F472602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 351 | 643 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10577259|Ga0207661_105772592 |
| Length | 230 |
| Sequence | VKTDVFSFAPFAEEVMSKLKISSFSISIDGFGAGPAQSLENPLGLGGTQLHEWAFATRTFQRMFGNEGGETGTDDDFAARGFENIGAWIMGRNMFGPVRGPWPDETWKGWWGNNPPYHTPVFVLSHHPRAPIVMEGGTTFEFVTAGIHAALEKATAAAQGRDIRLGGGVATIREYLQAGLVDEMHLAISPAILGSGEHLLGGIDLVKLGFRCTEHAATPKATHVILTRKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 2 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 3 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 4 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 5 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 6 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 7 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 351 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 0.15 |
| Isolates | 1.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.15 |
| Nodule | 0.15 |
| Rhizoplane | 3.99 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001197 | 3300003203 | Bacteria | 12210 |
| 2 | rootL2_10027771 | 3300003322 | Bacteria | 7634 |
| 3 | rootL2_10054306 | 3300003322 | Bacteria | 5137 |
| 4 | rootL2_10091597 | 3300003322 | Bacteria | 1602 |
| 5 | rootH1_10055722 | 3300003323 | Bacteria | 3585 |
| 6 | Ga0065165_1002492 | 3300005262 | Bacteria | 15437 |
| 7 | Ga0065165_1013808 | 3300005262 | Bacteria | 3181 |
| 8 | Ga0065712_10134503 | 3300005290 | Bacteria | 1512 |
| 9 | Ga0065707_10040339 | 3300005295 | Bacteria | 904 |
| 10 | Ga0070658_10024394 | 3300005327 | Bacteria | 4851 |
| 11 | Ga0070676_10008198 | 3300005328 | Bacteria | 5622 |
| 12 | Ga0070676_10009376 | 3300005328 | Bacteria | 5290 |
| 13 | Ga0070690_100127247 | 3300005330 | Bacteria | 1716 |
| 14 | Ga0070690_100626752 | 3300005330 | Bacteria | 819 |
| 15 | Ga0070670_100094777 | 3300005331 | Bacteria | 2567 |
| 16 | Ga0070677_10158214 | 3300005333 | Bacteria | 1061 |
| 17 | Ga0068869_100003195 | 3300005334 | Bacteria | 10012 |
| 18 | Ga0068869_100016813 | 3300005334 | Bacteria | 4942 |
| 19 | Ga0070666_10008823 | 3300005335 | Bacteria | 6268 |
| 20 | Ga0070680_100281145 | 3300005336 | Bacteria | 1410 |
| 21 | Ga0070660_100015927 | 3300005339 | Bacteria | 5444 |
| 22 | Ga0070689_100472999 | 3300005340 | Bacteria | 1069 |
| 23 | Ga0070687_100045346 | 3300005343 | Bacteria | 2245 |
| 24 | Ga0070661_100002899 | 3300005344 | Bacteria | 11811 |
| 25 | Ga0070661_100244263 | 3300005344 | Bacteria | 1383 |
| 26 | Ga0070668_100000574 | 3300005347 | Bacteria | 24639 |
| 27 | Ga0070668_100088445 | 3300005347 | Bacteria | 2439 |
| 28 | Ga0070668_100108246 | 3300005347 | Bacteria | 2210 |
| 29 | Ga0070669_100000765 | 3300005353 | Bacteria | 23385 |
| 30 | Ga0070669_100002931 | 3300005353 | Bacteria | 12296 |
| 31 | Ga0070669_100314309 | 3300005353 | Bacteria | 1264 |
| 32 | Ga0070675_100002140 | 3300005354 | Bacteria | 14611 |
| 33 | Ga0070675_100049796 | 3300005354 | Bacteria | 3439 |
| 34 | Ga0070675_100098419 | 3300005354 | Bacteria | 2460 |
| 35 | Ga0070671_100362960 | 3300005355 | Bacteria | 1237 |
| 36 | Ga0070671_100431307 | 3300005355 | Bacteria | 1129 |
| 37 | Ga0070674_100011152 | 3300005356 | Bacteria | 5459 |
| 38 | Ga0070673_100050730 | 3300005364 | Bacteria | 3245 |
| 39 | Ga0070673_100054587 | 3300005364 | Bacteria | 3143 |
| 40 | Ga0070673_100189764 | 3300005364 | Bacteria | 1764 |
| 41 | Ga0070673_100283758 | 3300005364 | Bacteria | 1453 |
| 42 | Ga0070673_100290054 | 3300005364 | Bacteria | 1437 |
| 43 | Ga0070688_100069415 | 3300005365 | Bacteria | 2250 |
| 44 | Ga0070659_100043712 | 3300005366 | Bacteria | 3504 |
| 45 | Ga0070659_100098610 | 3300005366 | Bacteria | 2350 |
| 46 | Ga0070667_100007739 | 3300005367 | Bacteria | 8908 |
| 47 | Ga0070667_100112647 | 3300005367 | Bacteria | 2360 |
| 48 | Ga0070713_100077183 | 3300005436 | Bacteria | 2831 |
| 49 | Ga0070701_10030817 | 3300005438 | Bacteria | 2657 |
| 50 | Ga0070700_100006109 | 3300005441 | Bacteria | 6417 |
| 51 | Ga0070700_100452926 | 3300005441 | Unclassified | 977 |
| 52 | Ga0070694_100605285 | 3300005444 | Bacteria | 883 |
| 53 | Ga0070708_100239078 | 3300005445 | Bacteria | 1705 |
| 54 | Ga0070663_100046491 | 3300005455 | Bacteria | 3071 |
| 55 | Ga0070663_100074650 | 3300005455 | Bacteria | 2476 |
| 56 | Ga0070678_100015798 | 3300005456 | Bacteria | 4808 |
| 57 | Ga0070678_100093070 | 3300005456 | Bacteria | 2317 |
| 58 | Ga0070678_100314383 | 3300005456 | Bacteria | 1335 |
| 59 | Ga0070678_100540255 | 3300005456 | Bacteria | 1033 |
| 60 | Ga0070662_100000783 | 3300005457 | Bacteria | 19529 |
| 61 | Ga0070662_100003414 | 3300005457 | Bacteria | 9901 |
| 62 | Ga0070662_100114029 | 3300005457 | Bacteria | 2063 |
| 63 | Ga0068867_100005514 | 3300005459 | Bacteria | 8955 |
| 64 | Ga0070685_10006909 | 3300005466 | Bacteria | 5793 |
| 65 | Ga0070685_10273431 | 3300005466 | Bacteria | 1128 |
| 66 | Ga0070707_100154998 | 3300005468 | Bacteria | 2232 |
| 67 | Ga0070699_100020444 | 3300005518 | Bacteria | 5709 |
| 68 | Ga0070699_100344869 | 3300005518 | Bacteria | 1341 |
| 69 | Ga0070684_100013866 | 3300005535 | Bacteria | 6511 |
| 70 | Ga0070684_100112329 | 3300005535 | Bacteria | 2444 |
| 71 | Ga0068853_100005136 | 3300005539 | Bacteria | 10235 |
| 72 | Ga0070672_100005134 | 3300005543 | Bacteria | 8642 |
| 73 | Ga0070672_100079864 | 3300005543 | Bacteria | 2619 |
| 74 | Ga0070672_100133928 | 3300005543 | Bacteria | 2039 |
| 75 | Ga0070672_100175199 | 3300005543 | Bacteria | 1785 |
| 76 | Ga0070686_100452398 | 3300005544 | Unclassified | 987 |
| 77 | Ga0070665_100461152 | 3300005548 | Bacteria | 1281 |
| 78 | Ga0068855_100008710 | 3300005563 | Bacteria | 12265 |
| 79 | Ga0068855_100047031 | 3300005563 | Bacteria | 5099 |
| 80 | Ga0070664_100001492 | 3300005564 | Bacteria | 18638 |
| 81 | Ga0070664_100213965 | 3300005564 | Bacteria | 1723 |
| 82 | Ga0070664_100657232 | 3300005564 | Bacteria | 974 |
| 83 | Ga0068857_100000223 | 3300005577 | Bacteria | 37628 |
| 84 | Ga0068857_100016081 | 3300005577 | Bacteria | 6555 |
| 85 | Ga0068856_100000233 | 3300005614 | Bacteria | 60306 |
| 86 | Ga0070702_100497747 | 3300005615 | Bacteria | 894 |
| 87 | Ga0068852_100001585 | 3300005616 | Bacteria | 15462 |
| 88 | Ga0068852_100003813 | 3300005616 | Bacteria | 10582 |
| 89 | Ga0068852_100008232 | 3300005616 | Bacteria | 7665 |
| 90 | Ga0068852_100051386 | 3300005616 | Bacteria | 3537 |
| 91 | Ga0068852_100055860 | 3300005616 | Bacteria | 3409 |
| 92 | Ga0068852_100287673 | 3300005616 | Bacteria | 1586 |
| 93 | Ga0068852_100293144 | 3300005616 | Bacteria | 1572 |
| 94 | Ga0068859_100104541 | 3300005617 | Bacteria | 2891 |
| 95 | Ga0068859_100275730 | 3300005617 | Bacteria | 1774 |
| 96 | Ga0068864_100134405 | 3300005618 | Bacteria | 2225 |
| 97 | Ga0068864_100428668 | 3300005618 | Bacteria | 1261 |
| 98 | Ga0068864_101357713 | 3300005618 | Bacteria | 712 |
| 99 | Ga0068866_10002119 | 3300005718 | Bacteria | 8255 |
| 100 | Ga0068861_100001729 | 3300005719 | Bacteria | 14004 |
| 101 | Ga0068861_100004658 | 3300005719 | Bacteria | 9211 |
| 102 | Ga0068861_100053641 | 3300005719 | Bacteria | 3068 |
| 103 | Ga0068851_10015869 | 3300005834 | Bacteria | 3595 |
| 104 | Ga0068851_10042740 | 3300005834 | Bacteria | 2282 |
| 105 | Ga0068870_10268516 | 3300005840 | Bacteria | 1065 |
| 106 | Ga0068863_100001215 | 3300005841 | Bacteria | 25740 |
| 107 | Ga0068863_100012982 | 3300005841 | Bacteria | 8033 |
| 108 | Ga0068863_100018013 | 3300005841 | Bacteria | 6761 |
| 109 | Ga0068863_100041920 | 3300005841 | Bacteria | 4350 |
| 110 | Ga0068863_100555689 | 3300005841 | Bacteria | 1134 |
| 111 | Ga0068858_100011059 | 3300005842 | Bacteria | 8532 |
| 112 | Ga0068858_100594133 | 3300005842 | Unclassified | 1073 |
| 113 | Ga0068860_100009850 | 3300005843 | Bacteria | 9480 |
| 114 | Ga0068860_100434683 | 3300005843 | Bacteria | 1303 |
| 115 | Ga0068862_100007098 | 3300005844 | Bacteria | 9305 |
| 116 | Ga0068862_100020474 | 3300005844 | Bacteria | 5526 |
| 117 | Ga0081540_1010528 | 3300005983 | Bacteria | 6250 |
| 118 | Ga0081540_1011231 | 3300005983 | Bacteria | 6003 |
| 119 | Ga0081539_10002106 | 3300005985 | Bacteria | 29503 |
| 120 | Ga0081539_10017714 | 3300005985 | Bacteria | 4985 |
| 121 | Ga0075364_10007757 | 3300006051 | Bacteria | 6392 |
| 122 | Ga0075366_10014006 | 3300006195 | Bacteria | 4574 |
| 123 | Ga0075366_10094432 | 3300006195 | Bacteria | 1793 |
| 124 | Ga0075366_10360109 | 3300006195 | Bacteria | 893 |
| 125 | Ga0097621_100233119 | 3300006237 | Bacteria | 1607 |
| 126 | Ga0075370_10105980 | 3300006353 | Bacteria | 1629 |
| 127 | Ga0075430_100009271 | 3300006846 | Bacteria | 8317 |
| 128 | Ga0075431_100006662 | 3300006847 | Bacteria | 11473 |
| 129 | Ga0075433_10136374 | 3300006852 | Bacteria | 2181 |
| 130 | Ga0075433_10478595 | 3300006852 | Bacteria | 1097 |
| 131 | Ga0075429_100820861 | 3300006880 | Bacteria | 814 |
| 132 | Ga0068865_100003044 | 3300006881 | Bacteria | 10022 |
| 133 | Ga0068865_100086587 | 3300006881 | Bacteria | 2262 |
| 134 | Ga0097620_100104540 | 3300006931 | Bacteria | 2891 |
| 135 | Ga0097620_100275734 | 3300006931 | Bacteria | 1774 |
| 136 | Ga0105244_10194078 | 3300009036 | Bacteria | 959 |
| 137 | Ga0105240_10033636 | 3300009093 | Bacteria | 6619 |
| 138 | Ga0105240_10343586 | 3300009093 | Bacteria | 1695 |
| 139 | Ga0105240_10697331 | 3300009093 | Bacteria | 1109 |
| 140 | Ga0111539_10004167 | 3300009094 | Bacteria | 18959 |
| 141 | Ga0105245_10087074 | 3300009098 | Bacteria | 2866 |
| 142 | Ga0105245_11171294 | 3300009098 | Bacteria | 816 |
| 143 | Ga0114129_10244340 | 3300009147 | Bacteria | 2412 |
| 144 | Ga0105243_10015973 | 3300009148 | Bacteria | 5677 |
| 145 | Ga0105243_10033833 | 3300009148 | Bacteria | 3953 |
| 146 | Ga0105243_11065297 | 3300009148 | Bacteria | 815 |
| 147 | Ga0105242_10076586 | 3300009176 | Bacteria | 2789 |
| 148 | Ga0105242_10378330 | 3300009176 | Bacteria | 1315 |
| 149 | Ga0105248_10027004 | 3300009177 | Bacteria | 6386 |
| 150 | Ga0105248_10294006 | 3300009177 | Bacteria | 1829 |
| 151 | Ga0105248_10477784 | 3300009177 | Bacteria | 1405 |
| 152 | Ga0105249_10013028 | 3300009553 | Bacteria | 7338 |
| 153 | Ga0099796_10020039 | 3300010159 | Bacteria | 2038 |
| 154 | Ga0157373_10336949 | 3300013100 | Bacteria | 1074 |
| 155 | Ga0157371_10054470 | 3300013102 | Bacteria | 2841 |
| 156 | Ga0157369_10386620 | 3300013105 | Bacteria | 1452 |
| 157 | Ga0157374_10012857 | 3300013296 | Bacteria | 7291 |
| 158 | Ga0157374_10032897 | 3300013296 | Bacteria | 4726 |
| 159 | Ga0157378_11117195 | 3300013297 | Bacteria | 826 |
| 160 | Ga0163162_10000769 | 3300013306 | Bacteria | 29806 |
| 161 | Ga0163162_10009068 | 3300013306 | Bacteria | 9673 |
| 162 | Ga0157372_10267770 | 3300013307 | Bacteria | 1985 |
| 163 | Ga0157372_10654979 | 3300013307 | Bacteria | 1223 |
| 164 | Ga0157375_10004451 | 3300013308 | Bacteria | 12165 |
| 165 | Ga0157375_10010853 | 3300013308 | Bacteria | 8029 |
| 166 | Ga0157375_10098672 | 3300013308 | Bacteria | 2998 |
| 167 | Ga0163163_10004692 | 3300014325 | Bacteria | 11702 |
| 168 | Ga0163163_10311894 | 3300014325 | Bacteria | 1626 |
| 169 | Ga0157380_10004895 | 3300014326 | Bacteria | 9332 |
| 170 | Ga0157380_10020507 | 3300014326 | Bacteria | 4940 |
| 171 | Ga0157380_10064490 | 3300014326 | Bacteria | 2941 |
| 172 | Ga0157380_11087100 | 3300014326 | Bacteria | 838 |
| 173 | Ga0182008_10099300 | 3300014497 | Bacteria | 1438 |
| 174 | Ga0157377_10243610 | 3300014745 | Bacteria | 1162 |
| 175 | Ga0157379_10042066 | 3300014968 | Bacteria | 4078 |
| 176 | Ga0157379_10224998 | 3300014968 | Bacteria | 1700 |
| 177 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 178 | Ga0163161_10002372 | 3300017792 | Bacteria | 13495 |
| 179 | Ga0163161_10094713 | 3300017792 | Bacteria | 2214 |
| 180 | Ga0163161_10158155 | 3300017792 | Bacteria | 1726 |
| 181 | Ga0206353_10927837 | 3300020082 | Bacteria | 2108 |
| 182 | Ga0209564_1024324 | 3300025295 | Bacteria | 2073 |
| 183 | Ga0207697_10039525 | 3300025315 | Bacteria | 1935 |
| 184 | Ga0207697_10110172 | 3300025315 | Bacteria | 1178 |
| 185 | Ga0207656_10090576 | 3300025321 | Bacteria | 1388 |
| 186 | Ga0207682_10081342 | 3300025893 | Bacteria | 1389 |
| 187 | Ga0207642_10027248 | 3300025899 | Bacteria | 2337 |
| 188 | Ga0207688_10427838 | 3300025901 | Bacteria | 823 |
| 189 | Ga0207647_10025339 | 3300025904 | Bacteria | 3899 |
| 190 | Ga0207645_10001466 | 3300025907 | Bacteria | 19278 |
| 191 | Ga0207645_10004020 | 3300025907 | Bacteria | 10965 |
| 192 | Ga0207643_10247080 | 3300025908 | Bacteria | 1098 |
| 193 | Ga0207705_10006844 | 3300025909 | Bacteria | 8424 |
| 194 | Ga0207705_10008375 | 3300025909 | Bacteria | 7550 |
| 195 | Ga0207707_10360714 | 3300025912 | Bacteria | 1251 |
| 196 | Ga0207707_10802301 | 3300025912 | Bacteria | 784 |
| 197 | Ga0207695_10106857 | 3300025913 | Bacteria | 2784 |
| 198 | Ga0207663_10347038 | 3300025916 | Bacteria | 1123 |
| 199 | Ga0207660_10246050 | 3300025917 | Bacteria | 1410 |
| 200 | Ga0207662_10019987 | 3300025918 | Bacteria | 3817 |
| 201 | Ga0207662_10049144 | 3300025918 | Bacteria | 2501 |
| 202 | Ga0207657_10007757 | 3300025919 | Bacteria | 10960 |
| 203 | Ga0207657_10021906 | 3300025919 | Bacteria | 6001 |
| 204 | Ga0207657_10132680 | 3300025919 | Bacteria | 2040 |
| 205 | Ga0207649_10004404 | 3300025920 | Bacteria | 7640 |
| 206 | Ga0207652_10207532 | 3300025921 | Bacteria | 1763 |
| 207 | Ga0207652_10847863 | 3300025921 | Bacteria | 809 |
| 208 | Ga0207681_10000340 | 3300025923 | Bacteria | 33613 |
| 209 | Ga0207681_10060318 | 3300025923 | Bacteria | 2603 |
| 210 | Ga0207650_10056224 | 3300025925 | Bacteria | 2923 |
| 211 | Ga0207659_10011262 | 3300025926 | Bacteria | 5646 |
| 212 | Ga0207659_10089935 | 3300025926 | Bacteria | 2290 |
| 213 | Ga0207687_10065552 | 3300025927 | Bacteria | 2579 |
| 214 | Ga0207687_10075001 | 3300025927 | Bacteria | 2426 |
| 215 | Ga0207700_10101063 | 3300025928 | Bacteria | 2300 |
| 216 | Ga0207644_10144510 | 3300025931 | Bacteria | 1835 |
| 217 | Ga0207690_10554807 | 3300025932 | Bacteria | 934 |
| 218 | Ga0207690_10594783 | 3300025932 | Bacteria | 902 |
| 219 | Ga0207706_10002793 | 3300025933 | Bacteria | 16963 |
| 220 | Ga0207706_10025515 | 3300025933 | Bacteria | 5295 |
| 221 | Ga0207706_10068785 | 3300025933 | Bacteria | 3115 |
| 222 | Ga0207686_10003830 | 3300025934 | Bacteria | 8067 |
| 223 | Ga0207686_10038506 | 3300025934 | Bacteria | 2894 |
| 224 | Ga0207709_10078676 | 3300025935 | Bacteria | 2118 |
| 225 | Ga0207709_10142024 | 3300025935 | Bacteria | 1651 |
| 226 | Ga0207670_10144375 | 3300025936 | Bacteria | 1758 |
| 227 | Ga0207669_10005760 | 3300025937 | Bacteria | 5594 |
| 228 | Ga0207704_10003619 | 3300025938 | Bacteria | 7016 |
| 229 | Ga0207704_10067479 | 3300025938 | Bacteria | 2250 |
| 230 | Ga0207704_10162713 | 3300025938 | Bacteria | 1590 |
| 231 | Ga0207691_10000481 | 3300025940 | Bacteria | 39553 |
| 232 | Ga0207691_10044292 | 3300025940 | Bacteria | 4097 |
| 233 | Ga0207691_10085217 | 3300025940 | Bacteria | 2836 |
| 234 | Ga0207691_10260662 | 3300025940 | Bacteria | 1494 |
| 235 | Ga0207711_10013198 | 3300025941 | Bacteria | 6863 |
| 236 | Ga0207711_10259372 | 3300025941 | Bacteria | 1597 |
| 237 | Ga0207689_10002255 | 3300025942 | Bacteria | 18068 |
| 238 | Ga0207689_10027062 | 3300025942 | Bacteria | 4800 |
| 239 | Ga0207661_10102718 | 3300025944 | Bacteria | 2404 |
| 240 | Ga0207661_10577259 | 3300025944 | Bacteria | 1031 |
| 241 | Ga0207679_10008470 | 3300025945 | Bacteria | 6550 |
| 242 | Ga0207679_10044727 | 3300025945 | Bacteria | 3197 |
| 243 | Ga0207679_10706342 | 3300025945 | Bacteria | 915 |
| 244 | Ga0207712_10003827 | 3300025961 | Bacteria | 9501 |
| 245 | Ga0207712_10007809 | 3300025961 | Bacteria | 6762 |
| 246 | Ga0207668_10008601 | 3300025972 | Bacteria | 6093 |
| 247 | Ga0207668_10239362 | 3300025972 | Bacteria | 1467 |
| 248 | Ga0207668_10645974 | 3300025972 | Bacteria | 926 |
| 249 | Ga0207658_10000756 | 3300025986 | Bacteria | 27753 |
| 250 | Ga0207677_10041185 | 3300026023 | Bacteria | 3052 |
| 251 | Ga0207703_10001349 | 3300026035 | Bacteria | 22464 |
| 252 | Ga0207639_10259996 | 3300026041 | Bacteria | 1518 |
| 253 | Ga0207639_10386896 | 3300026041 | Bacteria | 1257 |
| 254 | Ga0207678_10036525 | 3300026067 | Bacteria | 4276 |
| 255 | Ga0207678_10169207 | 3300026067 | Bacteria | 1866 |
| 256 | Ga0207678_10285260 | 3300026067 | Bacteria | 1418 |
| 257 | Ga0207708_10002372 | 3300026075 | Bacteria | 13837 |
| 258 | Ga0207708_10641043 | 3300026075 | Bacteria | 903 |
| 259 | Ga0207702_10000577 | 3300026078 | Bacteria | 40792 |
| 260 | Ga0207702_11166354 | 3300026078 | Bacteria | 764 |
| 261 | Ga0207641_10005453 | 3300026088 | Bacteria | 10853 |
| 262 | Ga0207641_10009111 | 3300026088 | Bacteria | 8198 |
| 263 | Ga0207641_10011616 | 3300026088 | Bacteria | 7231 |
| 264 | Ga0207641_10110562 | 3300026088 | Bacteria | 2435 |
| 265 | Ga0207648_10002846 | 3300026089 | Bacteria | 18315 |
| 266 | Ga0207648_10176800 | 3300026089 | Bacteria | 1888 |
| 267 | Ga0207676_10049440 | 3300026095 | Bacteria | 3271 |
| 268 | Ga0207676_10208514 | 3300026095 | Bacteria | 1732 |
| 269 | Ga0207676_10348940 | 3300026095 | Bacteria | 1368 |
| 270 | Ga0207676_10364508 | 3300026095 | Bacteria | 1340 |
| 271 | Ga0207674_10000571 | 3300026116 | Bacteria | 48350 |
| 272 | Ga0207674_10010814 | 3300026116 | Bacteria | 10290 |
| 273 | Ga0207675_100000450 | 3300026118 | Bacteria | 39881 |
| 274 | Ga0207675_100003938 | 3300026118 | Bacteria | 14411 |
| 275 | Ga0207675_100518626 | 3300026118 | Bacteria | 1188 |
| 276 | Ga0207683_10035993 | 3300026121 | Bacteria | 4308 |
| 277 | Ga0207683_10116160 | 3300026121 | Bacteria | 2399 |
| 278 | Ga0207683_10207273 | 3300026121 | Bacteria | 1783 |
| 279 | Ga0207683_10392242 | 3300026121 | Bacteria | 1277 |
| 280 | Ga0207698_10000978 | 3300026142 | Bacteria | 16625 |
| 281 | Ga0207698_10005678 | 3300026142 | Bacteria | 7726 |
| 282 | Ga0207698_10019541 | 3300026142 | Bacteria | 4641 |
| 283 | Ga0268265_10014242 | 3300028380 | Bacteria | 5417 |
| 284 | Ga0268265_10072385 | 3300028380 | Bacteria | 2688 |
| 285 | Ga0268264_10011337 | 3300028381 | Bacteria | 7365 |
| 286 | Ga0268264_10125645 | 3300028381 | Bacteria | 2266 |
| 287 | Ga0265319_1003521 | 3300028563 | Bacteria | 8133 |
| 288 | Ga0265319_1006243 | 3300028563 | Bacteria | 5547 |
| 289 | Ga0265334_10126410 | 3300028573 | Bacteria | 912 |
| 290 | Ga0265318_10000412 | 3300028577 | Bacteria | 33039 |
| 291 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 292 | Ga0307515_10089387 | 3300028794 | Bacteria | 3879 |
| 293 | Ga0265338_10151912 | 3300028800 | Bacteria | 1798 |
| 294 | Ga0265330_10000345 | 3300031235 | Bacteria | 33039 |
| 295 | Ga0265330_10000624 | 3300031235 | Bacteria | 22852 |
| 296 | Ga0265332_10000406 | 3300031238 | Bacteria | 31160 |
| 297 | Ga0265332_10000614 | 3300031238 | Bacteria | 23207 |
| 298 | Ga0265332_10120583 | 3300031238 | Bacteria | 1102 |
| 299 | Ga0265328_10004041 | 3300031239 | Bacteria | 6420 |
| 300 | Ga0265320_10000433 | 3300031240 | Bacteria | 33039 |
| 301 | Ga0265320_10001865 | 3300031240 | Bacteria | 14925 |
| 302 | Ga0265320_10013162 | 3300031240 | Bacteria | 4769 |
| 303 | Ga0265325_10047554 | 3300031241 | Bacteria | 2220 |
| 304 | Ga0265329_10007656 | 3300031242 | Bacteria | 4157 |
| 305 | Ga0265331_10000573 | 3300031250 | Bacteria | 33039 |
| 306 | Ga0265331_10001570 | 3300031250 | Bacteria | 16712 |
| 307 | Ga0265316_10005925 | 3300031344 | Bacteria | 11769 |
| 308 | Ga0265316_10029349 | 3300031344 | Bacteria | 4524 |
| 309 | Ga0265313_10000755 | 3300031595 | Bacteria | 33039 |
| 310 | Ga0265313_10002098 | 3300031595 | Bacteria | 17772 |
| 311 | Ga0265313_10036387 | 3300031595 | Bacteria | 2471 |
| 312 | Ga0307508_10000096 | 3300031616 | Bacteria | 103730 |
| 313 | Ga0316579_10185865 | 3300031691 | Bacteria | 1005 |
| 314 | Ga0265314_10001005 | 3300031711 | Bacteria | 33039 |
| 315 | Ga0265314_10001934 | 3300031711 | Bacteria | 22116 |
| 316 | Ga0265314_10015645 | 3300031711 | Bacteria | 6014 |
| 317 | Ga0265342_10002483 | 3300031712 | Bacteria | 15893 |
| 318 | Ga0265342_10010321 | 3300031712 | Bacteria | 6494 |
| 319 | Ga0316578_10217856 | 3300031728 | Bacteria | 1148 |
| 320 | Ga0307405_10746366 | 3300031731 | Bacteria | 815 |
| 321 | Ga0307413_10225434 | 3300031824 | Bacteria | 1372 |
| 322 | Ga0307413_10308756 | 3300031824 | Bacteria | 1203 |
| 323 | Ga0307406_10375483 | 3300031901 | Bacteria | 1119 |
| 324 | Ga0307406_10466191 | 3300031901 | Bacteria | 1017 |
| 325 | Ga0307407_10147327 | 3300031903 | Bacteria | 1526 |
| 326 | Ga0307412_10448459 | 3300031911 | Bacteria | 1062 |
| 327 | Ga0307412_10690586 | 3300031911 | Bacteria | 875 |
| 328 | Ga0307409_100215933 | 3300031995 | Bacteria | 1728 |
| 329 | Ga0307409_100279673 | 3300031995 | Unclassified | 1542 |
| 330 | Ga0307416_100219733 | 3300032002 | Bacteria | 1821 |
| 331 | Ga0307416_100342597 | 3300032002 | Bacteria | 1508 |
| 332 | Ga0307416_101131994 | 3300032002 | Bacteria | 888 |
| 333 | Ga0307414_10491420 | 3300032004 | Bacteria | 1084 |
| 334 | Ga0307411_10260085 | 3300032005 | Bacteria | 1370 |
| 335 | Ga0307411_10278969 | 3300032005 | Bacteria | 1329 |
| 336 | Ga0307411_10498596 | 3300032005 | Bacteria | 1029 |
| 337 | Ga0307415_100347096 | 3300032126 | Bacteria | 1248 |
| 338 | Ga0373939_0249952 | 3300035114 | Bacteria | 690 |
| 339 | Ga0373956_0122156 | 3300035119 | Bacteria | 1217 |
| 340 | Ga0373955_0005149 | 3300035172 | Bacteria | 5848 |
| 341 | Ga0373935_0045836 | 3300035692 | Bacteria | 2760 |
| 342 | Ga0373925_0237970 | 3300037068 | Bacteria | 1457 |
| 343 | Ga0395899_0022522 | 3300037312 | Bacteria | 4775 |
| 344 | Ga0395899_0029567 | 3300037312 | Bacteria | 4121 |
| 345 | Ga0395899_0367839 | 3300037312 | Bacteria | 958 |
| 346 | Ga0395900_0002740 | 3300037418 | Bacteria | 19253 |
| 347 | Ga0395900_0032713 | 3300037418 | Bacteria | 5348 |
| 348 | Ga0395900_0062721 | 3300037418 | Bacteria | 3820 |
| 349 | Ga0395900_0482881 | 3300037418 | Bacteria | 1191 |
| 350 | Ga0395898_0083998 | 3300037466 | Bacteria | 3069 |
| 351 | Ga0395898_0109850 | 3300037466 | Bacteria | 2643 |
| 352 | Ga0395905_0014949 | 3300037471 | Bacteria | 7404 |
| 353 | Ga0395905_0057275 | 3300037471 | Bacteria | 3646 |
| 354 | Ga0395905_0111218 | 3300037471 | Bacteria | 2572 |
| 355 | Ga0395901_0002267 | 3300038443 | Bacteria | 19632 |
| 356 | Ga0395901_0130418 | 3300038443 | Bacteria | 2641 |
| 357 | Ga0395901_0336351 | 3300038443 | Bacteria | 1560 |
| 358 | Ga0395901_0969797 | 3300038443 | Bacteria | 828 |
| 359 | Ga0436361_0106978 | 3300039447 | Bacteria | 9029 |
| 360 | Ga0436361_0561101 | 3300039447 | Bacteria | 4247 |
| 361 | Ga0451797_0421985 | 3300041453 | Bacteria | 1092 |
| 362 | Ga0451800_0732284 | 3300041459 | Bacteria | 816 |
| 363 | Ga0451807_0601123 | 3300041486 | Bacteria | 831 |
| 364 | Ga0439448_0029711 | 3300042005 | Bacteria | 1731 |
| 365 | Ga0439435_0096948 | 3300042436 | Bacteria | 902 |
| 366 | Ga0451577_0199955 | 3300042876 | Bacteria | 1804 |
| 367 | Ga0466969_0042599 | 3300044656 | Bacteria | 2265 |
| 368 | Ga0466972_0000929 | 3300044658 | Bacteria | 14095 |
| 369 | Ga0453683_0003988 | 3300044673 | Bacteria | 10673 |
| 370 | Ga0453683_0266213 | 3300044673 | Bacteria | 1094 |
| 371 | Ga0466965_0006307 | 3300044683 | Bacteria | 5373 |
| 372 | Ga0466965_0006393 | 3300044683 | Bacteria | 5347 |
| 373 | Ga0466966_0059651 | 3300044684 | Bacteria | 2409 |
| 374 | Ga0466966_0114587 | 3300044684 | Bacteria | 1660 |
| 375 | Ga0466966_0378601 | 3300044684 | Bacteria | 850 |
| 376 | Ga0466961_0013520 | 3300044693 | Bacteria | 5226 |
| 377 | Ga0466961_0371731 | 3300044693 | Bacteria | 869 |
| 378 | Ga0466964_0001168 | 3300044706 | Bacteria | 8877 |
| 379 | Ga0466964_0047079 | 3300044706 | Bacteria | 1759 |
| 380 | Ga0453684_0022196 | 3300044712 | Bacteria | 9433 |
| 381 | Ga0466971_0053378 | 3300044719 | Bacteria | 1821 |
| 382 | Ga0466971_0175691 | 3300044719 | Bacteria | 1006 |
| 383 | Ga0466970_0159370 | 3300044765 | Bacteria | 1248 |
| 384 | Ga0466957_0000301 | 3300044842 | Bacteria | 24184 |
| 385 | Ga0466957_0029441 | 3300044842 | Bacteria | 3274 |
| 386 | Ga0466957_0147278 | 3300044842 | Bacteria | 1520 |
| 387 | Ga0466957_0176358 | 3300044842 | Bacteria | 1394 |
| 388 | Ga0466957_0229855 | 3300044842 | Bacteria | 1228 |
| 389 | Ga0466957_0711135 | 3300044842 | Bacteria | 709 |
| 390 | Ga0466960_0113618 | 3300044901 | Bacteria | 1410 |
| 391 | Ga0466959_0029619 | 3300045049 | Bacteria | 4056 |
| 392 | Ga0466959_0033854 | 3300045049 | Bacteria | 3779 |
| 393 | Ga0466959_0107663 | 3300045049 | Bacteria | 1992 |
| 394 | Ga0466959_0162681 | 3300045049 | Bacteria | 1568 |
| 395 | Ga0451576_0016907 | 3300045051 | Bacteria | 8034 |
| 396 | Ga0466958_0270156 | 3300045836 | Bacteria | 1089 |
| 397 | Ga0466967_0442515 | 3300045976 | Bacteria | 1269 |
| 398 | Ga0495617_000055 | 3300046452 | Bacteria | 102065 |
| 399 | Ga0495627_000123 | 3300046453 | Bacteria | 94862 |
| 400 | Ga0495590_0005483 | 3300046457 | Bacteria | 5028 |
| 401 | Ga0495590_0166937 | 3300046457 | Bacteria | 801 |
| 402 | Ga0495629_0016433 | 3300046459 | Bacteria | 5313 |
| 403 | Ga0495638_0010532 | 3300046460 | Bacteria | 6407 |
| 404 | Ga0495653_0004577 | 3300046463 | Bacteria | 11177 |
| 405 | Ga0495653_0046362 | 3300046463 | Bacteria | 3366 |
| 406 | Ga0495580_0022065 | 3300046472 | Bacteria | 4691 |
| 407 | Ga0495582_0087705 | 3300046473 | Bacteria | 1732 |
| 408 | Ga0495582_0127194 | 3300046473 | Bacteria | 1438 |
| 409 | Ga0495605_0000035 | 3300046474 | Bacteria | 208069 |
| 410 | Ga0495605_0000295 | 3300046474 | Bacteria | 54687 |
| 411 | Ga0495584_0000269 | 3300046491 | Bacteria | 36879 |
| 412 | Ga0495584_0005974 | 3300046491 | Bacteria | 6412 |
| 413 | Ga0495584_0090251 | 3300046491 | Bacteria | 1545 |
| 414 | Ga0495584_0263438 | 3300046491 | Bacteria | 876 |
| 415 | Ga0495585_0001645 | 3300046492 | Bacteria | 17084 |
| 416 | Ga0495585_0017999 | 3300046492 | Bacteria | 4076 |
| 417 | Ga0495585_0034628 | 3300046492 | Bacteria | 2855 |
| 418 | Ga0495585_0037463 | 3300046492 | Bacteria | 2731 |
| 419 | Ga0495585_0043338 | 3300046492 | Bacteria | 2517 |
| 420 | Ga0495585_0070487 | 3300046492 | Bacteria | 1906 |
| 421 | Ga0495585_0156323 | 3300046492 | Bacteria | 1186 |
| 422 | Ga0495594_0138356 | 3300046499 | Bacteria | 1380 |
| 423 | Ga0495596_0007503 | 3300046500 | Bacteria | 4917 |
| 424 | Ga0495596_0017215 | 3300046500 | Bacteria | 2996 |
| 425 | Ga0495596_0022359 | 3300046500 | Bacteria | 2575 |
| 426 | Ga0495596_0029961 | 3300046500 | Bacteria | 2180 |
| 427 | Ga0495596_0064843 | 3300046500 | Bacteria | 1421 |
| 428 | Ga0495607_0001166 | 3300046501 | Bacteria | 23766 |
| 429 | Ga0495607_0003986 | 3300046501 | Bacteria | 11098 |
| 430 | Ga0495607_0012237 | 3300046501 | Bacteria | 5671 |
| 431 | Ga0495607_0088538 | 3300046501 | Bacteria | 1682 |
| 432 | Ga0495607_0116750 | 3300046501 | Bacteria | 1407 |
| 433 | Ga0495583_0000903 | 3300046506 | Bacteria | 35338 |
| 434 | Ga0495583_0001133 | 3300046506 | Bacteria | 29196 |
| 435 | Ga0495606_0002110 | 3300046507 | Bacteria | 24150 |
| 436 | Ga0495606_0006889 | 3300046507 | Bacteria | 10351 |
| 437 | Ga0495606_0009787 | 3300046507 | Bacteria | 8055 |
| 438 | Ga0495606_0047018 | 3300046507 | Bacteria | 2848 |
| 439 | Ga0495616_0011495 | 3300046513 | Bacteria | 5068 |
| 440 | Ga0495616_0043694 | 3300046513 | Bacteria | 2276 |
| 441 | Ga0495628_0197955 | 3300046516 | Bacteria | 1515 |
| 442 | Ga0495630_0137322 | 3300046517 | Bacteria | 1858 |
| 443 | Ga0495631_0006475 | 3300046518 | Bacteria | 6041 |
| 444 | Ga0495631_0009245 | 3300046518 | Bacteria | 4931 |
| 445 | Ga0495631_0055530 | 3300046518 | Bacteria | 1725 |
| 446 | Ga0495631_0286979 | 3300046518 | Bacteria | 700 |
| 447 | Ga0495631_0290905 | 3300046518 | Bacteria | 695 |
| 448 | Ga0495632_0000236 | 3300046519 | Bacteria | 55200 |
| 449 | Ga0495632_0010207 | 3300046519 | Bacteria | 5580 |
| 450 | Ga0495632_0218884 | 3300046519 | Bacteria | 861 |
| 451 | Ga0495643_0004661 | 3300046522 | Bacteria | 9523 |
| 452 | Ga0495643_0005473 | 3300046522 | Bacteria | 8587 |
| 453 | Ga0495643_0023090 | 3300046522 | Bacteria | 3540 |
| 454 | Ga0495644_0015854 | 3300046523 | Bacteria | 2887 |
| 455 | Ga0495644_0039529 | 3300046523 | Bacteria | 1778 |
| 456 | Ga0495648_0000527 | 3300046524 | Bacteria | 41184 |
| 457 | Ga0495663_0005202 | 3300046525 | Bacteria | 3622 |
| 458 | Ga0495666_0060180 | 3300046526 | Bacteria | 1815 |
| 459 | Ga0495666_0076299 | 3300046526 | Bacteria | 1588 |
| 460 | Ga0495666_0241371 | 3300046526 | Bacteria | 824 |
| 461 | Ga0495642_0000005 | 3300046528 | Bacteria | 176726 |
| 462 | Ga0495642_0000174 | 3300046528 | Bacteria | 37880 |
| 463 | Ga0495642_0007222 | 3300046528 | Bacteria | 4263 |
| 464 | Ga0495642_0059570 | 3300046528 | Bacteria | 1582 |
| 465 | Ga0495652_0007357 | 3300046529 | Bacteria | 10153 |
| 466 | Ga0495665_0002419 | 3300046531 | Bacteria | 10086 |
| 467 | Ga0495665_0160109 | 3300046531 | Bacteria | 1173 |
| 468 | Ga0495586_0053153 | 3300046535 | Bacteria | 2194 |
| 469 | Ga0495586_0101643 | 3300046535 | Bacteria | 1595 |
| 470 | Ga0495587_0012772 | 3300046536 | Bacteria | 5283 |
| 471 | Ga0495587_0047504 | 3300046536 | Bacteria | 2544 |
| 472 | Ga0495587_0298236 | 3300046536 | Unclassified | 902 |
| 473 | Ga0495621_0094562 | 3300046539 | Bacteria | 1130 |
| 474 | Ga0495597_0000456 | 3300046542 | Bacteria | 34898 |
| 475 | Ga0495597_0011359 | 3300046542 | Bacteria | 4320 |
| 476 | Ga0495597_0031190 | 3300046542 | Bacteria | 2427 |
| 477 | Ga0495597_0147443 | 3300046542 | Bacteria | 967 |
| 478 | Ga0495622_0033222 | 3300046557 | Bacteria | 2409 |
| 479 | Ga0495622_0039083 | 3300046557 | Bacteria | 2209 |
| 480 | Ga0495622_0074292 | 3300046557 | Bacteria | 1568 |
| 481 | Ga0495622_0093130 | 3300046557 | Bacteria | 1383 |
| 482 | Ga0495633_0013034 | 3300046558 | Bacteria | 4397 |
| 483 | Ga0495633_0068025 | 3300046558 | Bacteria | 1663 |
| 484 | Ga0495633_0073545 | 3300046558 | Bacteria | 1593 |
| 485 | Ga0495633_0152118 | 3300046558 | Bacteria | 1068 |
| 486 | Ga0495633_0265541 | 3300046558 | Bacteria | 782 |
| 487 | Ga0495656_0014217 | 3300046615 | Bacteria | 2980 |
| 488 | Ga0495656_0067639 | 3300046615 | Bacteria | 1577 |
| 489 | Ga0495668_0003850 | 3300046616 | Bacteria | 10985 |
| 490 | Ga0495668_0004835 | 3300046616 | Bacteria | 9371 |
| 491 | Ga0495611_0005156 | 3300046648 | Bacteria | 5600 |
| 492 | Ga0495611_0005581 | 3300046648 | Bacteria | 5367 |
| 493 | Ga0495611_0075600 | 3300046648 | Bacteria | 1543 |
| 494 | Ga0495625_0046978 | 3300046660 | Bacteria | 3113 |
| 495 | Ga0495635_0453283 | 3300046663 | Bacteria | 848 |
| 496 | Ga0495661_0001403 | 3300046665 | Bacteria | 20212 |
| 497 | Ga0495661_0002211 | 3300046665 | Bacteria | 15176 |
| 498 | Ga0495661_0003246 | 3300046665 | Bacteria | 12115 |
| 499 | Ga0495661_0015341 | 3300046665 | Bacteria | 5114 |
| 500 | Ga0495661_0018291 | 3300046665 | Bacteria | 4612 |
| 501 | Ga0495661_0029067 | 3300046665 | Bacteria | 3531 |
| 502 | Ga0495661_0042329 | 3300046665 | Bacteria | 2808 |
| 503 | Ga0495661_0053722 | 3300046665 | Bacteria | 2421 |
| 504 | Ga0495661_0166614 | 3300046665 | Bacteria | 1178 |
| 505 | Ga0495588_0000174 | 3300046674 | Bacteria | 81329 |
| 506 | Ga0495588_0027385 | 3300046674 | Bacteria | 2848 |
| 507 | Ga0495588_0034367 | 3300046674 | Bacteria | 2565 |
| 508 | Ga0495588_0178136 | 3300046674 | Bacteria | 1123 |
| 509 | Ga0495623_0013243 | 3300046679 | Bacteria | 5349 |
| 510 | Ga0495623_0021712 | 3300046679 | Bacteria | 4146 |
| 511 | Ga0495623_0069013 | 3300046679 | Bacteria | 2203 |
| 512 | Ga0495669_0010777 | 3300046684 | Bacteria | 3869 |
| 513 | Ga0495669_0172800 | 3300046684 | Bacteria | 1028 |
| 514 | Ga0495670_0010488 | 3300046691 | Bacteria | 4552 |
| 515 | Ga0495670_0190866 | 3300046691 | Bacteria | 1083 |
| 516 | Ga0495671_0000294 | 3300046692 | Bacteria | 41764 |
| 517 | Ga0495671_0044757 | 3300046692 | Bacteria | 2218 |
| 518 | Ga0495649_0255050 | 3300046694 | Bacteria | 900 |
| 519 | Ga0495589_0000161 | 3300046794 | Bacteria | 62057 |
| 520 | Ga0495589_0002183 | 3300046794 | Bacteria | 11015 |
| 521 | Ga0495589_0061727 | 3300046794 | Bacteria | 1839 |
| 522 | Ga0495589_0181485 | 3300046794 | Bacteria | 998 |
| 523 | Ga0495600_0218517 | 3300046809 | Bacteria | 1219 |
| 524 | Ga0495600_0239498 | 3300046809 | Bacteria | 1156 |
| 525 | Ga0495660_0000157 | 3300046810 | Bacteria | 73772 |
| 526 | Ga0495660_0007122 | 3300046810 | Bacteria | 6589 |
| 527 | Ga0495660_0022472 | 3300046810 | Bacteria | 3602 |
| 528 | Ga0495660_0072648 | 3300046810 | Bacteria | 1821 |
| 529 | Ga0495581_0070697 | 3300047315 | Bacteria | 2019 |
| 530 | Ga0495581_0155345 | 3300047315 | Bacteria | 1337 |
| 531 | Ga0495604_0013177 | 3300047317 | Bacteria | 6583 |
| 532 | Ga0495604_0027495 | 3300047317 | Bacteria | 4523 |
| 533 | Ga0495636_0001470 | 3300047318 | Bacteria | 8916 |
| 534 | Ga0495636_0159480 | 3300047318 | Unclassified | 1016 |
| 535 | Ga0495674_0317131 | 3300047319 | Bacteria | 1271 |
| 536 | Ga0495672_0001930 | 3300047320 | Bacteria | 19604 |
| 537 | Ga0495672_0099452 | 3300047320 | Bacteria | 1581 |
| 538 | Ga0495676_0078378 | 3300047321 | Bacteria | 2516 |
| 539 | Ga0495680_0247980 | 3300047322 | Bacteria | 1263 |
| 540 | Ga0495683_0018703 | 3300047323 | Bacteria | 3580 |
| 541 | Ga0495683_0024581 | 3300047323 | Bacteria | 3091 |
| 542 | Ga0495683_0048730 | 3300047323 | Bacteria | 2123 |
| 543 | Ga0495687_000215 | 3300047443 | Bacteria | 82752 |
| 544 | Ga0495687_000298 | 3300047443 | Bacteria | 65591 |
| 545 | Ga0495675_0002719 | 3300047444 | Bacteria | 10601 |
| 546 | Ga0495677_0000109 | 3300047445 | Bacteria | 41192 |
| 547 | Ga0495677_0002072 | 3300047445 | Bacteria | 7988 |
| 548 | Ga0495677_0013665 | 3300047445 | Bacteria | 2955 |
| 549 | Ga0495677_0056799 | 3300047445 | Bacteria | 1446 |
| 550 | Ga0495679_007882 | 3300047446 | Bacteria | 4386 |
| 551 | Ga0495685_137303 | 3300047447 | Unclassified | 797 |
| 552 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 553 | Ga0495681_0020236 | 3300047470 | Bacteria | 3614 |
| 554 | Ga0495681_0020485 | 3300047470 | Bacteria | 3588 |
| 555 | Ga0495681_0053813 | 3300047470 | Bacteria | 1883 |
| 556 | Ga0495686_0000142 | 3300047472 | Bacteria | 143655 |
| 557 | Ga0495686_0006640 | 3300047472 | Bacteria | 8812 |
| 558 | Ga0495686_0086030 | 3300047472 | Bacteria | 1913 |
| 559 | Ga0495593_0033938 | 3300047673 | Bacteria | 2777 |
| 560 | Ga0495602_0126083 | 3300048088 | Bacteria | 2051 |
| 561 | Ga0495614_0098752 | 3300048089 | Bacteria | 1275 |
| 562 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 563 | Ga0495626_0013785 | 3300048091 | Bacteria | 4192 |
| 564 | Ga0496101_0281329 | 3300048904 | Bacteria | 1300 |
| 565 | Ga0496101_0362972 | 3300048904 | Bacteria | 1139 |
| 566 | Ga0496102_0000173 | 3300048905 | Bacteria | 87737 |
| 567 | Ga0496102_0002646 | 3300048905 | Bacteria | 15218 |
| 568 | Ga0496102_0478709 | 3300048905 | Bacteria | 1166 |
| 569 | Ga0496103_0000131 | 3300048906 | Bacteria | 79787 |
| 570 | Ga0496103_0016801 | 3300048906 | Bacteria | 4370 |
| 571 | Ga0496104_0037026 | 3300048907 | Bacteria | 4563 |
| 572 | Ga0496105_0001020 | 3300048908 | Bacteria | 19340 |
| 573 | Ga0496105_0105614 | 3300048908 | Bacteria | 2325 |
| 574 | Ga0496107_0120691 | 3300048910 | Bacteria | 1931 |
| 575 | Ga0496109_0101966 | 3300048912 | Bacteria | 2664 |
| 576 | Ga0496111_0086704 | 3300048914 | Bacteria | 2291 |
| 577 | Ga0496111_0103346 | 3300048914 | Bacteria | 2095 |
| 578 | Ga0496112_0199407 | 3300048915 | Bacteria | 1961 |
| 579 | Ga0496113_0001294 | 3300048916 | Bacteria | 13820 |
| 580 | Ga0496113_0180622 | 3300048916 | Bacteria | 1673 |
| 581 | Ga0496113_0238693 | 3300048916 | Bacteria | 1450 |
| 582 | Ga0496113_0694742 | 3300048916 | Bacteria | 812 |
| 583 | Ga0496114_0054285 | 3300048917 | Bacteria | 3342 |
| 584 | Ga0496114_1030596 | 3300048917 | Bacteria | 707 |
| 585 | Ga0496115_0000133 | 3300048918 | Bacteria | 67951 |
| 586 | Ga0496115_0002099 | 3300048918 | Bacteria | 14267 |
| 587 | Ga0496116_0005419 | 3300048919 | Bacteria | 11859 |
| 588 | Ga0496117_0002127 | 3300048920 | Bacteria | 25909 |
| 589 | Ga0496118_0000092 | 3300048921 | Bacteria | 169106 |
| 590 | Ga0496119_0005121 | 3300048922 | Bacteria | 12704 |
| 591 | Ga0496121_0005979 | 3300048924 | Bacteria | 15374 |
| 592 | Ga0496122_0002763 | 3300048925 | Bacteria | 24229 |
| 593 | Ga0496122_0122443 | 3300048925 | Bacteria | 1673 |
| 594 | Ga0496123_0002753 | 3300048926 | Bacteria | 21034 |
| 595 | Ga0496123_0004315 | 3300048926 | Bacteria | 15093 |
| 596 | Ga0496123_0024484 | 3300048926 | Bacteria | 4586 |
| 597 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 598 | Ga0496124_0027915 | 3300048927 | Bacteria | 5055 |
| 599 | Ga0496124_0109338 | 3300048927 | Bacteria | 2228 |
| 600 | Ga0496125_0002309 | 3300048928 | Bacteria | 25170 |
| 601 | Ga0496125_0055441 | 3300048928 | Bacteria | 3229 |
| 602 | Ga0496126_0000283 | 3300048929 | Bacteria | 107129 |
| 603 | Ga0495678_052232 | 3300049459 | Bacteria | 1575 |
| 604 | Ga0495682_0001423 | 3300049460 | Bacteria | 12956 |
| 605 | Ga0495682_0019235 | 3300049460 | Bacteria | 2569 |
| 606 | Ga0501031_0158274 | 3300049568 | Bacteria | 1480 |
| 607 | Ga0501034_0153494 | 3300049571 | Bacteria | 2278 |
| 608 | Ga0501037_0008162 | 3300049573 | Bacteria | 7675 |
| 609 | Ga0501040_0161456 | 3300049576 | Bacteria | 1584 |
| 610 | Ga0501042_0229728 | 3300049578 | Bacteria | 1338 |
| 611 | Ga0501046_0086394 | 3300049580 | Bacteria | 2418 |
| 612 | Ga0501047_0065616 | 3300049581 | Bacteria | 3499 |
| 613 | Ga0501070_0742247 | 3300049586 | Bacteria | 774 |
| 614 | Ga0501071_0067106 | 3300049587 | Bacteria | 2608 |
| 615 | Ga0501072_0049126 | 3300049588 | Bacteria | 3321 |
| 616 | Ga0501074_0091035 | 3300049590 | Bacteria | 2184 |
| 617 | Ga0501075_0023475 | 3300049591 | Bacteria | 4517 |
| 618 | Ga0501222_006383 | 3300049662 | Bacteria | 1585 |
| 619 | Ga0501079_0188111 | 3300049741 | Bacteria | 1611 |
| 620 | Ga0501081_0392019 | 3300049743 | Bacteria | 1027 |
| 621 | Ga0501083_0001990 | 3300049744 | Bacteria | 14063 |
| 622 | Ga0501283_051438 | 3300049779 | Bacteria | 731 |
| 623 | Ga0501035_0265361 | 3300049822 | Bacteria | 1454 |
| 624 | Ga0501044_0185662 | 3300049823 | Bacteria | 2044 |
| 625 | Ga0501045_0017114 | 3300049824 | Bacteria | 5147 |
| 626 | Ga0501045_0208587 | 3300049824 | Bacteria | 1455 |
| 627 | nmdc:mga0yw44_403469_c1 | 3300050492 | Bacteria | 924 |
| 628 | nmdc:mga0k408_143932_c1 | 3300050493 | Bacteria | 1419 |
| 629 | nmdc:mga0qj67_4962_c1 | 3300050509 | Bacteria | 9670 |
| 630 | nmdc:mga06r32_4146_c1 | 3300050510 | Bacteria | 12977 |
| 631 | nmdc:mga08y16_128079_c1 | 3300050511 | Bacteria | 2640 |
| 632 | nmdc:mga08x19_181460_c1 | 3300050514 | Bacteria | 1437 |
| 633 | nmdc:mga0a205_147214_c1 | 3300050515 | Bacteria | 2255 |
| 634 | nmdc:mga0a205_292167_c1 | 3300050515 | Bacteria | 1504 |
| 635 | Ga0500641_0150984 | 3300053096 | Bacteria | 1003 |
| 636 | Ga0500658_0118260 | 3300053134 | Bacteria | 1173 |
| 637 | Ga0500577_0038633 | 3300053142 | Bacteria | 1725 |
| 638 | Ga0500637_0001526 | 3300053178 | Bacteria | 9882 |
| 639 | Ga0501084_0080215 | 3300054114 | Bacteria | 2736 |
| 640 | Ga0501082_0004352 | 3300060353 | Bacteria | 12381 |
| 641 | Ga0501082_0039000 | 3300060353 | Bacteria | 4097 |
| 642 | Ga0466962_0047367 | 3300061719 | Bacteria | 2054 |
| 643 | Ga0530510_0105239 | 3300061734 | Bacteria | 2065 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042436 | Ga0439435_0096948 | Ga0439435_0096948_144_752 | 201 |
| 2 | 3300009147 | Ga0114129_10244340 | Ga0114129_102443402 | 204 |
| 3 | 3300042005 | Ga0439448_0029711 | Ga0439448_0029711_1085_1702 | 204 |
| 4 | 3300046457 | Ga0495590_0005483 | Ga0495590_0005483_821_1438 | 204 |
| 5 | 3300046474 | Ga0495605_0000295 | Ga0495605_0000295_53515_54132 | 204 |
| 6 | 3300046501 | Ga0495607_0003986 | Ga0495607_0003986_4647_5264 | 204 |
| 7 | 3300046518 | Ga0495631_0286979 | Ga0495631_0286979_31_648 | 204 |
| 8 | 3300046518 | Ga0495631_0290905 | Ga0495631_0290905_39_656 | 204 |
| 9 | 3300046522 | Ga0495643_0005473 | Ga0495643_0005473_3324_3941 | 204 |
| 10 | 3300046536 | Ga0495587_0298236 | Ga0495587_0298236_237_854 | 204 |
| 11 | 3300046542 | Ga0495597_0031190 | Ga0495597_0031190_1792_2409 | 204 |
| 12 | 3300046542 | Ga0495597_0147443 | Ga0495597_0147443_28_645 | 204 |
| 13 | 3300046665 | Ga0495661_0029067 | Ga0495661_0029067_684_1301 | 204 |
| 14 | 3300046674 | Ga0495588_0000174 | Ga0495588_0000174_14160_14777 | 204 |
| 15 | 3300046794 | Ga0495589_0000161 | Ga0495589_0000161_53515_54132 | 204 |
| 16 | 3300046810 | Ga0495660_0000157 | Ga0495660_0000157_14839_15456 | 204 |
| 17 | 3300047320 | Ga0495672_0001930 | Ga0495672_0001930_3174_3791 | 204 |
| 18 | 3300047323 | Ga0495683_0024581 | Ga0495683_0024581_1185_1802 | 204 |
| 19 | 3300047443 | Ga0495687_000298 | Ga0495687_000298_46709_47326 | 204 |
| 20 | 3300047445 | Ga0495677_0002072 | Ga0495677_0002072_2013_2630 | 204 |
| 21 | 3300048091 | Ga0495626_0000016 | Ga0495626_0000016_193221_193838 | 204 |
| 22 | 3300049459 | Ga0495678_052232 | Ga0495678_052232_530_1147 | 204 |
| 23 | 3300049662 | Ga0501222_006383 | Ga0501222_006383_357_974 | 204 |
| 24 | 3300025912 | Ga0207707_10360714 | Ga0207707_103607142 | 208 |
| 25 | iso_pu_bacteria | 2738541337 | 2739056719 | 209 |
| 26 | iso_pu_bacteria | 2791355260 | 2793323047 | 209 |
| 27 | iso_pu_bacteria | 2839993093 | 2839995432 | 209 |
| 28 | 3300046507 | Ga0495606_0009787 | Ga0495606_0009787_898_1530 | 210 |
| 29 | iso_pu_bacteria | 2643221556 | 2643802205 | 210 |
| 30 | iso_pu_bacteria | 2643221684 | 2644475713 | 210 |
| 31 | iso_pu_bacteria | 2808606418 | 2809143030 | 210 |
| 32 | iso_pu_bacteria | 2904424332 | 2904428217 | 210 |
| 33 | iso_pu_bacteria | 8047673197 | 8047673937 | 210 |
| 34 | 3300005614 | Ga0068856_100000233 | Ga0068856_10000023345 | 212 |
| 35 | 3300005618 | Ga0068864_100428668 | Ga0068864_1004286682 | 212 |
| 36 | 3300005841 | Ga0068863_100012982 | Ga0068863_1000129825 | 212 |
| 37 | 3300009093 | Ga0105240_10033636 | Ga0105240_100336366 | 212 |
| 38 | 3300025913 | Ga0207695_10106857 | Ga0207695_101068572 | 212 |
| 39 | 3300026078 | Ga0207702_10000577 | Ga0207702_100005771 | 212 |
| 40 | 3300026088 | Ga0207641_10009111 | Ga0207641_100091115 | 212 |
| 41 | 3300026095 | Ga0207676_10208514 | Ga0207676_102085142 | 212 |
| 42 | 3300028794 | Ga0307515_10000043 | Ga0307515_1000004358 | 212 |
| 43 | 3300039447 | Ga0436361_0106978 | Ga0436361_0106978_1830_2471 | 212 |
| 44 | 3300048908 | Ga0496105_0105614 | Ga0496105_0105614_1465_2106 | 212 |
| 45 | 3300005290 | Ga0065712_10134503 | Ga0065712_101345032 | 213 |
| 46 | 3300005336 | Ga0070680_100281145 | Ga0070680_1002811452 | 213 |
| 47 | 3300005445 | Ga0070708_100239078 | Ga0070708_1002390782 | 213 |
| 48 | 3300005518 | Ga0070699_100344869 | Ga0070699_1003448691 | 213 |
| 49 | 3300005616 | Ga0068852_100001585 | Ga0068852_10000158516 | 213 |
| 50 | 3300005985 | Ga0081539_10017714 | Ga0081539_100177146 | 213 |
| 51 | 3300006195 | Ga0075366_10094432 | Ga0075366_100944321 | 213 |
| 52 | 3300006353 | Ga0075370_10105980 | Ga0075370_101059802 | 213 |
| 53 | 3300025916 | Ga0207663_10347038 | Ga0207663_103470381 | 213 |
| 54 | 3300026142 | Ga0207698_10000978 | Ga0207698_100009786 | 213 |
| 55 | 3300028573 | Ga0265334_10126410 | Ga0265334_101264102 | 213 |
| 56 | 3300031241 | Ga0265325_10047554 | Ga0265325_100475542 | 213 |
| 57 | 3300035114 | Ga0373939_0249952 | Ga0373939_0249952_10_654 | 213 |
| 58 | 3300037471 | Ga0395905_0057275 | Ga0395905_0057275_660_1301 | 213 |
| 59 | 3300044693 | Ga0466961_0371731 | Ga0466961_0371731_215_859 | 213 |
| 60 | 3300044712 | Ga0453684_0022196 | Ga0453684_0022196_7715_8368 | 213 |
| 61 | 3300045976 | Ga0466967_0442515 | Ga0466967_0442515_595_1239 | 213 |
| 62 | 3300046460 | Ga0495638_0010532 | Ga0495638_0010532_5354_5998 | 213 |
| 63 | 3300046463 | Ga0495653_0004577 | Ga0495653_0004577_1753_2397 | 213 |
| 64 | 3300046472 | Ga0495580_0022065 | Ga0495580_0022065_568_1212 | 213 |
| 65 | 3300046473 | Ga0495582_0087705 | Ga0495582_0087705_1048_1692 | 213 |
| 66 | 3300046499 | Ga0495594_0138356 | Ga0495594_0138356_158_802 | 213 |
| 67 | 3300046517 | Ga0495630_0137322 | Ga0495630_0137322_648_1292 | 213 |
| 68 | 3300046526 | Ga0495666_0076299 | Ga0495666_0076299_270_914 | 213 |
| 69 | 3300046529 | Ga0495652_0007357 | Ga0495652_0007357_5695_6339 | 213 |
| 70 | 3300046531 | Ga0495665_0002419 | Ga0495665_0002419_2953_3597 | 213 |
| 71 | 3300046536 | Ga0495587_0012772 | Ga0495587_0012772_3884_4528 | 213 |
| 72 | 3300046557 | Ga0495622_0039083 | Ga0495622_0039083_726_1370 | 213 |
| 73 | 3300046679 | Ga0495623_0021712 | Ga0495623_0021712_2527_3171 | 213 |
| 74 | 3300046809 | Ga0495600_0218517 | Ga0495600_0218517_529_1173 | 213 |
| 75 | 3300047317 | Ga0495604_0013177 | Ga0495604_0013177_4407_5051 | 213 |
| 76 | 3300047444 | Ga0495675_0002719 | Ga0495675_0002719_8282_8926 | 213 |
| 77 | 3300049568 | Ga0501031_0158274 | Ga0501031_0158274_452_1096 | 213 |
| 78 | 3300049573 | Ga0501037_0008162 | Ga0501037_0008162_581_1225 | 213 |
| 79 | 3300049578 | Ga0501042_0229728 | Ga0501042_0229728_120_764 | 213 |
| 80 | 3300049822 | Ga0501035_0265361 | Ga0501035_0265361_414_1058 | 213 |
| 81 | 3300049823 | Ga0501044_0185662 | Ga0501044_0185662_417_1061 | 213 |
| 82 | 3300049824 | Ga0501045_0017114 | Ga0501045_0017114_1471_2115 | 213 |
| 83 | 3300050493 | nmdc:mga0k408_143932_c1 | nmdc:mga0k408_143932_c1_95_748 | 213 |
| 84 | 3300053096 | Ga0500641_0150984 | Ga0500641_0150984_62_706 | 213 |
| 85 | 3300053134 | Ga0500658_0118260 | Ga0500658_0118260_74_718 | 213 |
| 86 | 3300053142 | Ga0500577_0038633 | Ga0500577_0038633_728_1426 | 213 |
| 87 | 3300060353 | Ga0501082_0004352 | Ga0501082_0004352_5238_5882 | 213 |
| 88 | 3300003322 | rootL2_10027771 | rootL2_100277717 | 214 |
| 89 | 3300003322 | rootL2_10054306 | rootL2_100543063 | 214 |
| 90 | 3300003322 | rootL2_10091597 | rootL2_100915971 | 214 |
| 91 | 3300003323 | rootH1_10055722 | rootH1_100557222 | 214 |
| 92 | 3300005262 | Ga0065165_1002492 | Ga0065165_100249211 | 214 |
| 93 | 3300005262 | Ga0065165_1013808 | Ga0065165_10138083 | 214 |
| 94 | 3300005295 | Ga0065707_10040339 | Ga0065707_100403391 | 214 |
| 95 | 3300005327 | Ga0070658_10024394 | Ga0070658_100243944 | 214 |
| 96 | 3300005328 | Ga0070676_10008198 | Ga0070676_100081982 | 214 |
| 97 | 3300005330 | Ga0070690_100626752 | Ga0070690_1006267521 | 214 |
| 98 | 3300005334 | Ga0068869_100016813 | Ga0068869_1000168135 | 214 |
| 99 | 3300005339 | Ga0070660_100015927 | Ga0070660_1000159274 | 214 |
| 100 | 3300005340 | Ga0070689_100472999 | Ga0070689_1004729992 | 214 |
| 101 | 3300005344 | Ga0070661_100244263 | Ga0070661_1002442632 | 214 |
| 102 | 3300005347 | Ga0070668_100088445 | Ga0070668_1000884453 | 214 |
| 103 | 3300005347 | Ga0070668_100108246 | Ga0070668_1001082463 | 214 |
| 104 | 3300005353 | Ga0070669_100002931 | Ga0070669_1000029313 | 214 |
| 105 | 3300005354 | Ga0070675_100002140 | Ga0070675_1000021404 | 214 |
| 106 | 3300005355 | Ga0070671_100362960 | Ga0070671_1003629601 | 214 |
| 107 | 3300005364 | Ga0070673_100054587 | Ga0070673_1000545873 | 214 |
| 108 | 3300005365 | Ga0070688_100069415 | Ga0070688_1000694151 | 214 |
| 109 | 3300005366 | Ga0070659_100043712 | Ga0070659_1000437122 | 214 |
| 110 | 3300005366 | Ga0070659_100098610 | Ga0070659_1000986103 | 214 |
| 111 | 3300005367 | Ga0070667_100112647 | Ga0070667_1001126473 | 214 |
| 112 | 3300005438 | Ga0070701_10030817 | Ga0070701_100308174 | 214 |
| 113 | 3300005441 | Ga0070700_100452926 | Ga0070700_1004529261 | 214 |
| 114 | 3300005444 | Ga0070694_100605285 | Ga0070694_1006052851 | 214 |
| 115 | 3300005455 | Ga0070663_100046491 | Ga0070663_1000464914 | 214 |
| 116 | 3300005457 | Ga0070662_100003414 | Ga0070662_1000034144 | 214 |
| 117 | 3300005457 | Ga0070662_100114029 | Ga0070662_1001140293 | 214 |
| 118 | 3300005466 | Ga0070685_10006909 | Ga0070685_100069093 | 214 |
| 119 | 3300005466 | Ga0070685_10273431 | Ga0070685_102734312 | 214 |
| 120 | 3300005468 | Ga0070707_100154998 | Ga0070707_1001549981 | 214 |
| 121 | 3300005535 | Ga0070684_100013866 | Ga0070684_1000138665 | 214 |
| 122 | 3300005535 | Ga0070684_100112329 | Ga0070684_1001123291 | 214 |
| 123 | 3300005539 | Ga0068853_100005136 | Ga0068853_1000051363 | 214 |
| 124 | 3300005543 | Ga0070672_100079864 | Ga0070672_1000798641 | 214 |
| 125 | 3300005544 | Ga0070686_100452398 | Ga0070686_1004523981 | 214 |
| 126 | 3300005563 | Ga0068855_100008710 | Ga0068855_1000087108 | 214 |
| 127 | 3300005563 | Ga0068855_100047031 | Ga0068855_1000470311 | 214 |
| 128 | 3300005564 | Ga0070664_100657232 | Ga0070664_1006572322 | 214 |
| 129 | 3300005577 | Ga0068857_100016081 | Ga0068857_1000160813 | 214 |
| 130 | 3300005616 | Ga0068852_100003813 | Ga0068852_1000038136 | 214 |
| 131 | 3300005616 | Ga0068852_100051386 | Ga0068852_1000513863 | 214 |
| 132 | 3300005616 | Ga0068852_100055860 | Ga0068852_1000558604 | 214 |
| 133 | 3300005616 | Ga0068852_100293144 | Ga0068852_1002931442 | 214 |
| 134 | 3300005719 | Ga0068861_100001729 | Ga0068861_1000017294 | 214 |
| 135 | 3300005719 | Ga0068861_100053641 | Ga0068861_1000536411 | 214 |
| 136 | 3300005834 | Ga0068851_10042740 | Ga0068851_100427403 | 214 |
| 137 | 3300005841 | Ga0068863_100018013 | Ga0068863_1000180137 | 214 |
| 138 | 3300005841 | Ga0068863_100041920 | Ga0068863_1000419203 | 214 |
| 139 | 3300005842 | Ga0068858_100594133 | Ga0068858_1005941332 | 214 |
| 140 | 3300005844 | Ga0068862_100007098 | Ga0068862_1000070985 | 214 |
| 141 | 3300006051 | Ga0075364_10007757 | Ga0075364_100077577 | 214 |
| 142 | 3300006195 | Ga0075366_10014006 | Ga0075366_100140062 | 214 |
| 143 | 3300006195 | Ga0075366_10360109 | Ga0075366_103601092 | 214 |
| 144 | 3300006852 | Ga0075433_10136374 | Ga0075433_101363743 | 214 |
| 145 | 3300006880 | Ga0075429_100820861 | Ga0075429_1008208612 | 214 |
| 146 | 3300006881 | Ga0068865_100086587 | Ga0068865_1000865871 | 214 |
| 147 | 3300009036 | Ga0105244_10194078 | Ga0105244_101940782 | 214 |
| 148 | 3300009093 | Ga0105240_10343586 | Ga0105240_103435863 | 214 |
| 149 | 3300009093 | Ga0105240_10697331 | Ga0105240_106973312 | 214 |
| 150 | 3300009094 | Ga0111539_10004167 | Ga0111539_1000416717 | 214 |
| 151 | 3300009098 | Ga0105245_11171294 | Ga0105245_111712941 | 214 |
| 152 | 3300009148 | Ga0105243_10033833 | Ga0105243_100338332 | 214 |
| 153 | 3300009148 | Ga0105243_11065297 | Ga0105243_110652971 | 214 |
| 154 | 3300009176 | Ga0105242_10076586 | Ga0105242_100765861 | 214 |
| 155 | 3300009177 | Ga0105248_10294006 | Ga0105248_102940062 | 214 |
| 156 | 3300013100 | Ga0157373_10336949 | Ga0157373_103369492 | 214 |
| 157 | 3300013102 | Ga0157371_10054470 | Ga0157371_100544702 | 214 |
| 158 | 3300013296 | Ga0157374_10032897 | Ga0157374_100328973 | 214 |
| 159 | 3300013297 | Ga0157378_11117195 | Ga0157378_111171951 | 214 |
| 160 | 3300013306 | Ga0163162_10009068 | Ga0163162_100090686 | 214 |
| 161 | 3300013307 | Ga0157372_10654979 | Ga0157372_106549791 | 214 |
| 162 | 3300013308 | Ga0157375_10010853 | Ga0157375_100108536 | 214 |
| 163 | 3300014326 | Ga0157380_10020507 | Ga0157380_100205072 | 214 |
| 164 | 3300014326 | Ga0157380_11087100 | Ga0157380_110871001 | 214 |
| 165 | 3300014497 | Ga0182008_10099300 | Ga0182008_100993002 | 214 |
| 166 | 3300014968 | Ga0157379_10042066 | Ga0157379_100420661 | 214 |
| 167 | 3300017792 | Ga0163161_10094713 | Ga0163161_100947133 | 214 |
| 168 | 3300020082 | Ga0206353_10927837 | Ga0206353_109278371 | 214 |
| 169 | 3300025295 | Ga0209564_1024324 | Ga0209564_10243242 | 214 |
| 170 | 3300025321 | Ga0207656_10090576 | Ga0207656_100905762 | 214 |
| 171 | 3300025901 | Ga0207688_10427838 | Ga0207688_104278381 | 214 |
| 172 | 3300025904 | Ga0207647_10025339 | Ga0207647_100253392 | 214 |
| 173 | 3300025907 | Ga0207645_10001466 | Ga0207645_100014663 | 214 |
| 174 | 3300025909 | Ga0207705_10006844 | Ga0207705_100068445 | 214 |
| 175 | 3300025909 | Ga0207705_10008375 | Ga0207705_100083754 | 214 |
| 176 | 3300025918 | Ga0207662_10019987 | Ga0207662_100199873 | 214 |
| 177 | 3300025919 | Ga0207657_10007757 | Ga0207657_100077578 | 214 |
| 178 | 3300025919 | Ga0207657_10021906 | Ga0207657_100219064 | 214 |
| 179 | 3300025923 | Ga0207681_10060318 | Ga0207681_100603184 | 214 |
| 180 | 3300025926 | Ga0207659_10011262 | Ga0207659_100112623 | 214 |
| 181 | 3300025927 | Ga0207687_10065552 | Ga0207687_100655521 | 214 |
| 182 | 3300025931 | Ga0207644_10144510 | Ga0207644_101445102 | 214 |
| 183 | 3300025932 | Ga0207690_10554807 | Ga0207690_105548072 | 214 |
| 184 | 3300025932 | Ga0207690_10594783 | Ga0207690_105947831 | 214 |
| 185 | 3300025933 | Ga0207706_10002793 | Ga0207706_1000279311 | 214 |
| 186 | 3300025933 | Ga0207706_10068785 | Ga0207706_100687853 | 214 |
| 187 | 3300025934 | Ga0207686_10003830 | Ga0207686_100038302 | 214 |
| 188 | 3300025935 | Ga0207709_10142024 | Ga0207709_101420241 | 214 |
| 189 | 3300025936 | Ga0207670_10144375 | Ga0207670_101443752 | 214 |
| 190 | 3300025938 | Ga0207704_10067479 | Ga0207704_100674791 | 214 |
| 191 | 3300025940 | Ga0207691_10000481 | Ga0207691_1000048124 | 214 |
| 192 | 3300025941 | Ga0207711_10259372 | Ga0207711_102593722 | 214 |
| 193 | 3300025942 | Ga0207689_10027062 | Ga0207689_100270621 | 214 |
| 194 | 3300025944 | Ga0207661_10102718 | Ga0207661_101027182 | 214 |
| 195 | 3300025945 | Ga0207679_10008470 | Ga0207679_100084706 | 214 |
| 196 | 3300025945 | Ga0207679_10044727 | Ga0207679_100447271 | 214 |
| 197 | 3300025961 | Ga0207712_10007809 | Ga0207712_100078094 | 214 |
| 198 | 3300025972 | Ga0207668_10239362 | Ga0207668_102393622 | 214 |
| 199 | 3300026023 | Ga0207677_10041185 | Ga0207677_100411851 | 214 |
| 200 | 3300026041 | Ga0207639_10386896 | Ga0207639_103868961 | 214 |
| 201 | 3300026067 | Ga0207678_10285260 | Ga0207678_102852601 | 214 |
| 202 | 3300026075 | Ga0207708_10641043 | Ga0207708_106410431 | 214 |
| 203 | 3300026078 | Ga0207702_11166354 | Ga0207702_111663541 | 214 |
| 204 | 3300026088 | Ga0207641_10011616 | Ga0207641_100116162 | 214 |
| 205 | 3300026088 | Ga0207641_10110562 | Ga0207641_101105623 | 214 |
| 206 | 3300026116 | Ga0207674_10010814 | Ga0207674_100108142 | 214 |
| 207 | 3300026118 | Ga0207675_100000450 | Ga0207675_10000045021 | 214 |
| 208 | 3300026142 | Ga0207698_10019541 | Ga0207698_100195413 | 214 |
| 209 | 3300028380 | Ga0268265_10072385 | Ga0268265_100723851 | 214 |
| 210 | 3300028381 | Ga0268264_10125645 | Ga0268264_101256453 | 214 |
| 211 | 3300028563 | Ga0265319_1006243 | Ga0265319_10062433 | 214 |
| 212 | 3300028794 | Ga0307515_10089387 | Ga0307515_100893873 | 214 |
| 213 | 3300031238 | Ga0265332_10120583 | Ga0265332_101205831 | 214 |
| 214 | 3300031595 | Ga0265313_10002098 | Ga0265313_1000209811 | 214 |
| 215 | 3300031616 | Ga0307508_10000096 | Ga0307508_1000009643 | 214 |
| 216 | 3300031691 | Ga0316579_10185865 | Ga0316579_101858651 | 214 |
| 217 | 3300031711 | Ga0265314_10015645 | Ga0265314_100156453 | 214 |
| 218 | 3300031728 | Ga0316578_10217856 | Ga0316578_102178562 | 214 |
| 219 | 3300031731 | Ga0307405_10746366 | Ga0307405_107463661 | 214 |
| 220 | 3300031824 | Ga0307413_10225434 | Ga0307413_102254342 | 214 |
| 221 | 3300031901 | Ga0307406_10375483 | Ga0307406_103754832 | 214 |
| 222 | 3300031911 | Ga0307412_10690586 | Ga0307412_106905862 | 214 |
| 223 | 3300031995 | Ga0307409_100279673 | Ga0307409_1002796732 | 214 |
| 224 | 3300032002 | Ga0307416_100342597 | Ga0307416_1003425972 | 214 |
| 225 | 3300032005 | Ga0307411_10260085 | Ga0307411_102600852 | 214 |
| 226 | 3300035119 | Ga0373956_0122156 | Ga0373956_0122156_519_1166 | 214 |
| 227 | 3300035172 | Ga0373955_0005149 | Ga0373955_0005149_2170_2817 | 214 |
| 228 | 3300037068 | Ga0373925_0237970 | Ga0373925_0237970_45_692 | 214 |
| 229 | 3300037312 | Ga0395899_0022522 | Ga0395899_0022522_2174_2821 | 214 |
| 230 | 3300037312 | Ga0395899_0029567 | Ga0395899_0029567_2064_2711 | 214 |
| 231 | 3300037312 | Ga0395899_0367839 | Ga0395899_0367839_185_832 | 214 |
| 232 | 3300037418 | Ga0395900_0002740 | Ga0395900_0002740_11717_12364 | 214 |
| 233 | 3300037418 | Ga0395900_0032713 | Ga0395900_0032713_3291_3938 | 214 |
| 234 | 3300037418 | Ga0395900_0062721 | Ga0395900_0062721_2829_3476 | 214 |
| 235 | 3300037418 | Ga0395900_0482881 | Ga0395900_0482881_340_987 | 214 |
| 236 | 3300037466 | Ga0395898_0083998 | Ga0395898_0083998_1092_1739 | 214 |
| 237 | 3300037466 | Ga0395898_0109850 | Ga0395898_0109850_918_1565 | 214 |
| 238 | 3300037471 | Ga0395905_0111218 | Ga0395905_0111218_345_992 | 214 |
| 239 | 3300038443 | Ga0395901_0002267 | Ga0395901_0002267_10320_10967 | 214 |
| 240 | 3300038443 | Ga0395901_0130418 | Ga0395901_0130418_1682_2329 | 214 |
| 241 | 3300038443 | Ga0395901_0336351 | Ga0395901_0336351_743_1390 | 214 |
| 242 | 3300041459 | Ga0451800_0732284 | Ga0451800_0732284_82_765 | 214 |
| 243 | 3300042876 | Ga0451577_0199955 | Ga0451577_0199955_100_747 | 214 |
| 244 | 3300044658 | Ga0466972_0000929 | Ga0466972_0000929_655_1302 | 214 |
| 245 | 3300044673 | Ga0453683_0266213 | Ga0453683_0266213_269_916 | 214 |
| 246 | 3300044683 | Ga0466965_0006307 | Ga0466965_0006307_4029_4676 | 214 |
| 247 | 3300044683 | Ga0466965_0006393 | Ga0466965_0006393_2679_3326 | 214 |
| 248 | 3300044684 | Ga0466966_0059651 | Ga0466966_0059651_47_694 | 214 |
| 249 | 3300044684 | Ga0466966_0114587 | Ga0466966_0114587_973_1620 | 214 |
| 250 | 3300044684 | Ga0466966_0378601 | Ga0466966_0378601_29_676 | 214 |
| 251 | 3300044706 | Ga0466964_0001168 | Ga0466964_0001168_527_1174 | 214 |
| 252 | 3300044719 | Ga0466971_0175691 | Ga0466971_0175691_83_730 | 214 |
| 253 | 3300044765 | Ga0466970_0159370 | Ga0466970_0159370_532_1179 | 214 |
| 254 | 3300044842 | Ga0466957_0000301 | Ga0466957_0000301_10243_10965 | 214 |
| 255 | 3300044842 | Ga0466957_0029441 | Ga0466957_0029441_1811_2458 | 214 |
| 256 | 3300044842 | Ga0466957_0147278 | Ga0466957_0147278_327_974 | 214 |
| 257 | 3300044842 | Ga0466957_0229855 | Ga0466957_0229855_312_959 | 214 |
| 258 | 3300044842 | Ga0466957_0711135 | Ga0466957_0711135_34_681 | 214 |
| 259 | 3300044901 | Ga0466960_0113618 | Ga0466960_0113618_690_1337 | 214 |
| 260 | 3300045049 | Ga0466959_0029619 | Ga0466959_0029619_2566_3210 | 214 |
| 261 | 3300045049 | Ga0466959_0033854 | Ga0466959_0033854_310_957 | 214 |
| 262 | 3300045049 | Ga0466959_0107663 | Ga0466959_0107663_1134_1781 | 214 |
| 263 | 3300045836 | Ga0466958_0270156 | Ga0466958_0270156_293_940 | 214 |
| 264 | 3300046452 | Ga0495617_000055 | Ga0495617_000055_31668_32315 | 214 |
| 265 | 3300046453 | Ga0495627_000123 | Ga0495627_000123_62284_62931 | 214 |
| 266 | 3300046457 | Ga0495590_0166937 | Ga0495590_0166937_41_691 | 214 |
| 267 | 3300046459 | Ga0495629_0016433 | Ga0495629_0016433_3644_4291 | 214 |
| 268 | 3300046463 | Ga0495653_0046362 | Ga0495653_0046362_1533_2180 | 214 |
| 269 | 3300046473 | Ga0495582_0127194 | Ga0495582_0127194_639_1286 | 214 |
| 270 | 3300046474 | Ga0495605_0000035 | Ga0495605_0000035_133138_133785 | 214 |
| 271 | 3300046491 | Ga0495584_0000269 | Ga0495584_0000269_16807_17454 | 214 |
| 272 | 3300046491 | Ga0495584_0005974 | Ga0495584_0005974_1176_1823 | 214 |
| 273 | 3300046491 | Ga0495584_0090251 | Ga0495584_0090251_467_1114 | 214 |
| 274 | 3300046491 | Ga0495584_0263438 | Ga0495584_0263438_188_835 | 214 |
| 275 | 3300046492 | Ga0495585_0001645 | Ga0495585_0001645_675_1322 | 214 |
| 276 | 3300046492 | Ga0495585_0017999 | Ga0495585_0017999_274_921 | 214 |
| 277 | 3300046492 | Ga0495585_0034628 | Ga0495585_0034628_836_1486 | 214 |
| 278 | 3300046492 | Ga0495585_0037463 | Ga0495585_0037463_473_1123 | 214 |
| 279 | 3300046492 | Ga0495585_0043338 | Ga0495585_0043338_1817_2464 | 214 |
| 280 | 3300046492 | Ga0495585_0070487 | Ga0495585_0070487_711_1361 | 214 |
| 281 | 3300046492 | Ga0495585_0156323 | Ga0495585_0156323_22_669 | 214 |
| 282 | 3300046500 | Ga0495596_0007503 | Ga0495596_0007503_4048_4695 | 214 |
| 283 | 3300046500 | Ga0495596_0017215 | Ga0495596_0017215_188_835 | 214 |
| 284 | 3300046500 | Ga0495596_0022359 | Ga0495596_0022359_1462_2112 | 214 |
| 285 | 3300046500 | Ga0495596_0029961 | Ga0495596_0029961_265_912 | 214 |
| 286 | 3300046501 | Ga0495607_0001166 | Ga0495607_0001166_7301_7948 | 214 |
| 287 | 3300046501 | Ga0495607_0012237 | Ga0495607_0012237_1659_2306 | 214 |
| 288 | 3300046501 | Ga0495607_0088538 | Ga0495607_0088538_517_1164 | 214 |
| 289 | 3300046501 | Ga0495607_0116750 | Ga0495607_0116750_605_1255 | 214 |
| 290 | 3300046506 | Ga0495583_0000903 | Ga0495583_0000903_5197_5847 | 214 |
| 291 | 3300046506 | Ga0495583_0001133 | Ga0495583_0001133_17743_18393 | 214 |
| 292 | 3300046507 | Ga0495606_0002110 | Ga0495606_0002110_7920_8678 | 214 |
| 293 | 3300046507 | Ga0495606_0006889 | Ga0495606_0006889_3727_4374 | 214 |
| 294 | 3300046507 | Ga0495606_0047018 | Ga0495606_0047018_774_1424 | 214 |
| 295 | 3300046513 | Ga0495616_0011495 | Ga0495616_0011495_1222_1869 | 214 |
| 296 | 3300046513 | Ga0495616_0043694 | Ga0495616_0043694_761_1408 | 214 |
| 297 | 3300046516 | Ga0495628_0197955 | Ga0495628_0197955_62_709 | 214 |
| 298 | 3300046518 | Ga0495631_0006475 | Ga0495631_0006475_3699_4349 | 214 |
| 299 | 3300046518 | Ga0495631_0009245 | Ga0495631_0009245_3214_3861 | 214 |
| 300 | 3300046518 | Ga0495631_0055530 | Ga0495631_0055530_310_957 | 214 |
| 301 | 3300046519 | Ga0495632_0000236 | Ga0495632_0000236_23354_24001 | 214 |
| 302 | 3300046519 | Ga0495632_0010207 | Ga0495632_0010207_3341_3991 | 214 |
| 303 | 3300046519 | Ga0495632_0218884 | Ga0495632_0218884_191_841 | 214 |
| 304 | 3300046522 | Ga0495643_0004661 | Ga0495643_0004661_6676_7323 | 214 |
| 305 | 3300046522 | Ga0495643_0023090 | Ga0495643_0023090_2103_2750 | 214 |
| 306 | 3300046523 | Ga0495644_0015854 | Ga0495644_0015854_1659_2309 | 214 |
| 307 | 3300046523 | Ga0495644_0039529 | Ga0495644_0039529_358_1005 | 214 |
| 308 | 3300046524 | Ga0495648_0000527 | Ga0495648_0000527_8870_9517 | 214 |
| 309 | 3300046525 | Ga0495663_0005202 | Ga0495663_0005202_724_1371 | 214 |
| 310 | 3300046526 | Ga0495666_0060180 | Ga0495666_0060180_206_853 | 214 |
| 311 | 3300046526 | Ga0495666_0241371 | Ga0495666_0241371_89_736 | 214 |
| 312 | 3300046528 | Ga0495642_0000005 | Ga0495642_0000005_95286_95933 | 214 |
| 313 | 3300046528 | Ga0495642_0000174 | Ga0495642_0000174_13209_13856 | 214 |
| 314 | 3300046528 | Ga0495642_0007222 | Ga0495642_0007222_2752_3399 | 214 |
| 315 | 3300046528 | Ga0495642_0059570 | Ga0495642_0059570_627_1277 | 214 |
| 316 | 3300046531 | Ga0495665_0160109 | Ga0495665_0160109_340_1038 | 214 |
| 317 | 3300046535 | Ga0495586_0053153 | Ga0495586_0053153_362_1012 | 214 |
| 318 | 3300046535 | Ga0495586_0101643 | Ga0495586_0101643_210_857 | 214 |
| 319 | 3300046536 | Ga0495587_0047504 | Ga0495587_0047504_63_710 | 214 |
| 320 | 3300046542 | Ga0495597_0000456 | Ga0495597_0000456_29925_30575 | 214 |
| 321 | 3300046542 | Ga0495597_0011359 | Ga0495597_0011359_2893_3543 | 214 |
| 322 | 3300046557 | Ga0495622_0033222 | Ga0495622_0033222_325_1023 | 214 |
| 323 | 3300046557 | Ga0495622_0074292 | Ga0495622_0074292_804_1496 | 214 |
| 324 | 3300046557 | Ga0495622_0093130 | Ga0495622_0093130_715_1362 | 214 |
| 325 | 3300046558 | Ga0495633_0013034 | Ga0495633_0013034_3059_3709 | 214 |
| 326 | 3300046558 | Ga0495633_0073545 | Ga0495633_0073545_117_764 | 214 |
| 327 | 3300046558 | Ga0495633_0152118 | Ga0495633_0152118_267_917 | 214 |
| 328 | 3300046558 | Ga0495633_0265541 | Ga0495633_0265541_66_713 | 214 |
| 329 | 3300046615 | Ga0495656_0014217 | Ga0495656_0014217_1004_1651 | 214 |
| 330 | 3300046615 | Ga0495656_0067639 | Ga0495656_0067639_758_1420 | 214 |
| 331 | 3300046616 | Ga0495668_0003850 | Ga0495668_0003850_8240_8887 | 214 |
| 332 | 3300046616 | Ga0495668_0004835 | Ga0495668_0004835_5102_5749 | 214 |
| 333 | 3300046648 | Ga0495611_0005156 | Ga0495611_0005156_1574_2224 | 214 |
| 334 | 3300046648 | Ga0495611_0005581 | Ga0495611_0005581_4549_5199 | 214 |
| 335 | 3300046648 | Ga0495611_0075600 | Ga0495611_0075600_206_853 | 214 |
| 336 | 3300046660 | Ga0495625_0046978 | Ga0495625_0046978_578_1228 | 214 |
| 337 | 3300046663 | Ga0495635_0453283 | Ga0495635_0453283_76_726 | 214 |
| 338 | 3300046665 | Ga0495661_0001403 | Ga0495661_0001403_14918_15565 | 214 |
| 339 | 3300046665 | Ga0495661_0002211 | Ga0495661_0002211_11544_12191 | 214 |
| 340 | 3300046665 | Ga0495661_0003246 | Ga0495661_0003246_5915_6562 | 214 |
| 341 | 3300046665 | Ga0495661_0015341 | Ga0495661_0015341_764_1411 | 214 |
| 342 | 3300046665 | Ga0495661_0018291 | Ga0495661_0018291_1553_2200 | 214 |
| 343 | 3300046665 | Ga0495661_0042329 | Ga0495661_0042329_1372_2019 | 214 |
| 344 | 3300046665 | Ga0495661_0053722 | Ga0495661_0053722_396_1046 | 214 |
| 345 | 3300046665 | Ga0495661_0166614 | Ga0495661_0166614_309_959 | 214 |
| 346 | 3300046674 | Ga0495588_0034367 | Ga0495588_0034367_1546_2193 | 214 |
| 347 | 3300046674 | Ga0495588_0178136 | Ga0495588_0178136_113_805 | 214 |
| 348 | 3300046679 | Ga0495623_0013243 | Ga0495623_0013243_1745_2392 | 214 |
| 349 | 3300046679 | Ga0495623_0069013 | Ga0495623_0069013_1394_2041 | 214 |
| 350 | 3300046684 | Ga0495669_0010777 | Ga0495669_0010777_1488_2135 | 214 |
| 351 | 3300046684 | Ga0495669_0172800 | Ga0495669_0172800_79_729 | 214 |
| 352 | 3300046691 | Ga0495670_0010488 | Ga0495670_0010488_3432_4079 | 214 |
| 353 | 3300046691 | Ga0495670_0190866 | Ga0495670_0190866_240_890 | 214 |
| 354 | 3300046692 | Ga0495671_0000294 | Ga0495671_0000294_8988_9635 | 214 |
| 355 | 3300046692 | Ga0495671_0044757 | Ga0495671_0044757_1283_2047 | 214 |
| 356 | 3300046694 | Ga0495649_0255050 | Ga0495649_0255050_123_770 | 214 |
| 357 | 3300046794 | Ga0495589_0002183 | Ga0495589_0002183_5138_5785 | 214 |
| 358 | 3300046794 | Ga0495589_0061727 | Ga0495589_0061727_978_1625 | 214 |
| 359 | 3300046794 | Ga0495589_0181485 | Ga0495589_0181485_18_665 | 214 |
| 360 | 3300046809 | Ga0495600_0239498 | Ga0495600_0239498_313_960 | 214 |
| 361 | 3300046810 | Ga0495660_0007122 | Ga0495660_0007122_2045_2692 | 214 |
| 362 | 3300046810 | Ga0495660_0022472 | Ga0495660_0022472_1977_2624 | 214 |
| 363 | 3300046810 | Ga0495660_0072648 | Ga0495660_0072648_529_1179 | 214 |
| 364 | 3300047315 | Ga0495581_0070697 | Ga0495581_0070697_549_1199 | 214 |
| 365 | 3300047315 | Ga0495581_0155345 | Ga0495581_0155345_127_825 | 214 |
| 366 | 3300047317 | Ga0495604_0027495 | Ga0495604_0027495_750_1442 | 214 |
| 367 | 3300047318 | Ga0495636_0001470 | Ga0495636_0001470_6429_7076 | 214 |
| 368 | 3300047318 | Ga0495636_0159480 | Ga0495636_0159480_28_678 | 214 |
| 369 | 3300047319 | Ga0495674_0317131 | Ga0495674_0317131_182_829 | 214 |
| 370 | 3300047320 | Ga0495672_0099452 | Ga0495672_0099452_398_1048 | 214 |
| 371 | 3300047321 | Ga0495676_0078378 | Ga0495676_0078378_1509_2159 | 214 |
| 372 | 3300047322 | Ga0495680_0247980 | Ga0495680_0247980_456_1103 | 214 |
| 373 | 3300047323 | Ga0495683_0018703 | Ga0495683_0018703_196_846 | 214 |
| 374 | 3300047323 | Ga0495683_0048730 | Ga0495683_0048730_74_721 | 214 |
| 375 | 3300047443 | Ga0495687_000215 | Ga0495687_000215_33338_33985 | 214 |
| 376 | 3300047445 | Ga0495677_0000109 | Ga0495677_0000109_32152_32799 | 214 |
| 377 | 3300047445 | Ga0495677_0013665 | Ga0495677_0013665_1619_2266 | 214 |
| 378 | 3300047445 | Ga0495677_0056799 | Ga0495677_0056799_736_1386 | 214 |
| 379 | 3300047446 | Ga0495679_007882 | Ga0495679_007882_528_1175 | 214 |
| 380 | 3300047447 | Ga0495685_137303 | Ga0495685_137303_117_767 | 214 |
| 381 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_422396_423043 | 214 |
| 382 | 3300047470 | Ga0495681_0020236 | Ga0495681_0020236_1617_2267 | 214 |
| 383 | 3300047470 | Ga0495681_0020485 | Ga0495681_0020485_1015_1665 | 214 |
| 384 | 3300047470 | Ga0495681_0053813 | Ga0495681_0053813_874_1521 | 214 |
| 385 | 3300047472 | Ga0495686_0000142 | Ga0495686_0000142_43818_44465 | 214 |
| 386 | 3300047472 | Ga0495686_0006640 | Ga0495686_0006640_7447_8094 | 214 |
| 387 | 3300047472 | Ga0495686_0086030 | Ga0495686_0086030_1150_1797 | 214 |
| 388 | 3300047673 | Ga0495593_0033938 | Ga0495593_0033938_1814_2464 | 214 |
| 389 | 3300048088 | Ga0495602_0126083 | Ga0495602_0126083_595_1242 | 214 |
| 390 | 3300048089 | Ga0495614_0098752 | Ga0495614_0098752_534_1184 | 214 |
| 391 | 3300048091 | Ga0495626_0013785 | Ga0495626_0013785_1457_2107 | 214 |
| 392 | 3300048905 | Ga0496102_0000173 | Ga0496102_0000173_12128_12775 | 214 |
| 393 | 3300048905 | Ga0496102_0478709 | Ga0496102_0478709_194_841 | 214 |
| 394 | 3300048906 | Ga0496103_0016801 | Ga0496103_0016801_1663_2310 | 214 |
| 395 | 3300048912 | Ga0496109_0101966 | Ga0496109_0101966_1113_1760 | 214 |
| 396 | 3300048914 | Ga0496111_0086704 | Ga0496111_0086704_1464_2111 | 214 |
| 397 | 3300048915 | Ga0496112_0199407 | Ga0496112_0199407_445_1092 | 214 |
| 398 | 3300048916 | Ga0496113_0001294 | Ga0496113_0001294_3635_4282 | 214 |
| 399 | 3300048916 | Ga0496113_0238693 | Ga0496113_0238693_362_1009 | 214 |
| 400 | 3300048916 | Ga0496113_0694742 | Ga0496113_0694742_31_678 | 214 |
| 401 | 3300048918 | Ga0496115_0002099 | Ga0496115_0002099_1109_1756 | 214 |
| 402 | 3300048925 | Ga0496122_0002763 | Ga0496122_0002763_6992_7639 | 214 |
| 403 | 3300048925 | Ga0496122_0122443 | Ga0496122_0122443_815_1462 | 214 |
| 404 | 3300048926 | Ga0496123_0004315 | Ga0496123_0004315_11649_12401 | 214 |
| 405 | 3300048926 | Ga0496123_0024484 | Ga0496123_0024484_1776_2423 | 214 |
| 406 | 3300048927 | Ga0496124_0027915 | Ga0496124_0027915_2866_3513 | 214 |
| 407 | 3300048927 | Ga0496124_0109338 | Ga0496124_0109338_1065_1712 | 214 |
| 408 | 3300048928 | Ga0496125_0055441 | Ga0496125_0055441_335_982 | 214 |
| 409 | 3300049460 | Ga0495682_0001423 | Ga0495682_0001423_5912_6559 | 214 |
| 410 | 3300049460 | Ga0495682_0019235 | Ga0495682_0019235_421_1071 | 214 |
| 411 | 3300049571 | Ga0501034_0153494 | Ga0501034_0153494_210_857 | 214 |
| 412 | 3300049580 | Ga0501046_0086394 | Ga0501046_0086394_1384_2055 | 214 |
| 413 | 3300049581 | Ga0501047_0065616 | Ga0501047_0065616_657_1328 | 214 |
| 414 | 3300049586 | Ga0501070_0742247 | Ga0501070_0742247_97_747 | 214 |
| 415 | 3300049744 | Ga0501083_0001990 | Ga0501083_0001990_10318_10989 | 214 |
| 416 | 3300049779 | Ga0501283_051438 | Ga0501283_051438_77_721 | 214 |
| 417 | 3300050492 | nmdc:mga0yw44_403469_c1 | nmdc:mga0yw44_403469_c1_101_763 | 214 |
| 418 | 3300050515 | nmdc:mga0a205_292167_c1 | nmdc:mga0a205_292167_c1_701_1348 | 214 |
| 419 | 3300053178 | Ga0500637_0001526 | Ga0500637_0001526_7963_8610 | 214 |
| 420 | 3300061719 | Ga0466962_0047367 | Ga0466962_0047367_1338_1985 | 214 |
| 421 | 3300003203 | JGI25406J46586_10001197 | JGI25406J46586_1000119711 | 215 |
| 422 | 3300005328 | Ga0070676_10009376 | Ga0070676_100093762 | 215 |
| 423 | 3300005330 | Ga0070690_100127247 | Ga0070690_1001272472 | 215 |
| 424 | 3300005331 | Ga0070670_100094777 | Ga0070670_1000947772 | 215 |
| 425 | 3300005333 | Ga0070677_10158214 | Ga0070677_101582141 | 215 |
| 426 | 3300005334 | Ga0068869_100003195 | Ga0068869_1000031958 | 215 |
| 427 | 3300005335 | Ga0070666_10008823 | Ga0070666_100088232 | 215 |
| 428 | 3300005343 | Ga0070687_100045346 | Ga0070687_1000453463 | 215 |
| 429 | 3300005344 | Ga0070661_100002899 | Ga0070661_1000028992 | 215 |
| 430 | 3300005347 | Ga0070668_100000574 | Ga0070668_1000005749 | 215 |
| 431 | 3300005353 | Ga0070669_100000765 | Ga0070669_1000007656 | 215 |
| 432 | 3300005353 | Ga0070669_100314309 | Ga0070669_1003143092 | 215 |
| 433 | 3300005354 | Ga0070675_100049796 | Ga0070675_1000497962 | 215 |
| 434 | 3300005354 | Ga0070675_100098419 | Ga0070675_1000984194 | 215 |
| 435 | 3300005355 | Ga0070671_100431307 | Ga0070671_1004313072 | 215 |
| 436 | 3300005356 | Ga0070674_100011152 | Ga0070674_1000111524 | 215 |
| 437 | 3300005364 | Ga0070673_100050730 | Ga0070673_1000507302 | 215 |
| 438 | 3300005364 | Ga0070673_100189764 | Ga0070673_1001897641 | 215 |
| 439 | 3300005364 | Ga0070673_100283758 | Ga0070673_1002837581 | 215 |
| 440 | 3300005364 | Ga0070673_100290054 | Ga0070673_1002900542 | 215 |
| 441 | 3300005367 | Ga0070667_100007739 | Ga0070667_1000077397 | 215 |
| 442 | 3300005436 | Ga0070713_100077183 | Ga0070713_1000771832 | 215 |
| 443 | 3300005441 | Ga0070700_100006109 | Ga0070700_1000061096 | 215 |
| 444 | 3300005455 | Ga0070663_100074650 | Ga0070663_1000746503 | 215 |
| 445 | 3300005456 | Ga0070678_100015798 | Ga0070678_1000157985 | 215 |
| 446 | 3300005456 | Ga0070678_100093070 | Ga0070678_1000930702 | 215 |
| 447 | 3300005456 | Ga0070678_100314383 | Ga0070678_1003143832 | 215 |
| 448 | 3300005456 | Ga0070678_100540255 | Ga0070678_1005402552 | 215 |
| 449 | 3300005457 | Ga0070662_100000783 | Ga0070662_1000007838 | 215 |
| 450 | 3300005459 | Ga0068867_100005514 | Ga0068867_1000055146 | 215 |
| 451 | 3300005518 | Ga0070699_100020444 | Ga0070699_1000204447 | 215 |
| 452 | 3300005543 | Ga0070672_100005134 | Ga0070672_1000051346 | 215 |
| 453 | 3300005543 | Ga0070672_100133928 | Ga0070672_1001339282 | 215 |
| 454 | 3300005543 | Ga0070672_100175199 | Ga0070672_1001751991 | 215 |
| 455 | 3300005548 | Ga0070665_100461152 | Ga0070665_1004611522 | 215 |
| 456 | 3300005564 | Ga0070664_100001492 | Ga0070664_1000014928 | 215 |
| 457 | 3300005564 | Ga0070664_100213965 | Ga0070664_1002139652 | 215 |
| 458 | 3300005577 | Ga0068857_100000223 | Ga0068857_10000022321 | 215 |
| 459 | 3300005615 | Ga0070702_100497747 | Ga0070702_1004977471 | 215 |
| 460 | 3300005616 | Ga0068852_100008232 | Ga0068852_1000082327 | 215 |
| 461 | 3300005616 | Ga0068852_100287673 | Ga0068852_1002876732 | 215 |
| 462 | 3300005617 | Ga0068859_100104541 | Ga0068859_1001045412 | 215 |
| 463 | 3300005617 | Ga0068859_100275730 | Ga0068859_1002757303 | 215 |
| 464 | 3300005618 | Ga0068864_100134405 | Ga0068864_1001344052 | 215 |
| 465 | 3300005618 | Ga0068864_101357713 | Ga0068864_1013577131 | 215 |
| 466 | 3300005718 | Ga0068866_10002119 | Ga0068866_1000211910 | 215 |
| 467 | 3300005719 | Ga0068861_100004658 | Ga0068861_1000046587 | 215 |
| 468 | 3300005834 | Ga0068851_10015869 | Ga0068851_100158694 | 215 |
| 469 | 3300005840 | Ga0068870_10268516 | Ga0068870_102685162 | 215 |
| 470 | 3300005841 | Ga0068863_100001215 | Ga0068863_1000012157 | 215 |
| 471 | 3300005841 | Ga0068863_100555689 | Ga0068863_1005556892 | 215 |
| 472 | 3300005842 | Ga0068858_100011059 | Ga0068858_1000110595 | 215 |
| 473 | 3300005843 | Ga0068860_100009850 | Ga0068860_1000098506 | 215 |
| 474 | 3300005843 | Ga0068860_100434683 | Ga0068860_1004346832 | 215 |
| 475 | 3300005844 | Ga0068862_100020474 | Ga0068862_1000204745 | 215 |
| 476 | 3300005983 | Ga0081540_1010528 | Ga0081540_10105286 | 215 |
| 477 | 3300005983 | Ga0081540_1011231 | Ga0081540_10112315 | 215 |
| 478 | 3300005985 | Ga0081539_10002106 | Ga0081539_100021069 | 215 |
| 479 | 3300006237 | Ga0097621_100233119 | Ga0097621_1002331192 | 215 |
| 480 | 3300006846 | Ga0075430_100009271 | Ga0075430_1000092716 | 215 |
| 481 | 3300006847 | Ga0075431_100006662 | Ga0075431_1000066626 | 215 |
| 482 | 3300006852 | Ga0075433_10478595 | Ga0075433_104785951 | 215 |
| 483 | 3300006881 | Ga0068865_100003044 | Ga0068865_1000030446 | 215 |
| 484 | 3300006931 | Ga0097620_100104540 | Ga0097620_1001045402 | 215 |
| 485 | 3300006931 | Ga0097620_100275734 | Ga0097620_1002757343 | 215 |
| 486 | 3300009098 | Ga0105245_10087074 | Ga0105245_100870743 | 215 |
| 487 | 3300009148 | Ga0105243_10015973 | Ga0105243_100159737 | 215 |
| 488 | 3300009176 | Ga0105242_10378330 | Ga0105242_103783302 | 215 |
| 489 | 3300009177 | Ga0105248_10027004 | Ga0105248_100270046 | 215 |
| 490 | 3300009177 | Ga0105248_10477784 | Ga0105248_104777842 | 215 |
| 491 | 3300009553 | Ga0105249_10013028 | Ga0105249_100130286 | 215 |
| 492 | 3300010159 | Ga0099796_10020039 | Ga0099796_100200392 | 215 |
| 493 | 3300013105 | Ga0157369_10386620 | Ga0157369_103866202 | 215 |
| 494 | 3300013296 | Ga0157374_10012857 | Ga0157374_100128574 | 215 |
| 495 | 3300013306 | Ga0163162_10000769 | Ga0163162_1000076910 | 215 |
| 496 | 3300013307 | Ga0157372_10267770 | Ga0157372_102677702 | 215 |
| 497 | 3300013308 | Ga0157375_10004451 | Ga0157375_100044519 | 215 |
| 498 | 3300013308 | Ga0157375_10098672 | Ga0157375_100986725 | 215 |
| 499 | 3300014325 | Ga0163163_10004692 | Ga0163163_100046927 | 215 |
| 500 | 3300014325 | Ga0163163_10311894 | Ga0163163_103118941 | 215 |
| 501 | 3300014326 | Ga0157380_10004895 | Ga0157380_100048952 | 215 |
| 502 | 3300014326 | Ga0157380_10064490 | Ga0157380_100644902 | 215 |
| 503 | 3300014745 | Ga0157377_10243610 | Ga0157377_102436101 | 215 |
| 504 | 3300014968 | Ga0157379_10224998 | Ga0157379_102249982 | 215 |
| 505 | 3300015683 | Ga0183362_10002 | Ga0183362_10002238 | 215 |
| 506 | 3300017792 | Ga0163161_10002372 | Ga0163161_1000237214 | 215 |
| 507 | 3300017792 | Ga0163161_10158155 | Ga0163161_101581553 | 215 |
| 508 | 3300025315 | Ga0207697_10039525 | Ga0207697_100395253 | 215 |
| 509 | 3300025315 | Ga0207697_10110172 | Ga0207697_101101722 | 215 |
| 510 | 3300025893 | Ga0207682_10081342 | Ga0207682_100813422 | 215 |
| 511 | 3300025899 | Ga0207642_10027248 | Ga0207642_100272484 | 215 |
| 512 | 3300025907 | Ga0207645_10004020 | Ga0207645_100040207 | 215 |
| 513 | 3300025908 | Ga0207643_10247080 | Ga0207643_102470802 | 215 |
| 514 | 3300025912 | Ga0207707_10802301 | Ga0207707_108023011 | 215 |
| 515 | 3300025917 | Ga0207660_10246050 | Ga0207660_102460502 | 215 |
| 516 | 3300025918 | Ga0207662_10049144 | Ga0207662_100491444 | 215 |
| 517 | 3300025919 | Ga0207657_10132680 | Ga0207657_101326802 | 215 |
| 518 | 3300025920 | Ga0207649_10004404 | Ga0207649_100044042 | 215 |
| 519 | 3300025921 | Ga0207652_10207532 | Ga0207652_102075322 | 215 |
| 520 | 3300025921 | Ga0207652_10847863 | Ga0207652_108478631 | 215 |
| 521 | 3300025923 | Ga0207681_10000340 | Ga0207681_100003408 | 215 |
| 522 | 3300025925 | Ga0207650_10056224 | Ga0207650_100562244 | 215 |
| 523 | 3300025926 | Ga0207659_10089935 | Ga0207659_100899352 | 215 |
| 524 | 3300025927 | Ga0207687_10075001 | Ga0207687_100750013 | 215 |
| 525 | 3300025928 | Ga0207700_10101063 | Ga0207700_101010633 | 215 |
| 526 | 3300025933 | Ga0207706_10025515 | Ga0207706_100255152 | 215 |
| 527 | 3300025934 | Ga0207686_10038506 | Ga0207686_100385064 | 215 |
| 528 | 3300025935 | Ga0207709_10078676 | Ga0207709_100786763 | 215 |
| 529 | 3300025937 | Ga0207669_10005760 | Ga0207669_100057605 | 215 |
| 530 | 3300025938 | Ga0207704_10003619 | Ga0207704_100036194 | 215 |
| 531 | 3300025938 | Ga0207704_10162713 | Ga0207704_101627133 | 215 |
| 532 | 3300025940 | Ga0207691_10044292 | Ga0207691_100442922 | 215 |
| 533 | 3300025940 | Ga0207691_10085217 | Ga0207691_100852174 | 215 |
| 534 | 3300025940 | Ga0207691_10260662 | Ga0207691_102606622 | 215 |
| 535 | 3300025941 | Ga0207711_10013198 | Ga0207711_100131986 | 215 |
| 536 | 3300025942 | Ga0207689_10002255 | Ga0207689_100022554 | 215 |
| 537 | 3300025944 | Ga0207661_10577259 | Ga0207661_105772592 | 215 |
| 538 | 3300025945 | Ga0207679_10706342 | Ga0207679_107063421 | 215 |
| 539 | 3300025961 | Ga0207712_10003827 | Ga0207712_100038276 | 215 |
| 540 | 3300025972 | Ga0207668_10008601 | Ga0207668_100086012 | 215 |
| 541 | 3300025972 | Ga0207668_10645974 | Ga0207668_106459741 | 215 |
| 542 | 3300025986 | Ga0207658_10000756 | Ga0207658_100007564 | 215 |
| 543 | 3300026035 | Ga0207703_10001349 | Ga0207703_100013494 | 215 |
| 544 | 3300026041 | Ga0207639_10259996 | Ga0207639_102599962 | 215 |
| 545 | 3300026067 | Ga0207678_10036525 | Ga0207678_100365256 | 215 |
| 546 | 3300026067 | Ga0207678_10169207 | Ga0207678_101692072 | 215 |
| 547 | 3300026075 | Ga0207708_10002372 | Ga0207708_1000237215 | 215 |
| 548 | 3300026088 | Ga0207641_10005453 | Ga0207641_100054535 | 215 |
| 549 | 3300026089 | Ga0207648_10002846 | Ga0207648_100028464 | 215 |
| 550 | 3300026089 | Ga0207648_10176800 | Ga0207648_101768003 | 215 |
| 551 | 3300026095 | Ga0207676_10049440 | Ga0207676_100494403 | 215 |
| 552 | 3300026095 | Ga0207676_10348940 | Ga0207676_103489402 | 215 |
| 553 | 3300026095 | Ga0207676_10364508 | Ga0207676_103645082 | 215 |
| 554 | 3300026116 | Ga0207674_10000571 | Ga0207674_1000057128 | 215 |
| 555 | 3300026118 | Ga0207675_100003938 | Ga0207675_1000039387 | 215 |
| 556 | 3300026118 | Ga0207675_100518626 | Ga0207675_1005186262 | 215 |
| 557 | 3300026121 | Ga0207683_10035993 | Ga0207683_100359932 | 215 |
| 558 | 3300026121 | Ga0207683_10116160 | Ga0207683_101161602 | 215 |
| 559 | 3300026121 | Ga0207683_10207273 | Ga0207683_102072732 | 215 |
| 560 | 3300026121 | Ga0207683_10392242 | Ga0207683_103922422 | 215 |
| 561 | 3300026142 | Ga0207698_10005678 | Ga0207698_100056787 | 215 |
| 562 | 3300028380 | Ga0268265_10014242 | Ga0268265_100142423 | 215 |
| 563 | 3300028381 | Ga0268264_10011337 | Ga0268264_100113376 | 215 |
| 564 | 3300028563 | Ga0265319_1003521 | Ga0265319_10035218 | 215 |
| 565 | 3300028577 | Ga0265318_10000412 | Ga0265318_1000041218 | 215 |
| 566 | 3300028800 | Ga0265338_10151912 | Ga0265338_101519122 | 215 |
| 567 | 3300031235 | Ga0265330_10000345 | Ga0265330_1000034518 | 215 |
| 568 | 3300031235 | Ga0265330_10000624 | Ga0265330_1000062414 | 215 |
| 569 | 3300031238 | Ga0265332_10000406 | Ga0265332_1000040614 | 215 |
| 570 | 3300031238 | Ga0265332_10000614 | Ga0265332_1000061416 | 215 |
| 571 | 3300031239 | Ga0265328_10004041 | Ga0265328_100040413 | 215 |
| 572 | 3300031240 | Ga0265320_10000433 | Ga0265320_1000043317 | 215 |
| 573 | 3300031240 | Ga0265320_10001865 | Ga0265320_100018652 | 215 |
| 574 | 3300031240 | Ga0265320_10013162 | Ga0265320_100131622 | 215 |
| 575 | 3300031242 | Ga0265329_10007656 | Ga0265329_100076563 | 215 |
| 576 | 3300031250 | Ga0265331_10000573 | Ga0265331_1000057317 | 215 |
| 577 | 3300031250 | Ga0265331_10001570 | Ga0265331_100015703 | 215 |
| 578 | 3300031344 | Ga0265316_10005925 | Ga0265316_100059255 | 215 |
| 579 | 3300031344 | Ga0265316_10029349 | Ga0265316_100293492 | 215 |
| 580 | 3300031595 | Ga0265313_10000755 | Ga0265313_1000075517 | 215 |
| 581 | 3300031595 | Ga0265313_10036387 | Ga0265313_100363872 | 215 |
| 582 | 3300031711 | Ga0265314_10001005 | Ga0265314_1000100518 | 215 |
| 583 | 3300031711 | Ga0265314_10001934 | Ga0265314_100019343 | 215 |
| 584 | 3300031712 | Ga0265342_10002483 | Ga0265342_100024833 | 215 |
| 585 | 3300031712 | Ga0265342_10010321 | Ga0265342_100103214 | 215 |
| 586 | 3300031824 | Ga0307413_10308756 | Ga0307413_103087562 | 215 |
| 587 | 3300031901 | Ga0307406_10466191 | Ga0307406_104661912 | 215 |
| 588 | 3300031903 | Ga0307407_10147327 | Ga0307407_101473272 | 215 |
| 589 | 3300031911 | Ga0307412_10448459 | Ga0307412_104484591 | 215 |
| 590 | 3300031995 | Ga0307409_100215933 | Ga0307409_1002159332 | 215 |
| 591 | 3300032002 | Ga0307416_100219733 | Ga0307416_1002197331 | 215 |
| 592 | 3300032002 | Ga0307416_101131994 | Ga0307416_1011319941 | 215 |
| 593 | 3300032004 | Ga0307414_10491420 | Ga0307414_104914201 | 215 |
| 594 | 3300032005 | Ga0307411_10278969 | Ga0307411_102789691 | 215 |
| 595 | 3300032005 | Ga0307411_10498596 | Ga0307411_104985962 | 215 |
| 596 | 3300032126 | Ga0307415_100347096 | Ga0307415_1003470961 | 215 |
| 597 | 3300035692 | Ga0373935_0045836 | Ga0373935_0045836_1765_2439 | 215 |
| 598 | 3300037471 | Ga0395905_0014949 | Ga0395905_0014949_1374_2027 | 215 |
| 599 | 3300038443 | Ga0395901_0969797 | Ga0395901_0969797_38_688 | 215 |
| 600 | 3300039447 | Ga0436361_0561101 | Ga0436361_0561101_3264_3914 | 215 |
| 601 | 3300041453 | Ga0451797_0421985 | Ga0451797_0421985_131_790 | 215 |
| 602 | 3300041486 | Ga0451807_0601123 | Ga0451807_0601123_10_657 | 215 |
| 603 | 3300044656 | Ga0466969_0042599 | Ga0466969_0042599_539_1201 | 215 |
| 604 | 3300044673 | Ga0453683_0003988 | Ga0453683_0003988_8132_8782 | 215 |
| 605 | 3300044693 | Ga0466961_0013520 | Ga0466961_0013520_3951_4613 | 215 |
| 606 | 3300044706 | Ga0466964_0047079 | Ga0466964_0047079_734_1396 | 215 |
| 607 | 3300044719 | Ga0466971_0053378 | Ga0466971_0053378_648_1310 | 215 |
| 608 | 3300044842 | Ga0466957_0176358 | Ga0466957_0176358_673_1335 | 215 |
| 609 | 3300045049 | Ga0466959_0162681 | Ga0466959_0162681_103_765 | 215 |
| 610 | 3300045051 | Ga0451576_0016907 | Ga0451576_0016907_2484_3134 | 215 |
| 611 | 3300046500 | Ga0495596_0064843 | Ga0495596_0064843_119_781 | 215 |
| 612 | 3300046539 | Ga0495621_0094562 | Ga0495621_0094562_166_828 | 215 |
| 613 | 3300046558 | Ga0495633_0068025 | Ga0495633_0068025_326_979 | 215 |
| 614 | 3300046674 | Ga0495588_0027385 | Ga0495588_0027385_1257_1910 | 215 |
| 615 | 3300048904 | Ga0496101_0281329 | Ga0496101_0281329_214_867 | 215 |
| 616 | 3300048904 | Ga0496101_0362972 | Ga0496101_0362972_15_677 | 215 |
| 617 | 3300048905 | Ga0496102_0002646 | Ga0496102_0002646_11505_12158 | 215 |
| 618 | 3300048906 | Ga0496103_0000131 | Ga0496103_0000131_11375_12028 | 215 |
| 619 | 3300048907 | Ga0496104_0037026 | Ga0496104_0037026_2019_2672 | 215 |
| 620 | 3300048908 | Ga0496105_0001020 | Ga0496105_0001020_12018_12671 | 215 |
| 621 | 3300048910 | Ga0496107_0120691 | Ga0496107_0120691_661_1314 | 215 |
| 622 | 3300048914 | Ga0496111_0103346 | Ga0496111_0103346_1365_2018 | 215 |
| 623 | 3300048916 | Ga0496113_0180622 | Ga0496113_0180622_18_671 | 215 |
| 624 | 3300048917 | Ga0496114_0054285 | Ga0496114_0054285_2675_3328 | 215 |
| 625 | 3300048917 | Ga0496114_1030596 | Ga0496114_1030596_17_679 | 215 |
| 626 | 3300048918 | Ga0496115_0000133 | Ga0496115_0000133_56001_56654 | 215 |
| 627 | 3300048919 | Ga0496116_0005419 | Ga0496116_0005419_2831_3484 | 215 |
| 628 | 3300048920 | Ga0496117_0002127 | Ga0496117_0002127_13486_14139 | 215 |
| 629 | 3300048921 | Ga0496118_0000092 | Ga0496118_0000092_73692_74345 | 215 |
| 630 | 3300048922 | Ga0496119_0005121 | Ga0496119_0005121_8484_9137 | 215 |
| 631 | 3300048924 | Ga0496121_0005979 | Ga0496121_0005979_3520_4173 | 215 |
| 632 | 3300048926 | Ga0496123_0002753 | Ga0496123_0002753_8450_9103 | 215 |
| 633 | 3300048927 | Ga0496124_0000081 | Ga0496124_0000081_133997_134650 | 215 |
| 634 | 3300048928 | Ga0496125_0002309 | Ga0496125_0002309_13184_13837 | 215 |
| 635 | 3300048929 | Ga0496126_0000283 | Ga0496126_0000283_94770_95423 | 215 |
| 636 | 3300049576 | Ga0501040_0161456 | Ga0501040_0161456_325_972 | 215 |
| 637 | 3300049587 | Ga0501071_0067106 | Ga0501071_0067106_420_1067 | 215 |
| 638 | 3300049588 | Ga0501072_0049126 | Ga0501072_0049126_453_1100 | 215 |
| 639 | 3300049590 | Ga0501074_0091035 | Ga0501074_0091035_398_1045 | 215 |
| 640 | 3300049591 | Ga0501075_0023475 | Ga0501075_0023475_809_1456 | 215 |
| 641 | 3300049741 | Ga0501079_0188111 | Ga0501079_0188111_637_1284 | 215 |
| 642 | 3300049743 | Ga0501081_0392019 | Ga0501081_0392019_225_872 | 215 |
| 643 | 3300049824 | Ga0501045_0208587 | Ga0501045_0208587_182_829 | 215 |
| 644 | 3300050509 | nmdc:mga0qj67_4962_c1 | nmdc:mga0qj67_4962_c1_3425_4075 | 215 |
| 645 | 3300050510 | nmdc:mga06r32_4146_c1 | nmdc:mga06r32_4146_c1_1116_1766 | 215 |
| 646 | 3300050511 | nmdc:mga08y16_128079_c1 | nmdc:mga08y16_128079_c1_1039_1701 | 215 |
| 647 | 3300050514 | nmdc:mga08x19_181460_c1 | nmdc:mga08x19_181460_c1_54_707 | 215 |
| 648 | 3300050515 | nmdc:mga0a205_147214_c1 | nmdc:mga0a205_147214_c1_345_998 | 215 |
| 649 | 3300054114 | Ga0501084_0080215 | Ga0501084_0080215_1582_2229 | 215 |
| 650 | 3300060353 | Ga0501082_0039000 | Ga0501082_0039000_851_1498 | 215 |
| 651 | 3300061734 | Ga0530510_0105239 | Ga0530510_0105239_471_1118 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8782 | 1 | 214 |
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8625 | 1 | 214 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.8037 | 1 | 215 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.7912 | 1 | 215 |
| 3jtw-assembly2.cif.gz_B-3 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.7835 | 1 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8709 | 2 | 214 | 3.40.430.10 |
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8436 | 2 | 214 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8037 | 1 | 215 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7912 | 1 | 215 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7639 | 1 | 214 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239M7J6-F1-model_v4 | RibD C-terminal domain-containing protein | 0.9968 | 1 | 215 |
GO:0008703
GO:0009231 |
| AF-A0A6B9YSD1-F1-model_v4 | Dihydrofolate reductase | 0.995 | 1 | 214 |
GO:0008703
GO:0009231 |
| AF-A0A2A6JSK4-F1-model_v4 | Deaminase | 0.9948 | 1 | 213 |
GO:0008703
GO:0009231 |
| AF-A0A536U3N6-F1-model_v4 | Dihydrofolate reductase | 0.9946 | 1 | 215 |
GO:0008703
GO:0009231 |
| AF-A0A2N7SFS6-F1-model_v4 | deleted | 0.9946 | 59 | 214 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar