | 972 |
| 57 | Ga0068860_100818248 | 3300005843 | Bacteria | 945 |
| 58 | Ga0070717_10482164 | 3300006028 | Bacteria | 1120 |
| 59 | Ga0070717_10580942 | 3300006028 | Bacteria | 1016 |
| 60 | Ga0070717_11418695 | 3300006028 | Bacteria | 630 |
| 61 | Ga0070717_11841154 | 3300006028 | Bacteria | 547 |
| 62 | Ga0075365_10074516 | 3300006038 | Bacteria | 2289 |
| 63 | Ga0075365_10206026 | 3300006038 | Bacteria | 1378 |
| 64 | Ga0075368_10134895 | 3300006042 | Bacteria | 1027 |
| 65 | Ga0075363_100184635 | 3300006048 | Bacteria | 1188 |
| 66 | Ga0075364_11215812 | 3300006051 | Bacteria | 511 |
| 67 | Ga0075432_10457847 | 3300006058 | Unclassified | 561 |
| 68 | Ga0070716_100001221 | 3300006173 | Bacteria | 11304 |
| 69 | Ga0070712_100261448 | 3300006175 | Bacteria | 1387 |
| 70 | Ga0070712_100471873 | 3300006175 | Bacteria | 1048 |
| 71 | Ga0075362_10047263 | 3300006177 | Bacteria | 1916 |
| 72 | Ga0075362_10355365 | 3300006177 | Bacteria | 734 |
| 73 | Ga0075367_10120521 | 3300006178 | Bacteria | 1616 |
| 74 | Ga0075369_10123611 | 3300006186 | Bacteria | 1172 |
| 75 | Ga0075369_10217565 | 3300006186 | Bacteria | 884 |
| 76 | Ga0075366_10030991 | 3300006195 | Bacteria | 3146 |
| 77 | Ga0075366_10293718 | 3300006195 | Bacteria | 994 |
| 78 | Ga0075366_10489726 | 3300006195 | Bacteria | 760 |
| 79 | Ga0097621_100184321 | 3300006237 | Bacteria | 1805 |
| 80 | Ga0097621_101405964 | 3300006237 | Bacteria | 661 |
| 81 | Ga0075370_10147138 | 3300006353 | Bacteria | 1379 |
| 82 | Ga0075370_10388347 | 3300006353 | Bacteria | 836 |
| 83 | Ga0068871_100124373 | 3300006358 | Bacteria | 2182 |
| 84 | Ga0068871_100275006 | 3300006358 | Bacteria | 1472 |
| 85 | Ga0099826_10051757 | 3300006948 | Bacteria | 2751 |
| 86 | Ga0105251_10443489 | 3300009011 | Bacteria | 601 |
| 87 | Ga0105244_10003202 | 3300009036 | Bacteria | 11867 |
| 88 | Ga0105244_10095015 | 3300009036 | Bacteria | 1463 |
| 89 | Ga0105240_11289286 | 3300009093 | Bacteria | 771 |
| 90 | Ga0105240_11936418 | 3300009093 | Bacteria | 613 |
| 91 | Ga0105245_11228246 | 3300009098 | Bacteria | 798 |
| 92 | Ga0105245_12718418 | 3300009098 | Bacteria | 548 |
| 93 | Ga0105247_10027595 | 3300009101 | Bacteria | 3432 |
| 94 | Ga0105243_10064752 | 3300009148 | Bacteria | 2934 |
| 95 | Ga0105243_10250772 | 3300009148 | Bacteria | 1580 |
| 96 | Ga0105243_10552293 | 3300009148 | Bacteria | 1101 |
| 97 | Ga0105242_10989008 | 3300009176 | Bacteria | 848 |
| 98 | Ga0105242_11907683 | 3300009176 | Bacteria | 635 |
| 99 | Ga0105248_10880740 | 3300009177 | Bacteria | 1011 |
| 100 | Ga0105237_10011043 | 3300009545 | Bacteria | 9576 |
| 101 | Ga0105237_10468076 | 3300009545 | Bacteria | 1266 |
| 102 | Ga0105237_11202102 | 3300009545 | Bacteria | 765 |
| 103 | Ga0105237_12677886 | 3300009545 | Bacteria | 510 |
| 104 | Ga0105238_10150563 | 3300009551 | Bacteria | 2302 |
| 105 | Ga0105238_10734567 | 3300009551 | Bacteria | 1000 |
| 106 | Ga0105238_11178667 | 3300009551 | Bacteria | 790 |
| 107 | Ga0105249_10468458 | 3300009553 | Bacteria | 1301 |
| 108 | Ga0105239_10106059 | 3300010375 | Bacteria | 3112 |
| 109 | Ga0105239_10327382 | 3300010375 | Bacteria | 1728 |
| 110 | Ga0105239_11016642 | 3300010375 | Unclassified | 953 |
| 111 | Ga0105239_12153575 | 3300010375 | Bacteria | 648 |
| 112 | Ga0105246_10154937 | 3300011119 | Bacteria | 1739 |
| 113 | Ga0105246_10616919 | 3300011119 | Bacteria | 939 |
| 114 | Ga0157370_10849610 | 3300013104 | Bacteria | 829 |
| 115 | Ga0157369_10206589 | 3300013105 | Bacteria | 2059 |
| 116 | Ga0157374_10230305 | 3300013296 | Bacteria | 1820 |
| 117 | Ga0157378_10768075 | 3300013297 | Bacteria | 988 |
| 118 | Ga0157372_11782249 | 3300013307 | Bacteria | 708 |
| 119 | Ga0157375_10207867 | 3300013308 | Bacteria | 2114 |
| 120 | Ga0163163_11239018 | 3300014325 | Bacteria | 808 |
| 121 | Ga0163163_13070920 | 3300014325 | Bacteria | 521 |
| 122 | Ga0182008_10000357 | 3300014497 | Bacteria | 35568 |
| 123 | Ga0182008_10100424 | 3300014497 | Bacteria | 1430 |
| 124 | Ga0182008_10106835 | 3300014497 | Bacteria | 1385 |
| 125 | Ga0182008_10146581 | 3300014497 | Bacteria | 1183 |
| 126 | Ga0182008_10421689 | 3300014497 | Bacteria | 720 |
| 127 | Ga0157379_10882479 | 3300014968 | Bacteria | 848 |
| 128 | Ga0157379_11006937 | 3300014968 | Bacteria | 794 |
| 129 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 130 | Ga0182006_1006174 | 3300015261 | Bacteria | 5599 |
| 131 | Ga0182006_1036027 | 3300015261 | Bacteria | 1969 |
| 132 | Ga0182006_1083138 | 3300015261 | Bacteria | 1165 |
| 133 | Ga0182007_10000072 | 3300015262 | Bacteria | 81814 |
| 134 | Ga0182007_10009811 | 3300015262 | Bacteria | 3823 |
| 135 | Ga0182007_10010709 | 3300015262 | Bacteria | 3608 |
| 136 | Ga0182007_10011212 | 3300015262 | Bacteria | 3497 |
| 137 | Ga0182005_1000029 | 3300015265 | Bacteria | 214132 |
| 138 | Ga0182005_1000822 | 3300015265 | Bacteria | 13991 |
| 139 | Ga0163161_10016825 | 3300017792 | Bacteria | 5112 |
| 140 | Ga0163161_10456040 | 3300017792 | Bacteria | 1034 |
| 141 | Ga0213876_10051756 | 3300021384 | Bacteria | 2170 |
| 142 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 143 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 144 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 145 | Ga0209672_114835 | 3300025228 | Unclassified | 890 |
| 146 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 147 | Ga0207427_100291 | 3300025231 | Bacteria | 35604 |
| 148 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 149 | Ga0209437_120323 | 3300025233 | Bacteria | 818 |
| 150 | Ga0207425_1000474 | 3300025245 | Bacteria | 25484 |
| 151 | Ga0209646_1000049 | 3300025246 | Bacteria | 301924 |
| 152 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 153 | Ga0209677_100744 | 3300025253 | Bacteria | 16516 |
| 154 | Ga0209148_1041928 | 3300025254 | Bacteria | 629 |
| 155 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 156 | Ga0209676_1000573 | 3300025292 | Bacteria | 55423 |
| 157 | Ga0209676_1016075 | 3300025292 | Bacteria | 2722 |
| 158 | Ga0209025_1005303 | 3300025294 | Bacteria | 10586 |
| 159 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 160 | Ga0209758_1000265 | 3300025297 | Bacteria | 104078 |
| 161 | Ga0209758_1001248 | 3300025297 | Bacteria | 31567 |
| 162 | Ga0209050_1000460 | 3300025298 | Bacteria | 72933 |
| 163 | Ga0209050_1020279 | 3300025298 | Bacteria | 2479 |
| 164 | Ga0209051_1000441 | 3300025303 | Bacteria | 56405 |
| 165 | Ga0209051_1002360 | 3300025303 | Bacteria | 13662 |
| 166 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 167 | Ga0209257_1014049 | 3300025304 | Bacteria | 3485 |
| 168 | Ga0209257_1015575 | 3300025304 | Bacteria | 3152 |
| 169 | Ga0207655_1004248 | 3300025728 | Bacteria | 10252 |
| 170 | Ga0207692_10002227 | 3300025898 | Bacteria | 7421 |
| 171 | Ga0207710_10032482 | 3300025900 | Bacteria | 2286 |
| 172 | Ga0207647_10053319 | 3300025904 | Bacteria | 2492 |
| 173 | Ga0207699_10001550 | 3300025906 | Bacteria | 10891 |
| 174 | Ga0207695_11663707 | 3300025913 | Bacteria | 519 |
| 175 | Ga0207671_10047788 | 3300025914 | Bacteria | 3167 |
| 176 | Ga0207671_10155811 | 3300025914 | Bacteria | 1767 |
| 177 | Ga0207671_10976133 | 3300025914 | Bacteria | 668 |
| 178 | Ga0207693_10011501 | 3300025915 | Bacteria | 7158 |
| 179 | Ga0207663_10153952 | 3300025916 | Bacteria | 1615 |
| 180 | Ga0207663_10838099 | 3300025916 | Bacteria | 733 |
| 181 | Ga0207657_10258138 | 3300025919 | Bacteria | 1387 |
| 182 | Ga0207681_10888725 | 3300025923 | Bacteria | 746 |
| 183 | Ga0207694_10316369 | 3300025924 | Bacteria | 1287 |
| 184 | Ga0207700_10007535 | 3300025928 | Bacteria | 6660 |
| 185 | Ga0207700_10134144 | 3300025928 | Bacteria | 2026 |
| 186 | Ga0207664_10048422 | 3300025929 | Bacteria | 3342 |
| 187 | Ga0207690_10002574 | 3300025932 | Bacteria | 10949 |
| 188 | Ga0207690_10020905 | 3300025932 | Unclassified | 4051 |
| 189 | Ga0207690_10781534 | 3300025932 | Bacteria | 788 |
| 190 | Ga0207706_10005400 | 3300025933 | Bacteria | 11913 |
| 191 | Ga0207706_10011853 | 3300025933 | Bacteria | 7937 |
| 192 | Ga0207686_10307030 | 3300025934 | Bacteria | 1180 |
| 193 | Ga0207709_10070630 | 3300025935 | Bacteria | 2215 |
| 194 | Ga0207665_10026654 | 3300025939 | Bacteria | 3816 |
| 195 | Ga0207679_10000864 | 3300025945 | Bacteria | 19388 |
| 196 | Ga0207703_10182211 | 3300026035 | Bacteria | 1854 |
| 197 | Ga0207703_10459407 | 3300026035 | Bacteria | 1191 |
| 198 | Ga0207639_10245652 | 3300026041 | Bacteria | 1559 |
| 199 | Ga0207639_10269547 | 3300026041 | Bacteria | 1493 |
| 200 | Ga0207702_10784301 | 3300026078 | Bacteria | 942 |
| 201 | Ga0207641_10320474 | 3300026088 | Bacteria | 1470 |
| 202 | Ga0207641_10508519 | 3300026088 | Bacteria | 1171 |
| 203 | Ga0207648_10124715 | 3300026089 | Bacteria | 2265 |
| 204 | Ga0207674_10051822 | 3300026116 | Bacteria | 4187 |
| 205 | Ga0207674_10607723 | 3300026116 | Bacteria | 1056 |
| 206 | Ga0207683_11569114 | 3300026121 | Bacteria | 607 |
| 207 | Ga0209813_10021403 | 3300027866 | Bacteria | 1818 |
| 208 | Ga0209974_10076132 | 3300027876 | Bacteria | 1149 |
| 209 | Ga0268266_10201458 | 3300028379 | Bacteria | 1822 |
| 210 | Ga0268266_10634331 | 3300028379 | Bacteria | 1028 |
| 211 | Ga0268264_10000153 | 3300028381 | Bacteria | 157298 |
| 212 | Ga0268264_10996464 | 3300028381 | Bacteria | 844 |
| 213 | Ga0265318_10149805 | 3300028577 | Unclassified | 856 |
| 214 | Ga0307517_10378181 | 3300028786 | Bacteria | 758 |
| 215 | Ga0307511_10000014 | 3300030521 | Bacteria | 127602 |
| 216 | Ga0307511_10087724 | 3300030521 | Bacteria | 2133 |
| 217 | Ga0307511_10097613 | 3300030521 | Bacteria | 1950 |
| 218 | Ga0265330_10027227 | 3300031235 | Bacteria | 2583 |
| 219 | Ga0265330_10064250 | 3300031235 | Bacteria | 1594 |
| 220 | Ga0265332_10291061 | 3300031238 | Bacteria | 674 |
| 221 | Ga0265325_10010454 | 3300031241 | Bacteria | 5374 |
| 222 | Ga0265325_10012010 | 3300031241 | Bacteria | 4962 |
| 223 | Ga0265340_10109808 | 3300031247 | Bacteria | 1276 |
| 224 | Ga0265340_10188851 | 3300031247 | Bacteria | 929 |
| 225 | Ga0265339_10113185 | 3300031249 | Bacteria | 1402 |
| 226 | Ga0265331_10070112 | 3300031250 | Unclassified | 1641 |
| 227 | Ga0265316_10048680 | 3300031344 | Bacteria | 3344 |
| 228 | Ga0265316_10070861 | 3300031344 | Bacteria | 2688 |
| 229 | Ga0307513_10430301 | 3300031456 | Bacteria | 1048 |
| 230 | Ga0307509_10033194 | 3300031507 | Bacteria | 5681 |
| 231 | Ga0307509_10304114 | 3300031507 | Bacteria | 1341 |
| 232 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 233 | Ga0307508_10069917 | 3300031616 | Bacteria | 3082 |
| 234 | Ga0307508_10138116 | 3300031616 | Bacteria | 2040 |
| 235 | Ga0265314_10109135 | 3300031711 | Bacteria | 1762 |
| 236 | Ga0265342_10045287 | 3300031712 | Bacteria | 2649 |
| 237 | Ga0307516_10014988 | 3300031730 | Bacteria | 8173 |
| 238 | Ga0307516_10095616 | 3300031730 | Bacteria | 2793 |
| 239 | Ga0307507_10023098 | 3300033179 | Bacteria | 6842 |
| 240 | Ga0307507_10245614 | 3300033179 | Bacteria | 1164 |
| 241 | Ga0307510_10008632 | 3300033180 | Bacteria | 12144 |
| 242 | Ga0307510_10397309 | 3300033180 | Bacteria | 822 |
| 243 | Ga0373934_0010218 | 3300035086 | Bacteria | 3523 |
| 244 | Ga0373923_0100922 | 3300035111 | Bacteria | 1272 |
| 245 | Ga0373936_0253631 | 3300035113 | Bacteria | 786 |
| 246 | Ga0373953_0006562 | 3300035117 | Bacteria | 3842 |
| 247 | Ga0373954_0000584 | 3300035118 | Bacteria | 13828 |
| 248 | Ga0373954_0003159 | 3300035118 | Bacteria | 6963 |
| 249 | Ga0373956_0002897 | 3300035119 | Bacteria | 6946 |
| 250 | Ga0373957_0007168 | 3300035120 | Bacteria | 3555 |
| 251 | Ga0373943_0209587 | 3300035170 | Bacteria | 1082 |
| 252 | Ga0373955_0001386 | 3300035172 | Bacteria | 10297 |
| 253 | Ga0373955_0012385 | 3300035172 | Bacteria | 4098 |
| 254 | Ga0373924_0008307 | 3300035410 | Bacteria | 3768 |
| 255 | Ga0373935_0022754 | 3300035692 | Bacteria | 3847 |
| 256 | Ga0373935_0141768 | 3300035692 | Bacteria | 1624 |
| 257 | Ga0373935_0428964 | 3300035692 | Bacteria | 952 |
| 258 | Ga0373927_0192203 | 3300035695 | Bacteria | 1339 |
| 259 | Ga0373927_0309828 | 3300035695 | Bacteria | 1039 |
| 260 | Ga0373933_0005542 | 3300035724 | Bacteria | 6877 |
| 261 | Ga0373933_0019974 | 3300035724 | Bacteria | 3792 |
| 262 | Ga0373947_0023741 | 3300035725 | Bacteria | 3569 |
| 263 | Ga0373937_0002028 | 3300036401 | Bacteria | 16914 |
| 264 | Ga0373937_0014040 | 3300036401 | Bacteria | 7063 |
| 265 | Ga0373925_0030797 | 3300037068 | Bacteria | 3939 |
| 266 | Ga0395905_1587039 | 3300037471 | Bacteria | 559 |
| 267 | Ga0436364_0086439 | 3300037853 | Bacteria | 554 |
| 268 | Ga0436364_0947489 | 3300037853 | Bacteria | 4359 |
| 269 | Ga0436365_1319655 | 3300039437 | Bacteria | 5117 |
| 270 | Ga0436360_0101928 | 3300039438 | Bacteria | 814 |
| 271 | Ga0436360_0321371 | 3300039438 | Unclassified | 1176 |
| 272 | Ga0436360_1279581 | 3300039438 | Bacteria | 1286 |
| 273 | Ga0436361_0432098 | 3300039447 | Unclassified | 570 |
| 274 | Ga0436361_0513740 | 3300039447 | Bacteria | 868 |
| 275 | Ga0436363_0623699 | 3300039450 | Bacteria | 559 |
| 276 | Ga0436363_0688018 | 3300039450 | Unclassified | 1060 |
| 277 | Ga0451833_0262796 | 3300041491 | Bacteria | 545 |
| 278 | Ga0451839_0308465 | 3300041496 | Bacteria | 714 |
| 279 | Ga0451845_0774461 | 3300041501 | Bacteria | 514 |
| 280 | Ga0451853_3820061 | 3300041512 | Bacteria | 677 |
| 281 | Ga0439458_0111805 | 3300042157 | Bacteria | 715 |
| 282 | Ga0450893_0013950 | 3300042532 | Bacteria | 1343 |
| 283 | Ga0451577_0000060 | 3300042876 | Bacteria | 268725 |
| 284 | Ga0466965_0096073 | 3300044683 | Unclassified | 1512 |
| 285 | Ga0466966_0025507 | 3300044684 | Bacteria | 3860 |
| 286 | Ga0453684_0000211 | 3300044712 | Bacteria | 254993 |
| 287 | Ga0466959_0018721 | 3300045049 | Bacteria | 5086 |
| 288 | Ga0495592_0017995 | 3300046454 | Bacteria | 5368 |
| 289 | Ga0495592_0023669 | 3300046454 | Bacteria | 4672 |
| 290 | Ga0495592_0023775 | 3300046454 | Bacteria | 4661 |
| 291 | Ga0495592_0078974 | 3300046454 | Bacteria | 2383 |
| 292 | Ga0495590_0132311 | 3300046457 | Bacteria | 897 |
| 293 | Ga0495629_0002194 | 3300046459 | Bacteria | 15062 |
| 294 | Ga0495629_0004909 | 3300046459 | Bacteria | 10038 |
| 295 | Ga0495629_0035323 | 3300046459 | Bacteria | 3532 |
| 296 | Ga0495638_0005109 | 3300046460 | Bacteria | 9828 |
| 297 | Ga0495641_0178272 | 3300046461 | Bacteria | 951 |
| 298 | Ga0495651_0001006 | 3300046462 | Bacteria | 21897 |
| 299 | Ga0495651_0001421 | 3300046462 | Bacteria | 18588 |
| 300 | Ga0495651_0018674 | 3300046462 | Bacteria | 5372 |
| 301 | Ga0495651_0281771 | 3300046462 | Bacteria | 1122 |
| 302 | Ga0495651_0325787 | 3300046462 | Bacteria | 1022 |
| 303 | Ga0495651_0327431 | 3300046462 | Bacteria | 1019 |
| 304 | Ga0495653_0011823 | 3300046463 | Bacteria | 7128 |
| 305 | Ga0495653_0030435 | 3300046463 | Bacteria | 4300 |
| 306 | Ga0495653_0081016 | 3300046463 | Bacteria | 2399 |
| 307 | Ga0495653_0297618 | 3300046463 | Bacteria | 1053 |
| 308 | Ga0495582_0266714 | 3300046473 | Unclassified | 982 |
| 309 | Ga0495605_0094144 | 3300046474 | Bacteria | 1384 |
| 310 | Ga0495639_0025899 | 3300046475 | Bacteria | 2589 |
| 311 | Ga0495662_0001507 | 3300046476 | Bacteria | 11559 |
| 312 | Ga0495664_0003228 | 3300046477 | Bacteria | 8854 |
| 313 | Ga0495664_0058143 | 3300046477 | Bacteria | 2300 |
| 314 | Ga0495664_0381706 | 3300046477 | Bacteria | 847 |
| 315 | Ga0495664_0454880 | 3300046477 | Bacteria | 766 |
| 316 | Ga0495607_0256339 | 3300046501 | Bacteria | 840 |
| 317 | Ga0495583_0012479 | 3300046506 | Bacteria | 4804 |
| 318 | Ga0495606_0005632 | 3300046507 | Bacteria | 11878 |
| 319 | Ga0495606_0285248 | 3300046507 | Bacteria | 901 |
| 320 | Ga0495608_0002889 | 3300046511 | Bacteria | 12309 |
| 321 | Ga0495608_0004042 | 3300046511 | Bacteria | 10529 |
| 322 | Ga0495608_0019067 | 3300046511 | Bacteria | 4728 |
| 323 | Ga0495608_0133989 | 3300046511 | Bacteria | 1584 |
| 324 | Ga0495608_0282323 | 3300046511 | Bacteria | 1030 |
| 325 | Ga0495608_0409078 | 3300046511 | Unclassified | 829 |
| 326 | Ga0495616_0110719 | 3300046513 | Bacteria | 1276 |
| 327 | Ga0495618_0000741 | 3300046514 | Bacteria | 22826 |
| 328 | Ga0495618_0104302 | 3300046514 | Bacteria | 1815 |
| 329 | Ga0495618_0373857 | 3300046514 | Bacteria | 875 |
| 330 | Ga0495618_0425228 | 3300046514 | Bacteria | 809 |
| 331 | Ga0495628_0005140 | 3300046516 | Bacteria | 11501 |
| 332 | Ga0495628_0008625 | 3300046516 | Bacteria | 8734 |
| 333 | Ga0495628_0020789 | 3300046516 | Bacteria | 5408 |
| 334 | Ga0495628_0292072 | 3300046516 | Bacteria | 1208 |
| 335 | Ga0495628_0418137 | 3300046516 | Bacteria | 977 |
| 336 | Ga0495630_1205493 | 3300046517 | Bacteria | 572 |
| 337 | Ga0495648_0026027 | 3300046524 | Bacteria | 3947 |
| 338 | Ga0495648_0428635 | 3300046524 | Unclassified | 584 |
| 339 | Ga0495652_0025881 | 3300046529 | Bacteria | 5184 |
| 340 | Ga0495652_0027255 | 3300046529 | Bacteria | 5036 |
| 341 | Ga0495652_0038419 | 3300046529 | Bacteria | 4147 |
| 342 | Ga0495652_0112553 | 3300046529 | Bacteria | 2186 |
| 343 | Ga0495652_0380727 | 3300046529 | Bacteria | 1003 |
| 344 | Ga0495654_0151989 | 3300046530 | Bacteria | 1023 |
| 345 | Ga0495665_0056090 | 3300046531 | Bacteria | 2080 |
| 346 | Ga0495640_0005375 | 3300046533 | Bacteria | 10189 |
| 347 | Ga0495640_0012625 | 3300046533 | Bacteria | 6448 |
| 348 | Ga0495640_0016059 | 3300046533 | Bacteria | 5612 |
| 349 | Ga0495640_0025251 | 3300046533 | Bacteria | 4312 |
| 350 | Ga0495587_0007946 | 3300046536 | Bacteria | 6853 |
| 351 | Ga0495587_0010989 | 3300046536 | Bacteria | 5743 |
| 352 | Ga0495587_0022631 | 3300046536 | Bacteria | 3868 |
| 353 | Ga0495597_0166986 | 3300046542 | Bacteria | 895 |
| 354 | Ga0495645_0016180 | 3300046543 | Bacteria | 5319 |
| 355 | Ga0495645_0033417 | 3300046543 | Bacteria | 3753 |
| 356 | Ga0495645_0050856 | 3300046543 | Bacteria | 3015 |
| 357 | Ga0495622_0029475 | 3300046557 | Bacteria | 2564 |
| 358 | Ga0495622_0050878 | 3300046557 | Bacteria | 1922 |
| 359 | Ga0495667_0000654 | 3300046559 | Bacteria | 22139 |
| 360 | Ga0495667_0066680 | 3300046559 | Bacteria | 2352 |
| 361 | Ga0495667_0123246 | 3300046559 | Bacteria | 1673 |
| 362 | Ga0495667_0127106 | 3300046559 | Bacteria | 1644 |
| 363 | Ga0495656_0177920 | 3300046615 | Bacteria | 1044 |
| 364 | Ga0495668_0018238 | 3300046616 | Bacteria | 4056 |
| 365 | Ga0495668_0032038 | 3300046616 | Bacteria | 2960 |
| 366 | Ga0495668_0232852 | 3300046616 | Bacteria | 1009 |
| 367 | Ga0495634_0004062 | 3300046642 | Bacteria | 11588 |
| 368 | Ga0495634_0275094 | 3300046642 | Bacteria | 1024 |
| 369 | Ga0495634_0291976 | 3300046642 | Unclassified | 988 |
| 370 | Ga0495634_0326124 | 3300046642 | Bacteria | 923 |
| 371 | Ga0495634_0724284 | 3300046642 | Bacteria | 571 |
| 372 | Ga0495625_0031122 | 3300046660 | Bacteria | 3972 |
| 373 | Ga0495625_0085262 | 3300046660 | Bacteria | 2193 |
| 374 | Ga0495625_0142343 | 3300046660 | Bacteria | 1617 |
| 375 | Ga0495625_0227528 | 3300046660 | Bacteria | 1219 |
| 376 | Ga0495625_0263694 | 3300046660 | Bacteria | 1114 |
| 377 | Ga0495635_0001817 | 3300046663 | Bacteria | 14418 |
| 378 | Ga0495635_0001940 | 3300046663 | Bacteria | 14058 |
| 379 | Ga0495635_0003108 | 3300046663 | Bacteria | 11421 |
| 380 | Ga0495635_0037386 | 3300046663 | Bacteria | 3361 |
| 381 | Ga0495635_0187665 | 3300046663 | Unclassified | 1404 |
| 382 | Ga0495588_0125166 | 3300046674 | Bacteria | 1355 |
| 383 | Ga0495588_0183715 | 3300046674 | Bacteria | 1105 |
| 384 | Ga0495657_0020044 | 3300046675 | Bacteria | 4813 |
| 385 | Ga0495657_0021323 | 3300046675 | Bacteria | 4649 |
| 386 | Ga0495657_0026418 | 3300046675 | Bacteria | 4111 |
| 387 | Ga0495657_0027076 | 3300046675 | Bacteria | 4051 |
| 388 | Ga0495657_0039925 | 3300046675 | Bacteria | 3222 |
| 389 | Ga0495657_0253319 | 3300046675 | Bacteria | 1059 |
| 390 | Ga0495599_0005427 | 3300046678 | Bacteria | 7619 |
| 391 | Ga0495599_0006485 | 3300046678 | Bacteria | 7062 |
| 392 | Ga0495599_0012882 | 3300046678 | Bacteria | 5161 |
| 393 | Ga0495599_0239185 | 3300046678 | Bacteria | 1107 |
| 394 | Ga0495623_0003554 | 3300046679 | Bacteria | 10313 |
| 395 | Ga0495623_0011556 | 3300046679 | Bacteria | 5715 |
| 396 | Ga0495623_0013037 | 3300046679 | Bacteria | 5383 |
| 397 | Ga0495623_0449811 | 3300046679 | Bacteria | 686 |
| 398 | Ga0495646_0001331 | 3300046680 | Bacteria | 14585 |
| 399 | Ga0495646_0015943 | 3300046680 | Bacteria | 4769 |
| 400 | Ga0495646_0028720 | 3300046680 | Bacteria | 3481 |
| 401 | Ga0495646_0038820 | 3300046680 | Bacteria | 2938 |
| 402 | Ga0495647_0231884 | 3300046681 | Bacteria | 817 |
| 403 | Ga0495658_0009649 | 3300046683 | Bacteria | 4813 |
| 404 | Ga0495658_0056970 | 3300046683 | Bacteria | 2231 |
| 405 | Ga0495669_0209859 | 3300046684 | Bacteria | 932 |
| 406 | Ga0495613_0109643 | 3300046689 | Bacteria | 1990 |
| 407 | Ga0495613_0174371 | 3300046689 | Bacteria | 1525 |
| 408 | Ga0495613_0218520 | 3300046689 | Bacteria | 1338 |
| 409 | Ga0495613_0333364 | 3300046689 | Bacteria | 1045 |
| 410 | Ga0495624_0009016 | 3300046690 | Bacteria | 6933 |
| 411 | Ga0495624_0014746 | 3300046690 | Bacteria | 5292 |
| 412 | Ga0495670_0186519 | 3300046691 | Unclassified | 1096 |
| 413 | Ga0495671_0039479 | 3300046692 | Bacteria | 2383 |
| 414 | Ga0495649_0051765 | 3300046694 | Bacteria | 2226 |
| 415 | Ga0495600_0017015 | 3300046809 | Bacteria | 4621 |
| 416 | Ga0495600_0033575 | 3300046809 | Bacteria | 3331 |
| 417 | Ga0495600_0040439 | 3300046809 | Bacteria | 3036 |
| 418 | Ga0495600_0042899 | 3300046809 | Bacteria | 2949 |
| 419 | Ga0495600_0167162 | 3300046809 | Bacteria | 1420 |
| 420 | Ga0495600_0420431 | 3300046809 | Unclassified | 829 |
| 421 | Ga0495660_0251165 | 3300046810 | Bacteria | 820 |
| 422 | Ga0495581_0279515 | 3300047315 | Bacteria | 976 |
| 423 | Ga0495604_0001231 | 3300047317 | Bacteria | 20971 |
| 424 | Ga0495604_0001719 | 3300047317 | Bacteria | 17960 |
| 425 | Ga0495604_0007296 | 3300047317 | Bacteria | 8752 |
| 426 | Ga0495604_0052710 | 3300047317 | Bacteria | 3148 |
| 427 | Ga0495604_0092930 | 3300047317 | Bacteria | 2233 |
| 428 | Ga0495604_0114097 | 3300047317 | Bacteria | 1965 |
| 429 | Ga0495674_0002137 | 3300047319 | Bacteria | 19412 |
| 430 | Ga0495674_0014903 | 3300047319 | Bacteria | 7274 |
| 431 | Ga0495674_0093233 | 3300047319 | Bacteria | 2570 |
| 432 | Ga0495674_0299855 | 3300047319 | Bacteria | 1313 |
| 433 | Ga0495676_0008971 | 3300047321 | Bacteria | 9127 |
| 434 | Ga0495676_0054832 | 3300047321 | Bacteria | 3166 |
| 435 | Ga0495676_0416836 | 3300047321 | Unclassified | 889 |
| 436 | Ga0495680_0002906 | 3300047322 | Bacteria | 17209 |
| 437 | Ga0495680_0018086 | 3300047322 | Bacteria | 5997 |
| 438 | Ga0495680_0036768 | 3300047322 | Bacteria | 3927 |
| 439 | Ga0495683_0079575 | 3300047323 | Bacteria | 1600 |
| 440 | Ga0495675_0005020 | 3300047444 | Bacteria | 8051 |
| 441 | Ga0495675_0017647 | 3300047444 | Bacteria | 4525 |
| 442 | Ga0495673_0292572 | 3300047469 | Bacteria | 585 |
| 443 | Ga0495684_0002299 | 3300047471 | Bacteria | 15301 |
| 444 | Ga0495684_0003481 | 3300047471 | Bacteria | 12321 |
| 445 | Ga0495684_0147368 | 3300047471 | Bacteria | 1762 |
| 446 | Ga0495686_0100894 | 3300047472 | Bacteria | 1741 |
| 447 | Ga0495593_0008924 | 3300047673 | Bacteria | 5819 |
| 448 | Ga0495602_0011794 | 3300048088 | Bacteria | 9027 |
| 449 | Ga0495602_0027242 | 3300048088 | Bacteria | 5495 |
| 450 | Ga0495602_0027935 | 3300048088 | Bacteria | 5411 |
| 451 | Ga0495602_0342640 | 3300048088 | Unclassified | 1081 |
| 452 | Ga0495602_0690488 | 3300048088 | Bacteria | 693 |
| 453 | Ga0495602_0755679 | 3300048088 | Bacteria | 656 |
| 454 | Ga0495614_0325475 | 3300048089 | Bacteria | 713 |
| 455 | Ga0496100_0255821 | 3300048903 | Bacteria | 1297 |
| 456 | Ga0496100_0280065 | 3300048903 | Bacteria | 1243 |
| 457 | Ga0496100_0792492 | 3300048903 | Bacteria | 742 |
| 458 | Ga0496102_1392705 | 3300048905 | Bacteria | 620 |
| 459 | Ga0496103_0448429 | 3300048906 | Bacteria | 828 |
| 460 | Ga0496104_0008588 | 3300048907 | Bacteria | 9085 |
| 461 | Ga0496105_0009824 | 3300048908 | Bacteria | 7498 |
| 462 | Ga0496106_0001072 | 3300048909 | Bacteria | 20176 |
| 463 | Ga0496106_0516321 | 3300048909 | Bacteria | 959 |
| 464 | Ga0496107_0255517 | 3300048910 | Bacteria | 1304 |
| 465 | Ga0496107_0520346 | 3300048910 | Bacteria | 882 |
| 466 | Ga0496108_0544537 | 3300048911 | Bacteria | 1013 |
| 467 | Ga0496109_0735387 | 3300048912 | Bacteria | 924 |
| 468 | Ga0496110_0150999 | 3300048913 | Bacteria | 2104 |
| 469 | Ga0496111_0344873 | 3300048914 | Bacteria | 1103 |
| 470 | Ga0496111_0363004 | 3300048914 | Bacteria | 1072 |
| 471 | Ga0496112_0024034 | 3300048915 | Bacteria | 5832 |
| 472 | Ga0496112_0706831 | 3300048915 | Bacteria | 936 |
| 473 | Ga0496112_0803401 | 3300048915 | Bacteria | 865 |
| 474 | Ga0496113_0005589 | 3300048916 | Bacteria | 7860 |
| 475 | Ga0496113_0103834 | 3300048916 | Bacteria | 2205 |
| 476 | Ga0496114_0201129 | 3300048917 | Bacteria | 1745 |
| 477 | Ga0496114_0351545 | 3300048917 | Bacteria | 1304 |
| 478 | Ga0496115_0065521 | 3300048918 | Bacteria | 2934 |
| 479 | Ga0496115_0182379 | 3300048918 | Bacteria | 1735 |
| 480 | Ga0496115_0546085 | 3300048918 | Bacteria | 927 |
| 481 | Ga0496116_0055736 | 3300048919 | Bacteria | 2595 |
| 482 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 483 | Ga0496117_0019280 | 3300048920 | Bacteria | 5610 |
| 484 | Ga0496117_0075953 | 3300048920 | Bacteria | 2230 |
| 485 | Ga0496117_0113493 | 3300048920 | Bacteria | 1682 |
| 486 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 487 | Ga0496118_0002820 | 3300048921 | Bacteria | 22739 |
| 488 | Ga0496118_0037839 | 3300048921 | Bacteria | 3876 |
| 489 | Ga0496118_0096156 | 3300048921 | Bacteria | 2019 |
| 490 | Ga0496118_0112142 | 3300048921 | Bacteria | 1806 |
| 491 | Ga0496118_0292525 | 3300048921 | Bacteria | 899 |
| 492 | Ga0496119_0004149 | 3300048922 | Bacteria | 14581 |
| 493 | Ga0496119_0027920 | 3300048922 | Bacteria | 3865 |
| 494 | Ga0496119_0426901 | 3300048922 | Unclassified | 628 |
| 495 | Ga0496120_0010110 | 3300048923 | Bacteria | 6611 |
| 496 | Ga0496120_0020017 | 3300048923 | Bacteria | 4264 |
| 497 | Ga0496121_0001728 | 3300048924 | Bacteria | 35654 |
| 498 | Ga0496121_0002189 | 3300048924 | Bacteria | 30586 |
| 499 | Ga0496121_0002860 | 3300048924 | Bacteria | 25453 |
| 500 | Ga0496121_0023933 | 3300048924 | Bacteria | 5857 |
| 501 | Ga0496121_0087579 | 3300048924 | Bacteria | 2444 |
| 502 | Ga0496121_0104555 | 3300048924 | Bacteria | 2175 |
| 503 | Ga0496121_0140140 | 3300048924 | Bacteria | 1795 |
| 504 | Ga0496121_0222977 | 3300048924 | Bacteria | 1326 |
| 505 | Ga0496122_0005214 | 3300048925 | Bacteria | 15597 |
| 506 | Ga0496123_0009019 | 3300048926 | Bacteria | 9047 |
| 507 | Ga0496123_0289613 | 3300048926 | Bacteria | 787 |
| 508 | Ga0496124_0000916 | 3300048927 | Bacteria | 47613 |
| 509 | Ga0496124_0119508 | 3300048927 | Bacteria | 2108 |
| 510 | Ga0496124_0255698 | 3300048927 | Bacteria | 1292 |
| 511 | Ga0496124_0324533 | 3300048927 | Bacteria | 1101 |
| 512 | Ga0496125_0042013 | 3300048928 | Bacteria | 3901 |
| 513 | Ga0496125_0087442 | 3300048928 | Bacteria | 2354 |
| 514 | Ga0496125_0146749 | 3300048928 | Bacteria | 1629 |
| 515 | Ga0496126_0005239 | 3300048929 | Bacteria | 14926 |
| 516 | Ga0496126_0024537 | 3300048929 | Bacteria | 5819 |
| 517 | Ga0496126_0036557 | 3300048929 | Bacteria | 4590 |
| 518 | Ga0496126_0917427 | 3300048929 | Bacteria | 663 |
| 519 | Ga0495682_0021623 | 3300049460 | Bacteria | 2409 |
| 520 | Ga0501069_0219032 | 3300049585 | Bacteria | 1106 |
| 521 | Ga0501069_0366020 | 3300049585 | Bacteria | 851 |
| 522 | Ga0501207_011694 | 3300049654 | Bacteria | 1310 |
| 523 | Ga0501230_060471 | 3300049667 | Unclassified | 766 |
| 524 | Ga0501263_000853 | 3300049760 | Unclassified | 2605 |
| 525 | nmdc:mga03683_279212_c1 | 3300050489 | Bacteria | 780 |
| 526 | nmdc:mga03683_7659_c1 | 3300050489 | Bacteria | 3760 |
| 527 | nmdc:mga03n38_172766_c1 | 3300050490 | Bacteria | 1102 |
| 528 | nmdc:mga03n38_632483_c1 | 3300050490 | Bacteria | 612 |
| 529 | nmdc:mga00v17_23257_c1 | 3300050491 | Bacteria | 3584 |
| 530 | nmdc:mga00v17_232777_c1 | 3300050491 | Bacteria | 1194 |
| 531 | nmdc:mga00v17_840509_c1 | 3300050491 | Bacteria | 583 |
| 532 | nmdc:mga0yw44_84439_c1 | 3300050492 | Bacteria | 1996 |
| 533 | nmdc:mga0k408_11011_c1 | 3300050493 | Bacteria | 4910 |
| 534 | nmdc:mga0k408_161193_c1 | 3300050493 | Bacteria | 1336 |
| 535 | nmdc:mga06z11_386344_c1 | 3300050494 | Bacteria | 841 |
| 536 | nmdc:mga06z11_39616_c1 | 3300050494 | Bacteria | 2346 |
| 537 | nmdc:mga04h51_33427_c1 | 3300050495 | Bacteria | 1637 |
| 538 | nmdc:mga04h51_442527_c1 | 3300050495 | Bacteria | 549 |
| 539 | nmdc:mga07m45_216703_c1 | 3300050496 | Bacteria | 1113 |
| 540 | nmdc:mga07m45_477621_c1 | 3300050496 | Bacteria | 722 |
| 541 | nmdc:mga0sz30_110790_c1 | 3300050516 | Unclassified | 910 |
| 542 | nmdc:mga0sz30_27992_c1 | 3300050516 | Bacteria | 2317 |
| 543 | Ga0495601_0004876 | 3300053077 | Bacteria | 7788 |
| 544 | Ga0495601_0006948 | 3300053077 | Bacteria | 6629 |
| 545 | Ga0495601_0014495 | 3300053077 | Bacteria | 4751 |
| 546 | Ga0495601_0927372 | 3300053077 | Bacteria | 549 |
| 547 | Ga0495612_0005438 | 3300053078 | Bacteria | 5265 |
| 548 | Ga0495612_0160381 | 3300053078 | Bacteria | 982 |
| 549 | Ga0500610_0074907 | 3300053079 | Bacteria | 1765 |
| 550 | Ga0495655_0015942 | 3300053083 | Bacteria | 1608 |
| 551 | Ga0495595_0002007 | 3300053084 | Bacteria | 7907 |
| 552 | Ga0495595_0005927 | 3300053084 | Bacteria | 4956 |
| 553 | Ga0495595_0173339 | 3300053084 | Bacteria | 1068 |
| 554 | Ga0495619_0004943 | 3300053085 | Bacteria | 8466 |
| 555 | Ga0495619_0031133 | 3300053085 | Bacteria | 3455 |
| 556 | Ga0495619_0129026 | 3300053085 | Bacteria | 1737 |
| 557 | Ga0495619_0238668 | 3300053085 | Unclassified | 1260 |
| 558 | Ga0495619_0532972 | 3300053085 | Bacteria | 806 |
| 559 | Ga0495619_0810358 | 3300053085 | Bacteria | 633 |
| 560 | Ga0500644_0537206 | 3300053088 | Bacteria | 516 |
| 561 | Ga0500646_0002045 | 3300053090 | Bacteria | 5262 |
| 562 | Ga0500583_0000783 | 3300053092 | Bacteria | 9219 |
| 563 | Ga0500651_0299680 | 3300053093 | Bacteria | 922 |
| 564 | Ga0500566_0000394 | 3300053094 | Bacteria | 24254 |
| 565 | Ga0500566_0131216 | 3300053094 | Bacteria | 1340 |
| 566 | Ga0500640_002770 | 3300053095 | Bacteria | 5900 |
| 567 | Ga0500556_0062317 | 3300053104 | Bacteria | 1376 |
| 568 | Ga0500571_000024 | 3300053110 | Bacteria | 52195 |
| 569 | Ga0500572_000156 | 3300053111 | Bacteria | 23706 |
| 570 | Ga0500591_139102 | 3300053115 | Bacteria | 962 |
| 571 | Ga0500593_000323 | 3300053117 | Bacteria | 19241 |
| 572 | Ga0500595_001575 | 3300053119 | Bacteria | 12051 |
| 573 | Ga0500595_001671 | 3300053119 | Bacteria | 11662 |
| 574 | Ga0500595_030879 | 3300053119 | Bacteria | 1801 |
| 575 | Ga0500595_087074 | 3300053119 | Bacteria | 908 |
| 576 | Ga0500607_000025 | 3300053121 | Bacteria | 95473 |
| 577 | Ga0500608_039947 | 3300053122 | Bacteria | 2247 |
| 578 | Ga0500608_094009 | 3300053122 | Bacteria | 1397 |
| 579 | Ga0500614_000121 | 3300053123 | Bacteria | 18796 |
| 580 | Ga0500642_0018075 | 3300053130 | Unclassified | 2718 |
| 581 | Ga0500642_0239975 | 3300053130 | Bacteria | 835 |
| 582 | Ga0500642_0437289 | 3300053130 | Bacteria | 564 |
| 583 | Ga0500658_0009176 | 3300053134 | Bacteria | 3650 |
| 584 | Ga0500559_0001182 | 3300053136 | Bacteria | 15606 |
| 585 | Ga0500559_0037155 | 3300053136 | Bacteria | 2110 |
| 586 | Ga0500564_052772 | 3300053138 | Bacteria | 1857 |
| 587 | Ga0500573_0091598 | 3300053140 | Bacteria | 1716 |
| 588 | Ga0500574_000848 | 3300053141 | Bacteria | 4167 |
| 589 | Ga0500574_179982 | 3300053141 | Bacteria | 606 |
| 590 | Ga0500577_0028657 | 3300053142 | Bacteria | 1920 |
| 591 | Ga0500577_0256715 | 3300053142 | Bacteria | 760 |
| 592 | Ga0500577_0284874 | 3300053142 | Bacteria | 720 |
| 593 | Ga0500585_187648 | 3300053144 | Bacteria | 697 |
| 594 | Ga0500586_031001 | 3300053145 | Bacteria | 1762 |
| 595 | Ga0500590_018783 | 3300053148 | Bacteria | 3580 |
| 596 | Ga0500590_098043 | 3300053148 | Bacteria | 1412 |
| 597 | Ga0500603_000224 | 3300053150 | Bacteria | 14919 |
| 598 | Ga0500603_085693 | 3300053150 | Bacteria | 919 |
| 599 | Ga0500604_0004510 | 3300053151 | Bacteria | 3692 |
| 600 | Ga0500604_0110061 | 3300053151 | Bacteria | 914 |
| 601 | Ga0500616_0002571 | 3300053153 | Bacteria | 14937 |
| 602 | Ga0500616_0004212 | 3300053153 | Bacteria | 10366 |
| 603 | Ga0500619_000430 | 3300053154 | Bacteria | 7590 |
| 604 | Ga0500619_278490 | 3300053154 | Bacteria | 545 |
| 605 | Ga0500620_004709 | 3300053155 | Bacteria | 3078 |
| 606 | Ga0500622_0300843 | 3300053156 | Bacteria | 684 |
| 607 | Ga0500627_0077220 | 3300053158 | Bacteria | 1481 |
| 608 | Ga0500630_000834 | 3300053159 | Bacteria | 14264 |
| 609 | Ga0500638_005764 | 3300053162 | Bacteria | 4984 |
| 610 | Ga0500638_075341 | 3300053162 | Bacteria | 1608 |
| 611 | Ga0500639_002819 | 3300053163 | Bacteria | 8743 |
| 612 | Ga0500636_0018057 | 3300053177 | Bacteria | 4170 |
| 613 | Ga0500636_0063306 | 3300053177 | Bacteria | 2155 |
| 614 | Ga0500636_0304305 | 3300053177 | Unclassified | 783 |
| 615 | Ga0500649_070145 | 3300053722 | Bacteria | 1447 |
| 616 | Ga0500552_005361 | 3300053733 | Bacteria | 1394 |
| 617 | Ga0500552_035465 | 3300053733 | Bacteria | 789 |
| 618 | Ga0500596_000685 | 3300053735 | Bacteria | 6593 |
| 619 | Ga0500596_001137 | 3300053735 | Bacteria | 5360 |
| 620 | Ga0500596_017239 | 3300053735 | Bacteria | 1083 |
| 621 | Ga0500601_009020 | 3300053737 | Bacteria | 1111 |
| 622 | Ga0500661_040734 | 3300055283 | Bacteria | 823 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 3005416602 | 3005417420 | 126 |
| 2 | iso_pu_bacteria | 8005314921 | 8005315791 | 126 |
| 3 | iso_pu_bacteria | 2519899620 | 2520380232 | 127 |
| 4 | iso_pu_bacteria | 2523231067 | 2523470840 | 127 |
| 5 | iso_pu_bacteria | 2582581307 | 2585276653 | 127 |
| 6 | iso_pu_bacteria | 2615840698 | 2616554272 | 127 |
| 7 | iso_pu_bacteria | 2643221672 | 2644399138 | 127 |
| 8 | iso_pu_bacteria | 2738543031 | 2739351415 | 127 |
| 9 | iso_pu_bacteria | 2775507266 | 2778175457 | 127 |
| 10 | iso_pu_bacteria | 2841846520 | 2841847419 | 127 |
| 11 | iso_pu_bacteria | 2842124991 | 2842126551 | 127 |
| 12 | iso_pu_bacteria | 2852387548 | 2852388517 | 127 |
| 13 | iso_pu_bacteria | 2919171160 | 2919175987 | 127 |
| 14 | iso_pu_bacteria | 2937822353 | 2937824464 | 127 |
| 15 | iso_pu_bacteria | 2945945610 | 2945946265 | 127 |
| 16 | 3300046454 | Ga0495592_0023775 | Ga0495592_0023775_3874_4260 | 128 |
| 17 | 3300046462 | Ga0495651_0001421 | Ga0495651_0001421_2051_2437 | 128 |
| 18 | 3300046463 | Ga0495653_0297618 | Ga0495653_0297618_84_470 | 128 |
| 19 | 3300046477 | Ga0495664_0058143 | Ga0495664_0058143_1398_1784 | 128 |
| 20 | 3300046511 | Ga0495608_0282323 | Ga0495608_0282323_93_479 | 128 |
| 21 | 3300046516 | Ga0495628_0292072 | Ga0495628_0292072_546_932 | 128 |
| 22 | 3300046529 | Ga0495652_0038419 | Ga0495652_0038419_1659_2045 | 128 |
| 23 | 3300046533 | Ga0495640_0025251 | Ga0495640_0025251_2933_3319 | 128 |
| 24 | 3300046536 | Ga0495587_0007946 | Ga0495587_0007946_1762_2148 | 128 |
| 25 | 3300046559 | Ga0495667_0127106 | Ga0495667_0127106_1212_1598 | 128 |
| 26 | 3300046642 | Ga0495634_0326124 | Ga0495634_0326124_445_831 | 128 |
| 27 | 3300046663 | Ga0495635_0037386 | Ga0495635_0037386_2691_3077 | 128 |
| 28 | 3300046675 | Ga0495657_0020044 | Ga0495657_0020044_538_924 | 128 |
| 29 | 3300046678 | Ga0495599_0239185 | Ga0495599_0239185_376_762 | 128 |
| 30 | 3300046679 | Ga0495623_0003554 | Ga0495623_0003554_235_621 | 128 |
| 31 | 3300046680 | Ga0495646_0028720 | Ga0495646_0028720_1921_2307 | 128 |
| 32 | 3300046689 | Ga0495613_0333364 | Ga0495613_0333364_467_853 | 128 |
| 33 | 3300046809 | Ga0495600_0033575 | Ga0495600_0033575_1479_1865 | 128 |
| 34 | 3300047317 | Ga0495604_0001719 | Ga0495604_0001719_9189_9575 | 128 |
| 35 | 3300047319 | Ga0495674_0014903 | Ga0495674_0014903_1371_1757 | 128 |
| 36 | 3300047322 | Ga0495680_0018086 | Ga0495680_0018086_3850_4236 | 128 |
| 37 | 3300048088 | Ga0495602_0027935 | Ga0495602_0027935_3172_3558 | 128 |
| 38 | 3300053085 | Ga0495619_0129026 | Ga0495619_0129026_109_495 | 128 |
| 39 | iso_pu_bacteria | 2503198000 | 2503201535 | 128 |
| 40 | iso_pu_bacteria | 2756170246 | 2756675465 | 128 |
| 41 | iso_pu_bacteria | 2791355123 | 2792749242 | 128 |
| 42 | 3300048903 | Ga0496100_0255821 | Ga0496100_0255821_599_988 | 129 |
| 43 | 3300048915 | Ga0496112_0024034 | Ga0496112_0024034_2950_3339 | 129 |
| 44 | 3300048916 | Ga0496113_0103834 | Ga0496113_0103834_309_698 | 129 |
| 45 | 3300005434 | Ga0070709_10000528 | Ga0070709_100005284 | 130 |
| 46 | 3300005435 | Ga0070714_100034186 | Ga0070714_1000341863 | 130 |
| 47 | 3300005436 | Ga0070713_100032274 | Ga0070713_1000322744 | 130 |
| 48 | 3300005436 | Ga0070713_100250661 | Ga0070713_1002506613 | 130 |
| 49 | 3300005437 | Ga0070710_10001256 | Ga0070710_100012563 | 130 |
| 50 | 3300005439 | Ga0070711_100030122 | Ga0070711_1000301222 | 130 |
| 51 | 3300006028 | Ga0070717_11841154 | Ga0070717_118411541 | 130 |
| 52 | 3300006038 | Ga0075365_10074516 | Ga0075365_100745163 | 130 |
| 53 | 3300006038 | Ga0075365_10206026 | Ga0075365_102060263 | 130 |
| 54 | 3300006051 | Ga0075364_11215812 | Ga0075364_112158121 | 130 |
| 55 | 3300006173 | Ga0070716_100001221 | Ga0070716_1000012213 | 130 |
| 56 | 3300006175 | Ga0070712_100261448 | Ga0070712_1002614483 | 130 |
| 57 | 3300006175 | Ga0070712_100471873 | Ga0070712_1004718732 | 130 |
| 58 | 3300006177 | Ga0075362_10047263 | Ga0075362_100472633 | 130 |
| 59 | 3300006186 | Ga0075369_10123611 | Ga0075369_101236111 | 130 |
| 60 | 3300006186 | Ga0075369_10217565 | Ga0075369_102175651 | 130 |
| 61 | 3300009148 | Ga0105243_10552293 | Ga0105243_105522932 | 130 |
| 62 | 3300009176 | Ga0105242_10989008 | Ga0105242_109890082 | 130 |
| 63 | 3300009551 | Ga0105238_10734567 | Ga0105238_107345672 | 130 |
| 64 | 3300009553 | Ga0105249_10468458 | Ga0105249_104684582 | 130 |
| 65 | 3300010375 | Ga0105239_12153575 | Ga0105239_121535751 | 130 |
| 66 | 3300013297 | Ga0157378_10768075 | Ga0157378_107680752 | 130 |
| 67 | 3300025898 | Ga0207692_10002227 | Ga0207692_100022276 | 130 |
| 68 | 3300025906 | Ga0207699_10001550 | Ga0207699_100015504 | 130 |
| 69 | 3300025915 | Ga0207693_10011501 | Ga0207693_100115014 | 130 |
| 70 | 3300025916 | Ga0207663_10153952 | Ga0207663_101539523 | 130 |
| 71 | 3300025923 | Ga0207681_10888725 | Ga0207681_108887252 | 130 |
| 72 | 3300025928 | Ga0207700_10007535 | Ga0207700_100075354 | 130 |
| 73 | 3300025928 | Ga0207700_10134144 | Ga0207700_101341443 | 130 |
| 74 | 3300025929 | Ga0207664_10048422 | Ga0207664_100484223 | 130 |
| 75 | 3300025939 | Ga0207665_10026654 | Ga0207665_100266544 | 130 |
| 76 | 3300028379 | Ga0268266_10634331 | Ga0268266_106343312 | 130 |
| 77 | 3300039438 | Ga0436360_1279581 | Ga0436360_1279581_53_481 | 130 |
| 78 | 3300041496 | Ga0451839_0308465 | Ga0451839_0308465_95_487 | 130 |
| 79 | 3300046616 | Ga0495668_0232852 | Ga0495668_0232852_411_803 | 130 |
| 80 | 3300048924 | Ga0496121_0222977 | Ga0496121_0222977_147_539 | 130 |
| 81 | 3300049585 | Ga0501069_0366020 | Ga0501069_0366020_285_677 | 130 |
| 82 | 3300050489 | nmdc:mga03683_7659_c1 | nmdc:mga03683_7659_c1_2803_3195 | 130 |
| 83 | 3300050491 | nmdc:mga00v17_232777_c1 | nmdc:mga00v17_232777_c1_31_423 | 130 |
| 84 | 3300050491 | nmdc:mga00v17_840509_c1 | nmdc:mga00v17_840509_c1_152_544 | 130 |
| 85 | 3300050492 | nmdc:mga0yw44_84439_c1 | nmdc:mga0yw44_84439_c1_266_658 | 130 |
| 86 | 3300050516 | nmdc:mga0sz30_27992_c1 | nmdc:mga0sz30_27992_c1_613_1005 | 130 |
| 87 | 3300053151 | Ga0500604_0110061 | Ga0500604_0110061_330_722 | 130 |
| 88 | 3300053155 | Ga0500620_004709 | Ga0500620_004709_258_650 | 130 |
| 89 | 3300053158 | Ga0500627_0077220 | Ga0500627_0077220_399_791 | 130 |
| 90 | iso_pu_bacteria | 2513237094 | 2513640747 | 130 |
| 91 | iso_pu_bacteria | 2818991436 | 2819541604 | 130 |
| 92 | iso_pu_bacteria | 2844002411 | 2844007422 | 130 |
| 93 | iso_pu_bacteria | 2844315083 | 2844315959 | 130 |
| 94 | iso_pu_bacteria | 2903727486 | 2903731908 | 130 |
| 95 | iso_pu_bacteria | 2906602504 | 2906606151 | 130 |
| 96 | iso_pu_bacteria | 8019648815 | 8019653096 | 130 |
| 97 | iso_pu_bacteria | 8056967851 | 8056970735 | 130 |
| 98 | 3300002737 | JGI25162J39368_1024205 | JGI25162J39368_10242052 | 131 |
| 99 | 3300002738 | JGI25154J39366_1000336 | JGI25154J39366_10003362 | 131 |
| 100 | 3300003215 | JGI25153J46596_10011363 | JGI25153J46596_100113632 | 131 |
| 101 | 3300003322 | rootL2_10164609 | rootL2_101646095 | 131 |
| 102 | 3300003323 | rootH1_10264619 | rootH1_102646191 | 131 |
| 103 | 3300003771 | Ga0055526_1000016 | Ga0055526_1000016114 | 131 |
| 104 | 3300003781 | Ga0055536_1000955 | Ga0055536_100095510 | 131 |
| 105 | 3300003781 | Ga0055536_1001688 | Ga0055536_10016885 | 131 |
| 106 | 3300003791 | Ga0055530_10005038 | Ga0055530_100050385 | 131 |
| 107 | 3300003792 | Ga0055540_1000747 | Ga0055540_100074714 | 131 |
| 108 | 3300003792 | Ga0055540_1056135 | Ga0055540_10561351 | 131 |
| 109 | 3300003794 | Ga0055531_10001032 | Ga0055531_1000103214 | 131 |
| 110 | 3300003794 | Ga0055531_10004663 | Ga0055531_100046632 | 131 |
| 111 | 3300005288 | Ga0065714_10002968 | Ga0065714_1000296813 | 131 |
| 112 | 3300005334 | Ga0068869_101472821 | Ga0068869_1014728211 | 131 |
| 113 | 3300005339 | Ga0070660_100613701 | Ga0070660_1006137012 | 131 |
| 114 | 3300005457 | Ga0070662_100048463 | Ga0070662_1000484632 | 131 |
| 115 | 3300005577 | Ga0068857_100056676 | Ga0068857_1000566762 | 131 |
| 116 | 3300005578 | Ga0068854_101667120 | Ga0068854_1016671201 | 131 |
| 117 | 3300005616 | Ga0068852_100759879 | Ga0068852_1007598792 | 131 |
| 118 | 3300005842 | Ga0068858_100663878 | Ga0068858_1006638782 | 131 |
| 119 | 3300006058 | Ga0075432_10457847 | Ga0075432_104578471 | 131 |
| 120 | 3300006195 | Ga0075366_10030991 | Ga0075366_100309918 | 131 |
| 121 | 3300006237 | Ga0097621_100184321 | Ga0097621_1001843212 | 131 |
| 122 | 3300006353 | Ga0075370_10147138 | Ga0075370_101471382 | 131 |
| 123 | 3300006353 | Ga0075370_10388347 | Ga0075370_103883472 | 131 |
| 124 | 3300006358 | Ga0068871_100275006 | Ga0068871_1002750063 | 131 |
| 125 | 3300006948 | Ga0099826_10051757 | Ga0099826_100517572 | 131 |
| 126 | 3300009011 | Ga0105251_10443489 | Ga0105251_104434891 | 131 |
| 127 | 3300009036 | Ga0105244_10003202 | Ga0105244_100032028 | 131 |
| 128 | 3300009036 | Ga0105244_10095015 | Ga0105244_100950151 | 131 |
| 129 | 3300009098 | Ga0105245_12718418 | Ga0105245_127184181 | 131 |
| 130 | 3300009148 | Ga0105243_10064752 | Ga0105243_100647525 | 131 |
| 131 | 3300009148 | Ga0105243_10250772 | Ga0105243_102507721 | 131 |
| 132 | 3300009176 | Ga0105242_11907683 | Ga0105242_119076832 | 131 |
| 133 | 3300009545 | Ga0105237_12677886 | Ga0105237_126778861 | 131 |
| 134 | 3300011119 | Ga0105246_10154937 | Ga0105246_101549372 | 131 |
| 135 | 3300013104 | Ga0157370_10849610 | Ga0157370_108496101 | 131 |
| 136 | 3300014497 | Ga0182008_10000357 | Ga0182008_100003576 | 131 |
| 137 | 3300014497 | Ga0182008_10100424 | Ga0182008_101004241 | 131 |
| 138 | 3300014497 | Ga0182008_10146581 | Ga0182008_101465812 | 131 |
| 139 | 3300015261 | Ga0182006_1000002 | Ga0182006_100000262 | 131 |
| 140 | 3300015261 | Ga0182006_1006174 | Ga0182006_10061748 | 131 |
| 141 | 3300015262 | Ga0182007_10000072 | Ga0182007_1000007215 | 131 |
| 142 | 3300015262 | Ga0182007_10011212 | Ga0182007_100112122 | 131 |
| 143 | 3300015265 | Ga0182005_1000029 | Ga0182005_1000029117 | 131 |
| 144 | 3300017792 | Ga0163161_10016825 | Ga0163161_100168254 | 131 |
| 145 | 3300025228 | Ga0209672_114835 | Ga0209672_1148352 | 131 |
| 146 | 3300025233 | Ga0209437_120323 | Ga0209437_1203232 | 131 |
| 147 | 3300025246 | Ga0209646_1000049 | Ga0209646_1000049140 | 131 |
| 148 | 3300025292 | Ga0209676_1000573 | Ga0209676_100057337 | 131 |
| 149 | 3300025292 | Ga0209676_1016075 | Ga0209676_10160753 | 131 |
| 150 | 3300025295 | Ga0209564_1000002 | Ga0209564_10000021293 | 131 |
| 151 | 3300025297 | Ga0209758_1000265 | Ga0209758_100026594 | 131 |
| 152 | 3300025298 | Ga0209050_1000460 | Ga0209050_100046056 | 131 |
| 153 | 3300025298 | Ga0209050_1020279 | Ga0209050_10202792 | 131 |
| 154 | 3300025303 | Ga0209051_1000441 | Ga0209051_100044116 | 131 |
| 155 | 3300025303 | Ga0209051_1002360 | Ga0209051_100236015 | 131 |
| 156 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057382 | 131 |
| 157 | 3300025304 | Ga0209257_1014049 | Ga0209257_10140496 | 131 |
| 158 | 3300025304 | Ga0209257_1015575 | Ga0209257_10155752 | 131 |
| 159 | 3300025728 | Ga0207655_1004248 | Ga0207655_10042483 | 131 |
| 160 | 3300025932 | Ga0207690_10781534 | Ga0207690_107815342 | 131 |
| 161 | 3300025933 | Ga0207706_10011853 | Ga0207706_100118539 | 131 |
| 162 | 3300025935 | Ga0207709_10070630 | Ga0207709_100706303 | 131 |
| 163 | 3300026089 | Ga0207648_10124715 | Ga0207648_101247152 | 131 |
| 164 | 3300026116 | Ga0207674_10051822 | Ga0207674_100518224 | 131 |
| 165 | 3300027876 | Ga0209974_10076132 | Ga0209974_100761322 | 131 |
| 166 | 3300031235 | Ga0265330_10064250 | Ga0265330_100642501 | 131 |
| 167 | 3300031241 | Ga0265325_10010454 | Ga0265325_100104544 | 131 |
| 168 | 3300031247 | Ga0265340_10109808 | Ga0265340_101098082 | 131 |
| 169 | 3300031247 | Ga0265340_10188851 | Ga0265340_101888511 | 131 |
| 170 | 3300031249 | Ga0265339_10113185 | Ga0265339_101131852 | 131 |
| 171 | 3300031344 | Ga0265316_10048680 | Ga0265316_100486803 | 131 |
| 172 | 3300031616 | Ga0307508_10138116 | Ga0307508_101381163 | 131 |
| 173 | 3300031711 | Ga0265314_10109135 | Ga0265314_101091352 | 131 |
| 174 | 3300042532 | Ga0450893_0013950 | Ga0450893_0013950_790_1185 | 131 |
| 175 | 3300046459 | Ga0495629_0035323 | Ga0495629_0035323_2580_2975 | 131 |
| 176 | 3300046460 | Ga0495638_0005109 | Ga0495638_0005109_7427_7822 | 131 |
| 177 | 3300046473 | Ga0495582_0266714 | Ga0495582_0266714_481_876 | 131 |
| 178 | 3300046476 | Ga0495662_0001507 | Ga0495662_0001507_7565_7960 | 131 |
| 179 | 3300046511 | Ga0495608_0409078 | Ga0495608_0409078_46_441 | 131 |
| 180 | 3300046524 | Ga0495648_0428635 | Ga0495648_0428635_163_558 | 131 |
| 181 | 3300046530 | Ga0495654_0151989 | Ga0495654_0151989_449_844 | 131 |
| 182 | 3300046557 | Ga0495622_0029475 | Ga0495622_0029475_22_417 | 131 |
| 183 | 3300046615 | Ga0495656_0177920 | Ga0495656_0177920_323_718 | 131 |
| 184 | 3300046642 | Ga0495634_0291976 | Ga0495634_0291976_327_722 | 131 |
| 185 | 3300046660 | Ga0495625_0085262 | Ga0495625_0085262_419_814 | 131 |
| 186 | 3300046660 | Ga0495625_0142343 | Ga0495625_0142343_449_844 | 131 |
| 187 | 3300046660 | Ga0495625_0227528 | Ga0495625_0227528_495_893 | 131 |
| 188 | 3300046663 | Ga0495635_0187665 | Ga0495635_0187665_648_1043 | 131 |
| 189 | 3300046674 | Ga0495588_0183715 | Ga0495588_0183715_297_692 | 131 |
| 190 | 3300046675 | Ga0495657_0026418 | Ga0495657_0026418_2047_2442 | 131 |
| 191 | 3300046809 | Ga0495600_0420431 | Ga0495600_0420431_272_667 | 131 |
| 192 | 3300047317 | Ga0495604_0007296 | Ga0495604_0007296_6670_7065 | 131 |
| 193 | 3300047321 | Ga0495676_0008971 | Ga0495676_0008971_2842_3237 | 131 |
| 194 | 3300048088 | Ga0495602_0342640 | Ga0495602_0342640_673_1068 | 131 |
| 195 | 3300048906 | Ga0496103_0448429 | Ga0496103_0448429_64_459 | 131 |
| 196 | 3300048914 | Ga0496111_0344873 | Ga0496111_0344873_20_415 | 131 |
| 197 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_2018469_2018864 | 131 |
| 198 | 3300048920 | Ga0496117_0075953 | Ga0496117_0075953_1324_1779 | 131 |
| 199 | 3300048920 | Ga0496117_0113493 | Ga0496117_0113493_31_426 | 131 |
| 200 | 3300048921 | Ga0496118_0000008 | Ga0496118_0000008_136762_137157 | 131 |
| 201 | 3300048921 | Ga0496118_0037839 | Ga0496118_0037839_3152_3607 | 131 |
| 202 | 3300048921 | Ga0496118_0096156 | Ga0496118_0096156_1409_1804 | 131 |
| 203 | 3300048922 | Ga0496119_0027920 | Ga0496119_0027920_2293_2688 | 131 |
| 204 | 3300048924 | Ga0496121_0001728 | Ga0496121_0001728_16844_17299 | 131 |
| 205 | 3300048924 | Ga0496121_0002860 | Ga0496121_0002860_10217_10612 | 131 |
| 206 | 3300048924 | Ga0496121_0140140 | Ga0496121_0140140_240_635 | 131 |
| 207 | 3300048925 | Ga0496122_0005214 | Ga0496122_0005214_3028_3423 | 131 |
| 208 | 3300048926 | Ga0496123_0009019 | Ga0496123_0009019_662_1057 | 131 |
| 209 | 3300048926 | Ga0496123_0289613 | Ga0496123_0289613_238_633 | 131 |
| 210 | 3300048927 | Ga0496124_0119508 | Ga0496124_0119508_893_1288 | 131 |
| 211 | 3300048927 | Ga0496124_0324533 | Ga0496124_0324533_544_999 | 131 |
| 212 | 3300048928 | Ga0496125_0042013 | Ga0496125_0042013_2707_3102 | 131 |
| 213 | 3300048928 | Ga0496125_0087442 | Ga0496125_0087442_1854_2249 | 131 |
| 214 | 3300049585 | Ga0501069_0219032 | Ga0501069_0219032_350_751 | 131 |
| 215 | 3300050493 | nmdc:mga0k408_11011_c1 | nmdc:mga0k408_11011_c1_3386_3781 | 131 |
| 216 | 3300050495 | nmdc:mga04h51_442527_c1 | nmdc:mga04h51_442527_c1_28_423 | 131 |
| 217 | 3300050496 | nmdc:mga07m45_216703_c1 | nmdc:mga07m45_216703_c1_422_817 | 131 |
| 218 | 3300053085 | Ga0495619_0238668 | Ga0495619_0238668_308_703 | 131 |
| 219 | 3300053110 | Ga0500571_000024 | Ga0500571_000024_16798_17193 | 131 |
| 220 | 3300053117 | Ga0500593_000323 | Ga0500593_000323_9252_9647 | 131 |
| 221 | 3300053122 | Ga0500608_094009 | Ga0500608_094009_921_1316 | 131 |
| 222 | 3300053138 | Ga0500564_052772 | Ga0500564_052772_643_1038 | 131 |
| 223 | 3300053141 | Ga0500574_179982 | Ga0500574_179982_190_585 | 131 |
| 224 | 3300053142 | Ga0500577_0284874 | Ga0500577_0284874_31_429 | 131 |
| 225 | 3300053148 | Ga0500590_018783 | Ga0500590_018783_2570_2965 | 131 |
| 226 | 3300053153 | Ga0500616_0004212 | Ga0500616_0004212_6756_7154 | 131 |
| 227 | 3300053177 | Ga0500636_0018057 | Ga0500636_0018057_17_412 | 131 |
| 228 | 3300053177 | Ga0500636_0304305 | Ga0500636_0304305_47_442 | 131 |
| 229 | iso_pu_bacteria | 2529292951 | 2530648540 | 131 |
| 230 | iso_pu_bacteria | 8057575449 | 8057579907 | 131 |
| 231 | 3300003752 | Ga0055539_1016061 | Ga0055539_10160611 | 132 |
| 232 | 3300005340 | Ga0070689_100910818 | Ga0070689_1009108182 | 132 |
| 233 | 3300005455 | Ga0070663_100232573 | Ga0070663_1002325731 | 132 |
| 234 | 3300005548 | Ga0070665_100473765 | Ga0070665_1004737652 | 132 |
| 235 | 3300005841 | Ga0068863_100789565 | Ga0068863_1007895652 | 132 |
| 236 | 3300005842 | Ga0068858_100432405 | Ga0068858_1004324052 | 132 |
| 237 | 3300005843 | Ga0068860_100000179 | Ga0068860_10000017973 | 132 |
| 238 | 3300005843 | Ga0068860_100775176 | Ga0068860_1007751762 | 132 |
| 239 | 3300006042 | Ga0075368_10134895 | Ga0075368_101348953 | 132 |
| 240 | 3300006048 | Ga0075363_100184635 | Ga0075363_1001846352 | 132 |
| 241 | 3300006177 | Ga0075362_10355365 | Ga0075362_103553651 | 132 |
| 242 | 3300006178 | Ga0075367_10120521 | Ga0075367_101205212 | 132 |
| 243 | 3300006358 | Ga0068871_100124373 | Ga0068871_1001243733 | 132 |
| 244 | 3300009093 | Ga0105240_11936418 | Ga0105240_119364182 | 132 |
| 245 | 3300009098 | Ga0105245_11228246 | Ga0105245_112282461 | 132 |
| 246 | 3300009101 | Ga0105247_10027595 | Ga0105247_100275956 | 132 |
| 247 | 3300009545 | Ga0105237_10011043 | Ga0105237_100110434 | 132 |
| 248 | 3300009545 | Ga0105237_10468076 | Ga0105237_104680762 | 132 |
| 249 | 3300009545 | Ga0105237_11202102 | Ga0105237_112021021 | 132 |
| 250 | 3300009551 | Ga0105238_10150563 | Ga0105238_101505633 | 132 |
| 251 | 3300009551 | Ga0105238_11178667 | Ga0105238_111786672 | 132 |
| 252 | 3300010375 | Ga0105239_10106059 | Ga0105239_101060595 | 132 |
| 253 | 3300010375 | Ga0105239_10327382 | Ga0105239_103273822 | 132 |
| 254 | 3300011119 | Ga0105246_10616919 | Ga0105246_106169191 | 132 |
| 255 | 3300013105 | Ga0157369_10206589 | Ga0157369_102065893 | 132 |
| 256 | 3300013296 | Ga0157374_10230305 | Ga0157374_102303052 | 132 |
| 257 | 3300013307 | Ga0157372_11782249 | Ga0157372_117822492 | 132 |
| 258 | 3300014325 | Ga0163163_11239018 | Ga0163163_112390182 | 132 |
| 259 | 3300014497 | Ga0182008_10421689 | Ga0182008_104216892 | 132 |
| 260 | 3300017792 | Ga0163161_10456040 | Ga0163161_104560401 | 132 |
| 261 | 3300025253 | Ga0209677_100744 | Ga0209677_10074411 | 132 |
| 262 | 3300025254 | Ga0209148_1041928 | Ga0209148_10419282 | 132 |
| 263 | 3300025900 | Ga0207710_10032482 | Ga0207710_100324823 | 132 |
| 264 | 3300025914 | Ga0207671_10047788 | Ga0207671_100477883 | 132 |
| 265 | 3300025914 | Ga0207671_10155811 | Ga0207671_101558112 | 132 |
| 266 | 3300025914 | Ga0207671_10976133 | Ga0207671_109761331 | 132 |
| 267 | 3300025924 | Ga0207694_10316369 | Ga0207694_103163692 | 132 |
| 268 | 3300026035 | Ga0207703_10182211 | Ga0207703_101822113 | 132 |
| 269 | 3300026041 | Ga0207639_10245652 | Ga0207639_102456522 | 132 |
| 270 | 3300026041 | Ga0207639_10269547 | Ga0207639_102695472 | 132 |
| 271 | 3300026078 | Ga0207702_10784301 | Ga0207702_107843012 | 132 |
| 272 | 3300026088 | Ga0207641_10508519 | Ga0207641_105085192 | 132 |
| 273 | 3300026116 | Ga0207674_10607723 | Ga0207674_106077232 | 132 |
| 274 | 3300026121 | Ga0207683_11569114 | Ga0207683_115691141 | 132 |
| 275 | 3300027866 | Ga0209813_10021403 | Ga0209813_100214033 | 132 |
| 276 | 3300028379 | Ga0268266_10201458 | Ga0268266_102014582 | 132 |
| 277 | 3300028381 | Ga0268264_10000153 | Ga0268264_1000015376 | 132 |
| 278 | 3300028381 | Ga0268264_10996464 | Ga0268264_109964642 | 132 |
| 279 | 3300028577 | Ga0265318_10149805 | Ga0265318_101498051 | 132 |
| 280 | 3300030521 | Ga0307511_10087724 | Ga0307511_100877242 | 132 |
| 281 | 3300030521 | Ga0307511_10097613 | Ga0307511_100976133 | 132 |
| 282 | 3300031235 | Ga0265330_10027227 | Ga0265330_100272274 | 132 |
| 283 | 3300031238 | Ga0265332_10291061 | Ga0265332_102910611 | 132 |
| 284 | 3300031241 | Ga0265325_10012010 | Ga0265325_100120106 | 132 |
| 285 | 3300031250 | Ga0265331_10070112 | Ga0265331_100701122 | 132 |
| 286 | 3300031344 | Ga0265316_10070861 | Ga0265316_100708614 | 132 |
| 287 | 3300031507 | Ga0307509_10033194 | Ga0307509_100331948 | 132 |
| 288 | 3300031507 | Ga0307509_10304114 | Ga0307509_103041143 | 132 |
| 289 | 3300031616 | Ga0307508_10000009 | Ga0307508_1000000967 | 132 |
| 290 | 3300031616 | Ga0307508_10069917 | Ga0307508_100699172 | 132 |
| 291 | 3300031712 | Ga0265342_10045287 | Ga0265342_100452874 | 132 |
| 292 | 3300031730 | Ga0307516_10014988 | Ga0307516_1001498812 | 132 |
| 293 | 3300031730 | Ga0307516_10095616 | Ga0307516_100956165 | 132 |
| 294 | 3300033179 | Ga0307507_10023098 | Ga0307507_100230985 | 132 |
| 295 | 3300033180 | Ga0307510_10008632 | Ga0307510_1000863214 | 132 |
| 296 | 3300035086 | Ga0373934_0010218 | Ga0373934_0010218_806_1210 | 132 |
| 297 | 3300035111 | Ga0373923_0100922 | Ga0373923_0100922_593_997 | 132 |
| 298 | 3300035113 | Ga0373936_0253631 | Ga0373936_0253631_243_647 | 132 |
| 299 | 3300035117 | Ga0373953_0006562 | Ga0373953_0006562_1346_1750 | 132 |
| 300 | 3300035118 | Ga0373954_0000584 | Ga0373954_0000584_7246_7650 | 132 |
| 301 | 3300035119 | Ga0373956_0002897 | Ga0373956_0002897_4442_4846 | 132 |
| 302 | 3300035120 | Ga0373957_0007168 | Ga0373957_0007168_586_990 | 132 |
| 303 | 3300035170 | Ga0373943_0209587 | Ga0373943_0209587_501_962 | 132 |
| 304 | 3300035172 | Ga0373955_0012385 | Ga0373955_0012385_3087_3491 | 132 |
| 305 | 3300035410 | Ga0373924_0008307 | Ga0373924_0008307_2030_2434 | 132 |
| 306 | 3300035692 | Ga0373935_0141768 | Ga0373935_0141768_408_812 | 132 |
| 307 | 3300035692 | Ga0373935_0428964 | Ga0373935_0428964_512_916 | 132 |
| 308 | 3300035695 | Ga0373927_0192203 | Ga0373927_0192203_762_1223 | 132 |
| 309 | 3300035724 | Ga0373933_0019974 | Ga0373933_0019974_1575_1979 | 132 |
| 310 | 3300036401 | Ga0373937_0014040 | Ga0373937_0014040_2848_3252 | 132 |
| 311 | 3300037068 | Ga0373925_0030797 | Ga0373925_0030797_423_827 | 132 |
| 312 | 3300037471 | Ga0395905_1587039 | Ga0395905_1587039_139_537 | 132 |
| 313 | 3300039450 | Ga0436363_0623699 | Ga0436363_0623699_110_514 | 132 |
| 314 | 3300041491 | Ga0451833_0262796 | Ga0451833_0262796_21_425 | 132 |
| 315 | 3300041501 | Ga0451845_0774461 | Ga0451845_0774461_43_447 | 132 |
| 316 | 3300041512 | Ga0451853_3820061 | Ga0451853_3820061_107_505 | 132 |
| 317 | 3300046454 | Ga0495592_0017995 | Ga0495592_0017995_3229_3633 | 132 |
| 318 | 3300046459 | Ga0495629_0002194 | Ga0495629_0002194_1813_2217 | 132 |
| 319 | 3300046462 | Ga0495651_0018674 | Ga0495651_0018674_2886_3290 | 132 |
| 320 | 3300046463 | Ga0495653_0081016 | Ga0495653_0081016_1686_2090 | 132 |
| 321 | 3300046477 | Ga0495664_0381706 | Ga0495664_0381706_180_584 | 132 |
| 322 | 3300046511 | Ga0495608_0002889 | Ga0495608_0002889_3229_3633 | 132 |
| 323 | 3300046514 | Ga0495618_0373857 | Ga0495618_0373857_248_652 | 132 |
| 324 | 3300046516 | Ga0495628_0005140 | Ga0495628_0005140_8422_8826 | 132 |
| 325 | 3300046529 | Ga0495652_0025881 | Ga0495652_0025881_2698_3102 | 132 |
| 326 | 3300046533 | Ga0495640_0012625 | Ga0495640_0012625_2337_2741 | 132 |
| 327 | 3300046536 | Ga0495587_0022631 | Ga0495587_0022631_579_983 | 132 |
| 328 | 3300046543 | Ga0495645_0016180 | Ga0495645_0016180_1860_2264 | 132 |
| 329 | 3300046557 | Ga0495622_0050878 | Ga0495622_0050878_1050_1454 | 132 |
| 330 | 3300046559 | Ga0495667_0066680 | Ga0495667_0066680_1556_1960 | 132 |
| 331 | 3300046616 | Ga0495668_0018238 | Ga0495668_0018238_1144_1560 | 132 |
| 332 | 3300046642 | Ga0495634_0724284 | Ga0495634_0724284_71_532 | 132 |
| 333 | 3300046660 | Ga0495625_0263694 | Ga0495625_0263694_160_606 | 132 |
| 334 | 3300046663 | Ga0495635_0001940 | Ga0495635_0001940_8537_8941 | 132 |
| 335 | 3300046675 | Ga0495657_0039925 | Ga0495657_0039925_1686_2090 | 132 |
| 336 | 3300046678 | Ga0495599_0012882 | Ga0495599_0012882_2656_3060 | 132 |
| 337 | 3300046679 | Ga0495623_0011556 | Ga0495623_0011556_3229_3633 | 132 |
| 338 | 3300046680 | Ga0495646_0015943 | Ga0495646_0015943_2683_3087 | 132 |
| 339 | 3300046689 | Ga0495613_0109643 | Ga0495613_0109643_626_1030 | 132 |
| 340 | 3300046809 | Ga0495600_0167162 | Ga0495600_0167162_707_1111 | 132 |
| 341 | 3300047317 | Ga0495604_0114097 | Ga0495604_0114097_310_714 | 132 |
| 342 | 3300047319 | Ga0495674_0093233 | Ga0495674_0093233_1019_1423 | 132 |
| 343 | 3300047322 | Ga0495680_0036768 | Ga0495680_0036768_1252_1656 | 132 |
| 344 | 3300047444 | Ga0495675_0005020 | Ga0495675_0005020_7466_7870 | 132 |
| 345 | 3300047471 | Ga0495684_0003481 | Ga0495684_0003481_7074_7478 | 132 |
| 346 | 3300047673 | Ga0495593_0008924 | Ga0495593_0008924_3844_4248 | 132 |
| 347 | 3300048088 | Ga0495602_0027242 | Ga0495602_0027242_1261_1665 | 132 |
| 348 | 3300048088 | Ga0495602_0755679 | Ga0495602_0755679_115_513 | 132 |
| 349 | 3300048903 | Ga0496100_0792492 | Ga0496100_0792492_50_472 | 132 |
| 350 | 3300048905 | Ga0496102_1392705 | Ga0496102_1392705_172_570 | 132 |
| 351 | 3300048909 | Ga0496106_0001072 | Ga0496106_0001072_1895_2299 | 132 |
| 352 | 3300048910 | Ga0496107_0520346 | Ga0496107_0520346_339_743 | 132 |
| 353 | 3300048917 | Ga0496114_0351545 | Ga0496114_0351545_345_806 | 132 |
| 354 | 3300048918 | Ga0496115_0182379 | Ga0496115_0182379_351_755 | 132 |
| 355 | 3300048919 | Ga0496116_0055736 | Ga0496116_0055736_368_772 | 132 |
| 356 | 3300048920 | Ga0496117_0019280 | Ga0496117_0019280_1740_2144 | 132 |
| 357 | 3300048921 | Ga0496118_0002820 | Ga0496118_0002820_13567_13971 | 132 |
| 358 | 3300048921 | Ga0496118_0112142 | Ga0496118_0112142_694_1116 | 132 |
| 359 | 3300048923 | Ga0496120_0020017 | Ga0496120_0020017_1561_1959 | 132 |
| 360 | 3300048924 | Ga0496121_0002189 | Ga0496121_0002189_6999_7403 | 132 |
| 361 | 3300048924 | Ga0496121_0087579 | Ga0496121_0087579_188_649 | 132 |
| 362 | 3300048924 | Ga0496121_0104555 | Ga0496121_0104555_22_420 | 132 |
| 363 | 3300048927 | Ga0496124_0000916 | Ga0496124_0000916_19898_20302 | 132 |
| 364 | 3300048929 | Ga0496126_0005239 | Ga0496126_0005239_12571_12975 | 132 |
| 365 | 3300048929 | Ga0496126_0024537 | Ga0496126_0024537_2511_2972 | 132 |
| 366 | 3300048929 | Ga0496126_0917427 | Ga0496126_0917427_159_557 | 132 |
| 367 | 3300050489 | nmdc:mga03683_279212_c1 | nmdc:mga03683_279212_c1_305_703 | 132 |
| 368 | 3300050490 | nmdc:mga03n38_172766_c1 | nmdc:mga03n38_172766_c1_547_945 | 132 |
| 369 | 3300050490 | nmdc:mga03n38_632483_c1 | nmdc:mga03n38_632483_c1_187_585 | 132 |
| 370 | 3300050491 | nmdc:mga00v17_23257_c1 | nmdc:mga00v17_23257_c1_1253_1651 | 132 |
| 371 | 3300050494 | nmdc:mga06z11_39616_c1 | nmdc:mga06z11_39616_c1_1550_1948 | 132 |
| 372 | 3300050495 | nmdc:mga04h51_33427_c1 | nmdc:mga04h51_33427_c1_392_790 | 132 |
| 373 | 3300050496 | nmdc:mga07m45_477621_c1 | nmdc:mga07m45_477621_c1_258_656 | 132 |
| 374 | 3300053077 | Ga0495601_0014495 | Ga0495601_0014495_2665_3069 | 132 |
| 375 | 3300053078 | Ga0495612_0160381 | Ga0495612_0160381_121_519 | 132 |
| 376 | 3300053079 | Ga0500610_0074907 | Ga0500610_0074907_1164_1562 | 132 |
| 377 | 3300053084 | Ga0495595_0002007 | Ga0495595_0002007_3845_4249 | 132 |
| 378 | 3300053085 | Ga0495619_0004943 | Ga0495619_0004943_5994_6398 | 132 |
| 379 | 3300053088 | Ga0500644_0537206 | Ga0500644_0537206_107_505 | 132 |
| 380 | 3300053119 | Ga0500595_030879 | Ga0500595_030879_777_1181 | 132 |
| 381 | 3300053130 | Ga0500642_0018075 | Ga0500642_0018075_1005_1415 | 132 |
| 382 | 3300053136 | Ga0500559_0037155 | Ga0500559_0037155_483_887 | 132 |
| 383 | 3300053140 | Ga0500573_0091598 | Ga0500573_0091598_1208_1612 | 132 |
| 384 | 3300053142 | Ga0500577_0256715 | Ga0500577_0256715_95_493 | 132 |
| 385 | 3300053145 | Ga0500586_031001 | Ga0500586_031001_807_1205 | 132 |
| 386 | 3300053150 | Ga0500603_085693 | Ga0500603_085693_398_859 | 132 |
| 387 | 3300053162 | Ga0500638_075341 | Ga0500638_075341_1028_1432 | 132 |
| 388 | 3300053177 | Ga0500636_0063306 | Ga0500636_0063306_239_643 | 132 |
| 389 | 3300053735 | Ga0500596_000685 | Ga0500596_000685_5763_6167 | 132 |
| 390 | iso_pu_bacteria | 2906378014 | 2906383768 | 132 |
| 391 | 3300005344 | Ga0070661_100001480 | Ga0070661_10000148017 | 133 |
| 392 | 3300005366 | Ga0070659_100000895 | Ga0070659_10000089511 | 133 |
| 393 | 3300006195 | Ga0075366_10489726 | Ga0075366_104897261 | 133 |
| 394 | 3300013308 | Ga0157375_10207867 | Ga0157375_102078674 | 133 |
| 395 | 3300025919 | Ga0207657_10258138 | Ga0207657_102581383 | 133 |
| 396 | 3300025932 | Ga0207690_10020905 | Ga0207690_100209053 | 133 |
| 397 | 3300025945 | Ga0207679_10000864 | Ga0207679_100008642 | 133 |
| 398 | 3300026088 | Ga0207641_10320474 | Ga0207641_103204742 | 133 |
| 399 | 3300028786 | Ga0307517_10378181 | Ga0307517_103781812 | 133 |
| 400 | 3300031456 | Ga0307513_10430301 | Ga0307513_104303013 | 133 |
| 401 | 3300039438 | Ga0436360_0101928 | Ga0436360_0101928_58_462 | 133 |
| 402 | 3300039447 | Ga0436361_0513740 | Ga0436361_0513740_318_779 | 133 |
| 403 | 3300042157 | Ga0439458_0111805 | Ga0439458_0111805_238_639 | 133 |
| 404 | 3300042876 | Ga0451577_0000060 | Ga0451577_0000060_147207_147608 | 133 |
| 405 | 3300044712 | Ga0453684_0000211 | Ga0453684_0000211_70651_71052 | 133 |
| 406 | 3300046810 | Ga0495660_0251165 | Ga0495660_0251165_166_597 | 133 |
| 407 | 3300050493 | nmdc:mga0k408_161193_c1 | nmdc:mga0k408_161193_c1_657_1058 | 133 |
| 408 | 3300053154 | Ga0500619_278490 | Ga0500619_278490_47_448 | 133 |
| 409 | 3300055283 | Ga0500661_040734 | Ga0500661_040734_38_439 | 133 |
| 410 | 3300002737 | JGI25162J39368_1000021 | JGI25162J39368_1000021202 | 134 |
| 411 | 3300002774 | JGI25150J39212_1003233 | JGI25150J39212_10032333 | 134 |
| 412 | 3300003187 | JGI25151J46595_10042539 | JGI25151J46595_100425392 | 134 |
| 413 | 3300003214 | JGI25165J46597_1000049 | JGI25165J46597_100004921 | 134 |
| 414 | 3300003322 | rootL2_10121150 | rootL2_101211502 | 134 |
| 415 | 3300003322 | rootL2_10369363 | rootL2_103693632 | 134 |
| 416 | 3300003323 | rootH1_10080528 | rootH1_100805281 | 134 |
| 417 | 3300003323 | rootH1_10114272 | rootH1_101142721 | 134 |
| 418 | 3300003751 | Ga0055538_1000023 | Ga0055538_1000023202 | 134 |
| 419 | 3300003752 | Ga0055539_1000030 | Ga0055539_1000030202 | 134 |
| 420 | 3300003756 | Ga0055533_1000039 | Ga0055533_1000039202 | 134 |
| 421 | 3300003759 | Ga0055525_1000048 | Ga0055525_100004821 | 134 |
| 422 | 3300003841 | Ga0055541_1000021 | Ga0055541_100002121 | 134 |
| 423 | 3300005436 | Ga0070713_100629439 | Ga0070713_1006294391 | 134 |
| 424 | 3300005439 | Ga0070711_100137967 | Ga0070711_1001379673 | 134 |
| 425 | 3300005445 | Ga0070708_100318396 | Ga0070708_1003183962 | 134 |
| 426 | 3300005457 | Ga0070662_100007793 | Ga0070662_10000779311 | 134 |
| 427 | 3300005618 | Ga0068864_100257592 | Ga0068864_1002575923 | 134 |
| 428 | 3300005842 | Ga0068858_100544098 | Ga0068858_1005440982 | 134 |
| 429 | 3300005843 | Ga0068860_100818248 | Ga0068860_1008182483 | 134 |
| 430 | 3300006028 | Ga0070717_10482164 | Ga0070717_104821642 | 134 |
| 431 | 3300006028 | Ga0070717_10580942 | Ga0070717_105809422 | 134 |
| 432 | 3300006028 | Ga0070717_11418695 | Ga0070717_114186951 | 134 |
| 433 | 3300006195 | Ga0075366_10293718 | Ga0075366_102937182 | 134 |
| 434 | 3300006237 | Ga0097621_101405964 | Ga0097621_1014059641 | 134 |
| 435 | 3300009093 | Ga0105240_11289286 | Ga0105240_112892862 | 134 |
| 436 | 3300009177 | Ga0105248_10880740 | Ga0105248_108807402 | 134 |
| 437 | 3300010375 | Ga0105239_11016642 | Ga0105239_110166422 | 134 |
| 438 | 3300014325 | Ga0163163_13070920 | Ga0163163_130709201 | 134 |
| 439 | 3300014497 | Ga0182008_10106835 | Ga0182008_101068351 | 134 |
| 440 | 3300014968 | Ga0157379_10882479 | Ga0157379_108824792 | 134 |
| 441 | 3300014968 | Ga0157379_11006937 | Ga0157379_110069372 | 134 |
| 442 | 3300015261 | Ga0182006_1036027 | Ga0182006_10360273 | 134 |
| 443 | 3300015261 | Ga0182006_1083138 | Ga0182006_10831382 | 134 |
| 444 | 3300015262 | Ga0182007_10009811 | Ga0182007_100098115 | 134 |
| 445 | 3300015262 | Ga0182007_10010709 | Ga0182007_100107093 | 134 |
| 446 | 3300015265 | Ga0182005_1000822 | Ga0182005_10008224 | 134 |
| 447 | 3300021384 | Ga0213876_10051756 | Ga0213876_100517562 | 134 |
| 448 | 3300025224 | Ga0209784_100004 | Ga0209784_1000041244 | 134 |
| 449 | 3300025225 | Ga0209566_100004 | Ga0209566_1000041401 | 134 |
| 450 | 3300025226 | Ga0209674_100006 | Ga0209674_1000061401 | 134 |
| 451 | 3300025230 | Ga0209563_100009 | Ga0209563_1000091244 | 134 |
| 452 | 3300025231 | Ga0207427_100291 | Ga0207427_10029121 | 134 |
| 453 | 3300025233 | Ga0209437_100004 | Ga0209437_1000041244 | 134 |
| 454 | 3300025245 | Ga0207425_1000474 | Ga0207425_10004744 | 134 |
| 455 | 3300025253 | Ga0209677_100005 | Ga0209677_1000051244 | 134 |
| 456 | 3300025261 | Ga0209233_1000005 | Ga0209233_10000051401 | 134 |
| 457 | 3300025294 | Ga0209025_1005303 | Ga0209025_10053034 | 134 |
| 458 | 3300025297 | Ga0209758_1001248 | Ga0209758_100124815 | 134 |
| 459 | 3300025904 | Ga0207647_10053319 | Ga0207647_100533193 | 134 |
| 460 | 3300025913 | Ga0207695_11663707 | Ga0207695_116637071 | 134 |
| 461 | 3300025916 | Ga0207663_10838099 | Ga0207663_108380992 | 134 |
| 462 | 3300025932 | Ga0207690_10002574 | Ga0207690_100025745 | 134 |
| 463 | 3300025933 | Ga0207706_10005400 | Ga0207706_100054005 | 134 |
| 464 | 3300025934 | Ga0207686_10307030 | Ga0207686_103070302 | 134 |
| 465 | 3300026035 | Ga0207703_10459407 | Ga0207703_104594072 | 134 |
| 466 | 3300030521 | Ga0307511_10000014 | Ga0307511_100000149 | 134 |
| 467 | 3300033179 | Ga0307507_10245614 | Ga0307507_102456142 | 134 |
| 468 | 3300033180 | Ga0307510_10397309 | Ga0307510_103973091 | 134 |
| 469 | 3300035118 | Ga0373954_0003159 | Ga0373954_0003159_1340_1810 | 134 |
| 470 | 3300035172 | Ga0373955_0001386 | Ga0373955_0001386_8381_8851 | 134 |
| 471 | 3300035692 | Ga0373935_0022754 | Ga0373935_0022754_3303_3773 | 134 |
| 472 | 3300035695 | Ga0373927_0309828 | Ga0373927_0309828_497_967 | 134 |
| 473 | 3300035724 | Ga0373933_0005542 | Ga0373933_0005542_2609_3079 | 134 |
| 474 | 3300035725 | Ga0373947_0023741 | Ga0373947_0023741_696_1166 | 134 |
| 475 | 3300036401 | Ga0373937_0002028 | Ga0373937_0002028_2354_2824 | 134 |
| 476 | 3300037853 | Ga0436364_0086439 | Ga0436364_0086439_98_514 | 134 |
| 477 | 3300037853 | Ga0436364_0947489 | Ga0436364_0947489_221_637 | 134 |
| 478 | 3300039437 | Ga0436365_1319655 | Ga0436365_1319655_2614_3030 | 134 |
| 479 | 3300039438 | Ga0436360_0321371 | Ga0436360_0321371_133_549 | 134 |
| 480 | 3300039447 | Ga0436361_0432098 | Ga0436361_0432098_30_446 | 134 |
| 481 | 3300039450 | Ga0436363_0688018 | Ga0436363_0688018_607_1023 | 134 |
| 482 | 3300044683 | Ga0466965_0096073 | Ga0466965_0096073_1058_1468 | 134 |
| 483 | 3300044684 | Ga0466966_0025507 | Ga0466966_0025507_847_1269 | 134 |
| 484 | 3300045049 | Ga0466959_0018721 | Ga0466959_0018721_3585_4007 | 134 |
| 485 | 3300046454 | Ga0495592_0023669 | Ga0495592_0023669_353_823 | 134 |
| 486 | 3300046454 | Ga0495592_0078974 | Ga0495592_0078974_182_592 | 134 |
| 487 | 3300046457 | Ga0495590_0132311 | Ga0495590_0132311_154_558 | 134 |
| 488 | 3300046459 | Ga0495629_0004909 | Ga0495629_0004909_446_850 | 134 |
| 489 | 3300046461 | Ga0495641_0178272 | Ga0495641_0178272_223_627 | 134 |
| 490 | 3300046462 | Ga0495651_0001006 | Ga0495651_0001006_7719_8189 | 134 |
| 491 | 3300046462 | Ga0495651_0281771 | Ga0495651_0281771_557_967 | 134 |
| 492 | 3300046462 | Ga0495651_0325787 | Ga0495651_0325787_488_898 | 134 |
| 493 | 3300046462 | Ga0495651_0327431 | Ga0495651_0327431_257_661 | 134 |
| 494 | 3300046463 | Ga0495653_0011823 | Ga0495653_0011823_5319_5789 | 134 |
| 495 | 3300046463 | Ga0495653_0030435 | Ga0495653_0030435_2971_3381 | 134 |
| 496 | 3300046474 | Ga0495605_0094144 | Ga0495605_0094144_294_698 | 134 |
| 497 | 3300046475 | Ga0495639_0025899 | Ga0495639_0025899_768_1238 | 134 |
| 498 | 3300046477 | Ga0495664_0003228 | Ga0495664_0003228_3081_3551 | 134 |
| 499 | 3300046477 | Ga0495664_0454880 | Ga0495664_0454880_300_704 | 134 |
| 500 | 3300046501 | Ga0495607_0256339 | Ga0495607_0256339_387_791 | 134 |
| 501 | 3300046506 | Ga0495583_0012479 | Ga0495583_0012479_534_938 | 134 |
| 502 | 3300046507 | Ga0495606_0005632 | Ga0495606_0005632_3054_3458 | 134 |
| 503 | 3300046507 | Ga0495606_0285248 | Ga0495606_0285248_125_595 | 134 |
| 504 | 3300046511 | Ga0495608_0004042 | Ga0495608_0004042_6187_6657 | 134 |
| 505 | 3300046511 | Ga0495608_0019067 | Ga0495608_0019067_1901_2311 | 134 |
| 506 | 3300046511 | Ga0495608_0133989 | Ga0495608_0133989_38_442 | 134 |
| 507 | 3300046513 | Ga0495616_0110719 | Ga0495616_0110719_139_543 | 134 |
| 508 | 3300046514 | Ga0495618_0000741 | Ga0495618_0000741_14322_14792 | 134 |
| 509 | 3300046514 | Ga0495618_0104302 | Ga0495618_0104302_1168_1578 | 134 |
| 510 | 3300046514 | Ga0495618_0425228 | Ga0495618_0425228_207_611 | 134 |
| 511 | 3300046516 | Ga0495628_0008625 | Ga0495628_0008625_227_697 | 134 |
| 512 | 3300046516 | Ga0495628_0020789 | Ga0495628_0020789_2809_3219 | 134 |
| 513 | 3300046516 | Ga0495628_0418137 | Ga0495628_0418137_19_423 | 134 |
| 514 | 3300046517 | Ga0495630_1205493 | Ga0495630_1205493_46_450 | 134 |
| 515 | 3300046524 | Ga0495648_0026027 | Ga0495648_0026027_2072_2476 | 134 |
| 516 | 3300046529 | Ga0495652_0027255 | Ga0495652_0027255_2369_2839 | 134 |
| 517 | 3300046529 | Ga0495652_0112553 | Ga0495652_0112553_165_569 | 134 |
| 518 | 3300046529 | Ga0495652_0380727 | Ga0495652_0380727_271_681 | 134 |
| 519 | 3300046531 | Ga0495665_0056090 | Ga0495665_0056090_268_738 | 134 |
| 520 | 3300046533 | Ga0495640_0005375 | Ga0495640_0005375_4941_5411 | 134 |
| 521 | 3300046533 | Ga0495640_0016059 | Ga0495640_0016059_1875_2279 | 134 |
| 522 | 3300046536 | Ga0495587_0010989 | Ga0495587_0010989_2800_3270 | 134 |
| 523 | 3300046542 | Ga0495597_0166986 | Ga0495597_0166986_387_791 | 134 |
| 524 | 3300046543 | Ga0495645_0033417 | Ga0495645_0033417_1099_1569 | 134 |
| 525 | 3300046543 | Ga0495645_0050856 | Ga0495645_0050856_919_1329 | 134 |
| 526 | 3300046559 | Ga0495667_0000654 | Ga0495667_0000654_6822_7292 | 134 |
| 527 | 3300046559 | Ga0495667_0123246 | Ga0495667_0123246_1041_1445 | 134 |
| 528 | 3300046616 | Ga0495668_0032038 | Ga0495668_0032038_2011_2415 | 134 |
| 529 | 3300046642 | Ga0495634_0004062 | Ga0495634_0004062_2469_2939 | 134 |
| 530 | 3300046642 | Ga0495634_0275094 | Ga0495634_0275094_140_544 | 134 |
| 531 | 3300046660 | Ga0495625_0031122 | Ga0495625_0031122_2857_3261 | 134 |
| 532 | 3300046663 | Ga0495635_0001817 | Ga0495635_0001817_12818_13222 | 134 |
| 533 | 3300046663 | Ga0495635_0003108 | Ga0495635_0003108_8539_9009 | 134 |
| 534 | 3300046674 | Ga0495588_0125166 | Ga0495588_0125166_492_899 | 134 |
| 535 | 3300046675 | Ga0495657_0021323 | Ga0495657_0021323_150_554 | 134 |
| 536 | 3300046675 | Ga0495657_0027076 | Ga0495657_0027076_258_728 | 134 |
| 537 | 3300046675 | Ga0495657_0253319 | Ga0495657_0253319_556_966 | 134 |
| 538 | 3300046678 | Ga0495599_0005427 | Ga0495599_0005427_1993_2463 | 134 |
| 539 | 3300046678 | Ga0495599_0006485 | Ga0495599_0006485_4586_4996 | 134 |
| 540 | 3300046679 | Ga0495623_0013037 | Ga0495623_0013037_4375_4845 | 134 |
| 541 | 3300046679 | Ga0495623_0449811 | Ga0495623_0449811_159_563 | 134 |
| 542 | 3300046680 | Ga0495646_0001331 | Ga0495646_0001331_10923_11393 | 134 |
| 543 | 3300046680 | Ga0495646_0038820 | Ga0495646_0038820_1555_1965 | 134 |
| 544 | 3300046681 | Ga0495647_0231884 | Ga0495647_0231884_155_625 | 134 |
| 545 | 3300046683 | Ga0495658_0009649 | Ga0495658_0009649_3902_4372 | 134 |
| 546 | 3300046683 | Ga0495658_0056970 | Ga0495658_0056970_1377_1787 | 134 |
| 547 | 3300046684 | Ga0495669_0209859 | Ga0495669_0209859_439_843 | 134 |
| 548 | 3300046689 | Ga0495613_0174371 | Ga0495613_0174371_956_1426 | 134 |
| 549 | 3300046689 | Ga0495613_0218520 | Ga0495613_0218520_655_1059 | 134 |
| 550 | 3300046690 | Ga0495624_0009016 | Ga0495624_0009016_498_968 | 134 |
| 551 | 3300046690 | Ga0495624_0014746 | Ga0495624_0014746_4759_5169 | 134 |
| 552 | 3300046691 | Ga0495670_0186519 | Ga0495670_0186519_646_1056 | 134 |
| 553 | 3300046692 | Ga0495671_0039479 | Ga0495671_0039479_320_724 | 134 |
| 554 | 3300046694 | Ga0495649_0051765 | Ga0495649_0051765_890_1294 | 134 |
| 555 | 3300046809 | Ga0495600_0017015 | Ga0495600_0017015_908_1378 | 134 |
| 556 | 3300046809 | Ga0495600_0040439 | Ga0495600_0040439_215_625 | 134 |
| 557 | 3300046809 | Ga0495600_0042899 | Ga0495600_0042899_1246_1650 | 134 |
| 558 | 3300047315 | Ga0495581_0279515 | Ga0495581_0279515_215_685 | 134 |
| 559 | 3300047317 | Ga0495604_0001231 | Ga0495604_0001231_12458_12928 | 134 |
| 560 | 3300047317 | Ga0495604_0052710 | Ga0495604_0052710_1254_1658 | 134 |
| 561 | 3300047317 | Ga0495604_0092930 | Ga0495604_0092930_1734_2144 | 134 |
| 562 | 3300047319 | Ga0495674_0002137 | Ga0495674_0002137_14499_14969 | 134 |
| 563 | 3300047319 | Ga0495674_0299855 | Ga0495674_0299855_97_501 | 134 |
| 564 | 3300047321 | Ga0495676_0054832 | Ga0495676_0054832_150_554 | 134 |
| 565 | 3300047321 | Ga0495676_0416836 | Ga0495676_0416836_40_510 | 134 |
| 566 | 3300047322 | Ga0495680_0002906 | Ga0495680_0002906_9981_10451 | 134 |
| 567 | 3300047323 | Ga0495683_0079575 | Ga0495683_0079575_28_432 | 134 |
| 568 | 3300047444 | Ga0495675_0017647 | Ga0495675_0017647_3367_3837 | 134 |
| 569 | 3300047469 | Ga0495673_0292572 | Ga0495673_0292572_137_541 | 134 |
| 570 | 3300047471 | Ga0495684_0002299 | Ga0495684_0002299_3268_3738 | 134 |
| 571 | 3300047471 | Ga0495684_0147368 | Ga0495684_0147368_83_487 | 134 |
| 572 | 3300047472 | Ga0495686_0100894 | Ga0495686_0100894_149_553 | 134 |
| 573 | 3300048088 | Ga0495602_0011794 | Ga0495602_0011794_2371_2841 | 134 |
| 574 | 3300048088 | Ga0495602_0690488 | Ga0495602_0690488_69_479 | 134 |
| 575 | 3300048089 | Ga0495614_0325475 | Ga0495614_0325475_181_585 | 134 |
| 576 | 3300048903 | Ga0496100_0280065 | Ga0496100_0280065_466_882 | 134 |
| 577 | 3300048907 | Ga0496104_0008588 | Ga0496104_0008588_8160_8564 | 134 |
| 578 | 3300048908 | Ga0496105_0009824 | Ga0496105_0009824_3138_3542 | 134 |
| 579 | 3300048909 | Ga0496106_0516321 | Ga0496106_0516321_486_902 | 134 |
| 580 | 3300048910 | Ga0496107_0255517 | Ga0496107_0255517_603_1019 | 134 |
| 581 | 3300048911 | Ga0496108_0544537 | Ga0496108_0544537_138_554 | 134 |
| 582 | 3300048912 | Ga0496109_0735387 | Ga0496109_0735387_69_485 | 134 |
| 583 | 3300048913 | Ga0496110_0150999 | Ga0496110_0150999_547_963 | 134 |
| 584 | 3300048914 | Ga0496111_0363004 | Ga0496111_0363004_307_723 | 134 |
| 585 | 3300048915 | Ga0496112_0706831 | Ga0496112_0706831_221_637 | 134 |
| 586 | 3300048915 | Ga0496112_0803401 | Ga0496112_0803401_227_631 | 134 |
| 587 | 3300048916 | Ga0496113_0005589 | Ga0496113_0005589_6674_7078 | 134 |
| 588 | 3300048917 | Ga0496114_0201129 | Ga0496114_0201129_1061_1465 | 134 |
| 589 | 3300048918 | Ga0496115_0065521 | Ga0496115_0065521_2331_2735 | 134 |
| 590 | 3300048918 | Ga0496115_0546085 | Ga0496115_0546085_130_546 | 134 |
| 591 | 3300048921 | Ga0496118_0292525 | Ga0496118_0292525_263_667 | 134 |
| 592 | 3300048922 | Ga0496119_0004149 | Ga0496119_0004149_364_768 | 134 |
| 593 | 3300048922 | Ga0496119_0426901 | Ga0496119_0426901_190_612 | 134 |
| 594 | 3300048923 | Ga0496120_0010110 | Ga0496120_0010110_4834_5238 | 134 |
| 595 | 3300048924 | Ga0496121_0023933 | Ga0496121_0023933_764_1168 | 134 |
| 596 | 3300048927 | Ga0496124_0255698 | Ga0496124_0255698_637_1041 | 134 |
| 597 | 3300048928 | Ga0496125_0146749 | Ga0496125_0146749_874_1278 | 134 |
| 598 | 3300048929 | Ga0496126_0036557 | Ga0496126_0036557_2832_3236 | 134 |
| 599 | 3300049460 | Ga0495682_0021623 | Ga0495682_0021623_1067_1471 | 134 |
| 600 | 3300049654 | Ga0501207_011694 | Ga0501207_011694_67_471 | 134 |
| 601 | 3300049667 | Ga0501230_060471 | Ga0501230_060471_310_714 | 134 |
| 602 | 3300049760 | Ga0501263_000853 | Ga0501263_000853_2041_2445 | 134 |
| 603 | 3300050494 | nmdc:mga06z11_386344_c1 | nmdc:mga06z11_386344_c1_138_545 | 134 |
| 604 | 3300050516 | nmdc:mga0sz30_110790_c1 | nmdc:mga0sz30_110790_c1_433_852 | 134 |
| 605 | 3300053077 | Ga0495601_0004876 | Ga0495601_0004876_7091_7561 | 134 |
| 606 | 3300053077 | Ga0495601_0006948 | Ga0495601_0006948_5813_6223 | 134 |
| 607 | 3300053077 | Ga0495601_0927372 | Ga0495601_0927372_51_455 | 134 |
| 608 | 3300053078 | Ga0495612_0005438 | Ga0495612_0005438_3803_4273 | 134 |
| 609 | 3300053083 | Ga0495655_0015942 | Ga0495655_0015942_377_781 | 134 |
| 610 | 3300053084 | Ga0495595_0005927 | Ga0495595_0005927_1313_1783 | 134 |
| 611 | 3300053084 | Ga0495595_0173339 | Ga0495595_0173339_372_788 | 134 |
| 612 | 3300053085 | Ga0495619_0031133 | Ga0495619_0031133_993_1463 | 134 |
| 613 | 3300053085 | Ga0495619_0532972 | Ga0495619_0532972_62_478 | 134 |
| 614 | 3300053085 | Ga0495619_0810358 | Ga0495619_0810358_181_585 | 134 |
| 615 | 3300053090 | Ga0500646_0002045 | Ga0500646_0002045_1150_1557 | 134 |
| 616 | 3300053092 | Ga0500583_0000783 | Ga0500583_0000783_8491_8898 | 134 |
| 617 | 3300053093 | Ga0500651_0299680 | Ga0500651_0299680_25_438 | 134 |
| 618 | 3300053094 | Ga0500566_0000394 | Ga0500566_0000394_1249_1659 | 134 |
| 619 | 3300053094 | Ga0500566_0131216 | Ga0500566_0131216_452_865 | 134 |
| 620 | 3300053095 | Ga0500640_002770 | Ga0500640_002770_3821_4231 | 134 |
| 621 | 3300053104 | Ga0500556_0062317 | Ga0500556_0062317_515_928 | 134 |
| 622 | 3300053111 | Ga0500572_000156 | Ga0500572_000156_1037_1447 | 134 |
| 623 | 3300053115 | Ga0500591_139102 | Ga0500591_139102_386_796 | 134 |
| 624 | 3300053119 | Ga0500595_001575 | Ga0500595_001575_5078_5488 | 134 |
| 625 | 3300053119 | Ga0500595_001671 | Ga0500595_001671_2243_2656 | 134 |
| 626 | 3300053119 | Ga0500595_087074 | Ga0500595_087074_492_896 | 134 |
| 627 | 3300053121 | Ga0500607_000025 | Ga0500607_000025_22703_23110 | 134 |
| 628 | 3300053122 | Ga0500608_039947 | Ga0500608_039947_552_962 | 134 |
| 629 | 3300053123 | Ga0500614_000121 | Ga0500614_000121_1252_1662 | 134 |
| 630 | 3300053130 | Ga0500642_0239975 | Ga0500642_0239975_141_554 | 134 |
| 631 | 3300053130 | Ga0500642_0437289 | Ga0500642_0437289_69_473 | 134 |
| 632 | 3300053134 | Ga0500658_0009176 | Ga0500658_0009176_3063_3476 | 134 |
| 633 | 3300053136 | Ga0500559_0001182 | Ga0500559_0001182_11227_11637 | 134 |
| 634 | 3300053141 | Ga0500574_000848 | Ga0500574_000848_2822_3232 | 134 |
| 635 | 3300053142 | Ga0500577_0028657 | Ga0500577_0028657_962_1375 | 134 |
| 636 | 3300053144 | Ga0500585_187648 | Ga0500585_187648_201_611 | 134 |
| 637 | 3300053148 | Ga0500590_098043 | Ga0500590_098043_164_574 | 134 |
| 638 | 3300053150 | Ga0500603_000224 | Ga0500603_000224_12384_12794 | 134 |
| 639 | 3300053151 | Ga0500604_0004510 | Ga0500604_0004510_1786_2211 | 134 |
| 640 | 3300053153 | Ga0500616_0002571 | Ga0500616_0002571_5399_5812 | 134 |
| 641 | 3300053154 | Ga0500619_000430 | Ga0500619_000430_6486_6896 | 134 |
| 642 | 3300053156 | Ga0500622_0300843 | Ga0500622_0300843_150_563 | 134 |
| 643 | 3300053159 | Ga0500630_000834 | Ga0500630_000834_9422_9832 | 134 |
| 644 | 3300053162 | Ga0500638_005764 | Ga0500638_005764_1368_1778 | 134 |
| 645 | 3300053163 | Ga0500639_002819 | Ga0500639_002819_1637_2047 | 134 |
| 646 | 3300053722 | Ga0500649_070145 | Ga0500649_070145_724_1128 | 134 |
| 647 | 3300053733 | Ga0500552_005361 | Ga0500552_005361_629_1039 | 134 |
| 648 | 3300053733 | Ga0500552_035465 | Ga0500552_035465_137_541 | 134 |
| 649 | 3300053735 | Ga0500596_001137 | Ga0500596_001137_4220_4630 | 134 |
| 650 | 3300053735 | Ga0500596_017239 | Ga0500596_017239_54_458 | 134 |
| 651 | 3300053737 | Ga0500601_009020 | Ga0500601_009020_257_667 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u6l-assembly1.cif.gz_B | crystal structure of protein pa1353 from pseudomonas aeruginosa | 0.8881 | 1 | 130 |
| 1u6l-assembly1.cif.gz_B | crystal structure of protein pa1353 from pseudomonas aeruginosa | 0.8631 | 1 | 130 |
| 3oms-assembly1.cif.gz_A-2 | putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. | 0.8334 | 1 | 129 |
| 1u7i-assembly1.cif.gz_B | crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa | 0.8328 | 1 | 130 |
| 3oms-assembly1.cif.gz_A-2 | putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. | 0.8216 | 1 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9735 | 77 | 129 | 3.30.720.110 |
| af_Q2G1U2_73_132_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9022 | 76 | 130 | 3.30.720.110 |
| 1u6lB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8692 | 7 | 130 | 3.10.180.10 |
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8606 | 77 | 129 | 3.30.720.110 |
| 1u6lB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8491 | 7 | 130 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9QDR6-F1-model_v4 | VOC family protein | 0.9875 | 1 | 129 |
|
| AF-A0A2S9GZS6-F1-model_v4 | PhnB-like domain-containing protein | 0.9848 | 1 | 131 |
|
| AF-A0A6G8NPX8-F1-model_v4 | PhnB-like domain-containing protein | 0.9826 | 1 | 131 |
|
| AF-A0A2S9GZS6-F1-model_v4 | PhnB-like domain-containing protein | 0.9774 | 1 | 131 |
|
| AF-J3CI59-F1-model_v4 | PhnB-like domain-containing protein | 0.9738 | 39 | 129 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar