F472602

General Info

Members Datasets Scaffolds Average Seq Length
651 351 643 216

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10577259|Ga0207661_105772592
Length 230
Sequence VKTDVFSFAPFAEEVMSKLKISSFSISIDGFGAGPAQSLENPLGLGGTQLHEWAFATRTFQRMFGNEGGETGTDDDFAARGFENIGAWIMGRNMFGPVRGPWPDETWKGWWGNNPPYHTPVFVLSHHPRAPIVMEGGTTFEFVTAGIHAALEKATAAAQGRDIRLGGGVATIREYLQAGLVDEMHLAISPAILGSGEHLLGGIDLVKLGFRCTEHAATPKATHVILTRKR

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2738541337 Pelomonas sp. BT06 Isolate Unclassified
4 2791355260 Rhizobium sp. L9 Isolate Nodule
5 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
6 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
7 2904424332 Duganella sp. 1411 Isolate Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
351 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0.15
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0.15
Rhizoplane 3.99
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001197 3300003203 Bacteria 12210
2 rootL2_10027771 3300003322 Bacteria 7634
3 rootL2_10054306 3300003322 Bacteria 5137
4 rootL2_10091597 3300003322 Bacteria 1602
5 rootH1_10055722 3300003323 Bacteria 3585
6 Ga0065165_1002492 3300005262 Bacteria 15437
7 Ga0065165_1013808 3300005262 Bacteria 3181
8 Ga0065712_10134503 3300005290 Bacteria 1512
9 Ga0065707_10040339 3300005295 Bacteria 904
10 Ga0070658_10024394 3300005327 Bacteria 4851
11 Ga0070676_10008198 3300005328 Bacteria 5622
12 Ga0070676_10009376 3300005328 Bacteria 5290
13 Ga0070690_100127247 3300005330 Bacteria 1716
14 Ga0070690_100626752 3300005330 Bacteria 819
15 Ga0070670_100094777 3300005331 Bacteria 2567
16 Ga0070677_10158214 3300005333 Bacteria 1061
17 Ga0068869_100003195 3300005334 Bacteria 10012
18 Ga0068869_100016813 3300005334 Bacteria 4942
19 Ga0070666_10008823 3300005335 Bacteria 6268
20 Ga0070680_100281145 3300005336 Bacteria 1410
21 Ga0070660_100015927 3300005339 Bacteria 5444
22 Ga0070689_100472999 3300005340 Bacteria 1069
23 Ga0070687_100045346 3300005343 Bacteria 2245
24 Ga0070661_100002899 3300005344 Bacteria 11811
25 Ga0070661_100244263 3300005344 Bacteria 1383
26 Ga0070668_100000574 3300005347 Bacteria 24639
27 Ga0070668_100088445 3300005347 Bacteria 2439
28 Ga0070668_100108246 3300005347 Bacteria 2210
29 Ga0070669_100000765 3300005353 Bacteria 23385
30 Ga0070669_100002931 3300005353 Bacteria 12296
31 Ga0070669_100314309 3300005353 Bacteria 1264
32 Ga0070675_100002140 3300005354 Bacteria 14611
33 Ga0070675_100049796 3300005354 Bacteria 3439
34 Ga0070675_100098419 3300005354 Bacteria 2460
35 Ga0070671_100362960 3300005355 Bacteria 1237
36 Ga0070671_100431307 3300005355 Bacteria 1129
37 Ga0070674_100011152 3300005356 Bacteria 5459
38 Ga0070673_100050730 3300005364 Bacteria 3245
39 Ga0070673_100054587 3300005364 Bacteria 3143
40 Ga0070673_100189764 3300005364 Bacteria 1764
41 Ga0070673_100283758 3300005364 Bacteria 1453
42 Ga0070673_100290054 3300005364 Bacteria 1437
43 Ga0070688_100069415 3300005365 Bacteria 2250
44 Ga0070659_100043712 3300005366 Bacteria 3504
45 Ga0070659_100098610 3300005366 Bacteria 2350
46 Ga0070667_100007739 3300005367 Bacteria 8908
47 Ga0070667_100112647 3300005367 Bacteria 2360
48 Ga0070713_100077183 3300005436 Bacteria 2831
49 Ga0070701_10030817 3300005438 Bacteria 2657
50 Ga0070700_100006109 3300005441 Bacteria 6417
51 Ga0070700_100452926 3300005441 Unclassified 977
52 Ga0070694_100605285 3300005444 Bacteria 883
53 Ga0070708_100239078 3300005445 Bacteria 1705
54 Ga0070663_100046491 3300005455 Bacteria 3071
55 Ga0070663_100074650 3300005455 Bacteria 2476
56 Ga0070678_100015798 3300005456 Bacteria 4808
57 Ga0070678_100093070 3300005456 Bacteria 2317
58 Ga0070678_100314383 3300005456 Bacteria 1335
59 Ga0070678_100540255 3300005456 Bacteria 1033
60 Ga0070662_100000783 3300005457 Bacteria 19529
61 Ga0070662_100003414 3300005457 Bacteria 9901
62 Ga0070662_100114029 3300005457 Bacteria 2063
63 Ga0068867_100005514 3300005459 Bacteria 8955
64 Ga0070685_10006909 3300005466 Bacteria 5793
65 Ga0070685_10273431 3300005466 Bacteria 1128
66 Ga0070707_100154998 3300005468 Bacteria 2232
67 Ga0070699_100020444 3300005518 Bacteria 5709
68 Ga0070699_100344869 3300005518 Bacteria 1341
69 Ga0070684_100013866 3300005535 Bacteria 6511
70 Ga0070684_100112329 3300005535 Bacteria 2444
71 Ga0068853_100005136 3300005539 Bacteria 10235
72 Ga0070672_100005134 3300005543 Bacteria 8642
73 Ga0070672_100079864 3300005543 Bacteria 2619
74 Ga0070672_100133928 3300005543 Bacteria 2039
75 Ga0070672_100175199 3300005543 Bacteria 1785
76 Ga0070686_100452398 3300005544 Unclassified 987
77 Ga0070665_100461152 3300005548 Bacteria 1281
78 Ga0068855_100008710 3300005563 Bacteria 12265
79 Ga0068855_100047031 3300005563 Bacteria 5099
80 Ga0070664_100001492 3300005564 Bacteria 18638
81 Ga0070664_100213965 3300005564 Bacteria 1723
82 Ga0070664_100657232 3300005564 Bacteria 974
83 Ga0068857_100000223 3300005577 Bacteria 37628
84 Ga0068857_100016081 3300005577 Bacteria 6555
85 Ga0068856_100000233 3300005614 Bacteria 60306
86 Ga0070702_100497747 3300005615 Bacteria 894
87 Ga0068852_100001585 3300005616 Bacteria 15462
88 Ga0068852_100003813 3300005616 Bacteria 10582
89 Ga0068852_100008232 3300005616 Bacteria 7665
90 Ga0068852_100051386 3300005616 Bacteria 3537
91 Ga0068852_100055860 3300005616 Bacteria 3409
92 Ga0068852_100287673 3300005616 Bacteria 1586
93 Ga0068852_100293144 3300005616 Bacteria 1572
94 Ga0068859_100104541 3300005617 Bacteria 2891
95 Ga0068859_100275730 3300005617 Bacteria 1774
96 Ga0068864_100134405 3300005618 Bacteria 2225
97 Ga0068864_100428668 3300005618 Bacteria 1261
98 Ga0068864_101357713 3300005618 Bacteria 712
99 Ga0068866_10002119 3300005718 Bacteria 8255
100 Ga0068861_100001729 3300005719 Bacteria 14004
101 Ga0068861_100004658 3300005719 Bacteria 9211
102 Ga0068861_100053641 3300005719 Bacteria 3068
103 Ga0068851_10015869 3300005834 Bacteria 3595
104 Ga0068851_10042740 3300005834 Bacteria 2282
105 Ga0068870_10268516 3300005840 Bacteria 1065
106 Ga0068863_100001215 3300005841 Bacteria 25740
107 Ga0068863_100012982 3300005841 Bacteria 8033
108 Ga0068863_100018013 3300005841 Bacteria 6761
109 Ga0068863_100041920 3300005841 Bacteria 4350
110 Ga0068863_100555689 3300005841 Bacteria 1134
111 Ga0068858_100011059 3300005842 Bacteria 8532
112 Ga0068858_100594133 3300005842 Unclassified 1073
113 Ga0068860_100009850 3300005843 Bacteria 9480
114 Ga0068860_100434683 3300005843 Bacteria 1303
115 Ga0068862_100007098 3300005844 Bacteria 9305
116 Ga0068862_100020474 3300005844 Bacteria 5526
117 Ga0081540_1010528 3300005983 Bacteria 6250
118 Ga0081540_1011231 3300005983 Bacteria 6003
119 Ga0081539_10002106 3300005985 Bacteria 29503
120 Ga0081539_10017714 3300005985 Bacteria 4985
121 Ga0075364_10007757 3300006051 Bacteria 6392
122 Ga0075366_10014006 3300006195 Bacteria 4574
123 Ga0075366_10094432 3300006195 Bacteria 1793
124 Ga0075366_10360109 3300006195 Bacteria 893
125 Ga0097621_100233119 3300006237 Bacteria 1607
126 Ga0075370_10105980 3300006353 Bacteria 1629
127 Ga0075430_100009271 3300006846 Bacteria 8317
128 Ga0075431_100006662 3300006847 Bacteria 11473
129 Ga0075433_10136374 3300006852 Bacteria 2181
130 Ga0075433_10478595 3300006852 Bacteria 1097
131 Ga0075429_100820861 3300006880 Bacteria 814
132 Ga0068865_100003044 3300006881 Bacteria 10022
133 Ga0068865_100086587 3300006881 Bacteria 2262
134 Ga0097620_100104540 3300006931 Bacteria 2891
135 Ga0097620_100275734 3300006931 Bacteria 1774
136 Ga0105244_10194078 3300009036 Bacteria 959
137 Ga0105240_10033636 3300009093 Bacteria 6619
138 Ga0105240_10343586 3300009093 Bacteria 1695
139 Ga0105240_10697331 3300009093 Bacteria 1109
140 Ga0111539_10004167 3300009094 Bacteria 18959
141 Ga0105245_10087074 3300009098 Bacteria 2866
142 Ga0105245_11171294 3300009098 Bacteria 816
143 Ga0114129_10244340 3300009147 Bacteria 2412
144 Ga0105243_10015973 3300009148 Bacteria 5677
145 Ga0105243_10033833 3300009148 Bacteria 3953
146 Ga0105243_11065297 3300009148 Bacteria 815
147 Ga0105242_10076586 3300009176 Bacteria 2789
148 Ga0105242_10378330 3300009176 Bacteria 1315
149 Ga0105248_10027004 3300009177 Bacteria 6386
150 Ga0105248_10294006 3300009177 Bacteria 1829
151 Ga0105248_10477784 3300009177 Bacteria 1405
152 Ga0105249_10013028 3300009553 Bacteria 7338
153 Ga0099796_10020039 3300010159 Bacteria 2038
154 Ga0157373_10336949 3300013100 Bacteria 1074
155 Ga0157371_10054470 3300013102 Bacteria 2841
156 Ga0157369_10386620 3300013105 Bacteria 1452
157 Ga0157374_10012857 3300013296 Bacteria 7291
158 Ga0157374_10032897 3300013296 Bacteria 4726
159 Ga0157378_11117195 3300013297 Bacteria 826
160 Ga0163162_10000769 3300013306 Bacteria 29806
161 Ga0163162_10009068 3300013306 Bacteria 9673
162 Ga0157372_10267770 3300013307 Bacteria 1985
163 Ga0157372_10654979 3300013307 Bacteria 1223
164 Ga0157375_10004451 3300013308 Bacteria 12165
165 Ga0157375_10010853 3300013308 Bacteria 8029
166 Ga0157375_10098672 3300013308 Bacteria 2998
167 Ga0163163_10004692 3300014325 Bacteria 11702
168 Ga0163163_10311894 3300014325 Bacteria 1626
169 Ga0157380_10004895 3300014326 Bacteria 9332
170 Ga0157380_10020507 3300014326 Bacteria 4940
171 Ga0157380_10064490 3300014326 Bacteria 2941
172 Ga0157380_11087100 3300014326 Bacteria 838
173 Ga0182008_10099300 3300014497 Bacteria 1438
174 Ga0157377_10243610 3300014745 Bacteria 1162
175 Ga0157379_10042066 3300014968 Bacteria 4078
176 Ga0157379_10224998 3300014968 Bacteria 1700
177 Ga0183362_10002 3300015683 Bacteria 1432711
178 Ga0163161_10002372 3300017792 Bacteria 13495
179 Ga0163161_10094713 3300017792 Bacteria 2214
180 Ga0163161_10158155 3300017792 Bacteria 1726
181 Ga0206353_10927837 3300020082 Bacteria 2108
182 Ga0209564_1024324 3300025295 Bacteria 2073
183 Ga0207697_10039525 3300025315 Bacteria 1935
184 Ga0207697_10110172 3300025315 Bacteria 1178
185 Ga0207656_10090576 3300025321 Bacteria 1388
186 Ga0207682_10081342 3300025893 Bacteria 1389
187 Ga0207642_10027248 3300025899 Bacteria 2337
188 Ga0207688_10427838 3300025901 Bacteria 823
189 Ga0207647_10025339 3300025904 Bacteria 3899
190 Ga0207645_10001466 3300025907 Bacteria 19278
191 Ga0207645_10004020 3300025907 Bacteria 10965
192 Ga0207643_10247080 3300025908 Bacteria 1098
193 Ga0207705_10006844 3300025909 Bacteria 8424
194 Ga0207705_10008375 3300025909 Bacteria 7550
195 Ga0207707_10360714 3300025912 Bacteria 1251
196 Ga0207707_10802301 3300025912 Bacteria 784
197 Ga0207695_10106857 3300025913 Bacteria 2784
198 Ga0207663_10347038 3300025916 Bacteria 1123
199 Ga0207660_10246050 3300025917 Bacteria 1410
200 Ga0207662_10019987 3300025918 Bacteria 3817
201 Ga0207662_10049144 3300025918 Bacteria 2501
202 Ga0207657_10007757 3300025919 Bacteria 10960
203 Ga0207657_10021906 3300025919 Bacteria 6001
204 Ga0207657_10132680 3300025919 Bacteria 2040
205 Ga0207649_10004404 3300025920 Bacteria 7640
206 Ga0207652_10207532 3300025921 Bacteria 1763
207 Ga0207652_10847863 3300025921 Bacteria 809
208 Ga0207681_10000340 3300025923 Bacteria 33613
209 Ga0207681_10060318 3300025923 Bacteria 2603
210 Ga0207650_10056224 3300025925 Bacteria 2923
211 Ga0207659_10011262 3300025926 Bacteria 5646
212 Ga0207659_10089935 3300025926 Bacteria 2290
213 Ga0207687_10065552 3300025927 Bacteria 2579
214 Ga0207687_10075001 3300025927 Bacteria 2426
215 Ga0207700_10101063 3300025928 Bacteria 2300
216 Ga0207644_10144510 3300025931 Bacteria 1835
217 Ga0207690_10554807 3300025932 Bacteria 934
218 Ga0207690_10594783 3300025932 Bacteria 902
219 Ga0207706_10002793 3300025933 Bacteria 16963
220 Ga0207706_10025515 3300025933 Bacteria 5295
221 Ga0207706_10068785 3300025933 Bacteria 3115
222 Ga0207686_10003830 3300025934 Bacteria 8067
223 Ga0207686_10038506 3300025934 Bacteria 2894
224 Ga0207709_10078676 3300025935 Bacteria 2118
225 Ga0207709_10142024 3300025935 Bacteria 1651
226 Ga0207670_10144375 3300025936 Bacteria 1758
227 Ga0207669_10005760 3300025937 Bacteria 5594
228 Ga0207704_10003619 3300025938 Bacteria 7016
229 Ga0207704_10067479 3300025938 Bacteria 2250
230 Ga0207704_10162713 3300025938 Bacteria 1590
231 Ga0207691_10000481 3300025940 Bacteria 39553
232 Ga0207691_10044292 3300025940 Bacteria 4097
233 Ga0207691_10085217 3300025940 Bacteria 2836
234 Ga0207691_10260662 3300025940 Bacteria 1494
235 Ga0207711_10013198 3300025941 Bacteria 6863
236 Ga0207711_10259372 3300025941 Bacteria 1597
237 Ga0207689_10002255 3300025942 Bacteria 18068
238 Ga0207689_10027062 3300025942 Bacteria 4800
239 Ga0207661_10102718 3300025944 Bacteria 2404
240 Ga0207661_10577259 3300025944 Bacteria 1031
241 Ga0207679_10008470 3300025945 Bacteria 6550
242 Ga0207679_10044727 3300025945 Bacteria 3197
243 Ga0207679_10706342 3300025945 Bacteria 915
244 Ga0207712_10003827 3300025961 Bacteria 9501
245 Ga0207712_10007809 3300025961 Bacteria 6762
246 Ga0207668_10008601 3300025972 Bacteria 6093
247 Ga0207668_10239362 3300025972 Bacteria 1467
248 Ga0207668_10645974 3300025972 Bacteria 926
249 Ga0207658_10000756 3300025986 Bacteria 27753
250 Ga0207677_10041185 3300026023 Bacteria 3052
251 Ga0207703_10001349 3300026035 Bacteria 22464
252 Ga0207639_10259996 3300026041 Bacteria 1518
253 Ga0207639_10386896 3300026041 Bacteria 1257
254 Ga0207678_10036525 3300026067 Bacteria 4276
255 Ga0207678_10169207 3300026067 Bacteria 1866
256 Ga0207678_10285260 3300026067 Bacteria 1418
257 Ga0207708_10002372 3300026075 Bacteria 13837
258 Ga0207708_10641043 3300026075 Bacteria 903
259 Ga0207702_10000577 3300026078 Bacteria 40792
260 Ga0207702_11166354 3300026078 Bacteria 764
261 Ga0207641_10005453 3300026088 Bacteria 10853
262 Ga0207641_10009111 3300026088 Bacteria 8198
263 Ga0207641_10011616 3300026088 Bacteria 7231
264 Ga0207641_10110562 3300026088 Bacteria 2435
265 Ga0207648_10002846 3300026089 Bacteria 18315
266 Ga0207648_10176800 3300026089 Bacteria 1888
267 Ga0207676_10049440 3300026095 Bacteria 3271
268 Ga0207676_10208514 3300026095 Bacteria 1732
269 Ga0207676_10348940 3300026095 Bacteria 1368
270 Ga0207676_10364508 3300026095 Bacteria 1340
271 Ga0207674_10000571 3300026116 Bacteria 48350
272 Ga0207674_10010814 3300026116 Bacteria 10290
273 Ga0207675_100000450 3300026118 Bacteria 39881
274 Ga0207675_100003938 3300026118 Bacteria 14411
275 Ga0207675_100518626 3300026118 Bacteria 1188
276 Ga0207683_10035993 3300026121 Bacteria 4308
277 Ga0207683_10116160 3300026121 Bacteria 2399
278 Ga0207683_10207273 3300026121 Bacteria 1783
279 Ga0207683_10392242 3300026121 Bacteria 1277
280 Ga0207698_10000978 3300026142 Bacteria 16625
281 Ga0207698_10005678 3300026142 Bacteria 7726
282 Ga0207698_10019541 3300026142 Bacteria 4641
283 Ga0268265_10014242 3300028380 Bacteria 5417
284 Ga0268265_10072385 3300028380 Bacteria 2688
285 Ga0268264_10011337 3300028381 Bacteria 7365
286 Ga0268264_10125645 3300028381 Bacteria 2266
287 Ga0265319_1003521 3300028563 Bacteria 8133
288 Ga0265319_1006243 3300028563 Bacteria 5547
289 Ga0265334_10126410 3300028573 Bacteria 912
290 Ga0265318_10000412 3300028577 Bacteria 33039
291 Ga0307515_10000043 3300028794 Bacteria 304612
292 Ga0307515_10089387 3300028794 Bacteria 3879
293 Ga0265338_10151912 3300028800 Bacteria 1798
294 Ga0265330_10000345 3300031235 Bacteria 33039
295 Ga0265330_10000624 3300031235 Bacteria 22852
296 Ga0265332_10000406 3300031238 Bacteria 31160
297 Ga0265332_10000614 3300031238 Bacteria 23207
298 Ga0265332_10120583 3300031238 Bacteria 1102
299 Ga0265328_10004041 3300031239 Bacteria 6420
300 Ga0265320_10000433 3300031240 Bacteria 33039
301 Ga0265320_10001865 3300031240 Bacteria 14925
302 Ga0265320_10013162 3300031240 Bacteria 4769
303 Ga0265325_10047554 3300031241 Bacteria 2220
304 Ga0265329_10007656 3300031242 Bacteria 4157
305 Ga0265331_10000573 3300031250 Bacteria 33039
306 Ga0265331_10001570 3300031250 Bacteria 16712
307 Ga0265316_10005925 3300031344 Bacteria 11769
308 Ga0265316_10029349 3300031344 Bacteria 4524
309 Ga0265313_10000755 3300031595 Bacteria 33039
310 Ga0265313_10002098 3300031595 Bacteria 17772
311 Ga0265313_10036387 3300031595 Bacteria 2471
312 Ga0307508_10000096 3300031616 Bacteria 103730
313 Ga0316579_10185865 3300031691 Bacteria 1005
314 Ga0265314_10001005 3300031711 Bacteria 33039
315 Ga0265314_10001934 3300031711 Bacteria 22116
316 Ga0265314_10015645 3300031711 Bacteria 6014
317 Ga0265342_10002483 3300031712 Bacteria 15893
318 Ga0265342_10010321 3300031712 Bacteria 6494
319 Ga0316578_10217856 3300031728 Bacteria 1148
320 Ga0307405_10746366 3300031731 Bacteria 815
321 Ga0307413_10225434 3300031824 Bacteria 1372
322 Ga0307413_10308756 3300031824 Bacteria 1203
323 Ga0307406_10375483 3300031901 Bacteria 1119
324 Ga0307406_10466191 3300031901 Bacteria 1017
325 Ga0307407_10147327 3300031903 Bacteria 1526
326 Ga0307412_10448459 3300031911 Bacteria 1062
327 Ga0307412_10690586 3300031911 Bacteria 875
328 Ga0307409_100215933 3300031995 Bacteria 1728
329 Ga0307409_100279673 3300031995 Unclassified 1542
330 Ga0307416_100219733 3300032002 Bacteria 1821
331 Ga0307416_100342597 3300032002 Bacteria 1508
332 Ga0307416_101131994 3300032002 Bacteria 888
333 Ga0307414_10491420 3300032004 Bacteria 1084
334 Ga0307411_10260085 3300032005 Bacteria 1370
335 Ga0307411_10278969 3300032005 Bacteria 1329
336 Ga0307411_10498596 3300032005 Bacteria 1029
337 Ga0307415_100347096 3300032126 Bacteria 1248
338 Ga0373939_0249952 3300035114 Bacteria 690
339 Ga0373956_0122156 3300035119 Bacteria 1217
340 Ga0373955_0005149 3300035172 Bacteria 5848
341 Ga0373935_0045836 3300035692 Bacteria 2760
342 Ga0373925_0237970 3300037068 Bacteria 1457
343 Ga0395899_0022522 3300037312 Bacteria 4775
344 Ga0395899_0029567 3300037312 Bacteria 4121
345 Ga0395899_0367839 3300037312 Bacteria 958
346 Ga0395900_0002740 3300037418 Bacteria 19253
347 Ga0395900_0032713 3300037418 Bacteria 5348
348 Ga0395900_0062721 3300037418 Bacteria 3820
349 Ga0395900_0482881 3300037418 Bacteria 1191
350 Ga0395898_0083998 3300037466 Bacteria 3069
351 Ga0395898_0109850 3300037466 Bacteria 2643
352 Ga0395905_0014949 3300037471 Bacteria 7404
353 Ga0395905_0057275 3300037471 Bacteria 3646
354 Ga0395905_0111218 3300037471 Bacteria 2572
355 Ga0395901_0002267 3300038443 Bacteria 19632
356 Ga0395901_0130418 3300038443 Bacteria 2641
357 Ga0395901_0336351 3300038443 Bacteria 1560
358 Ga0395901_0969797 3300038443 Bacteria 828
359 Ga0436361_0106978 3300039447 Bacteria 9029
360 Ga0436361_0561101 3300039447 Bacteria 4247
361 Ga0451797_0421985 3300041453 Bacteria 1092
362 Ga0451800_0732284 3300041459 Bacteria 816
363 Ga0451807_0601123 3300041486 Bacteria 831
364 Ga0439448_0029711 3300042005 Bacteria 1731
365 Ga0439435_0096948 3300042436 Bacteria 902
366 Ga0451577_0199955 3300042876 Bacteria 1804
367 Ga0466969_0042599 3300044656 Bacteria 2265
368 Ga0466972_0000929 3300044658 Bacteria 14095
369 Ga0453683_0003988 3300044673 Bacteria 10673
370 Ga0453683_0266213 3300044673 Bacteria 1094
371 Ga0466965_0006307 3300044683 Bacteria 5373
372 Ga0466965_0006393 3300044683 Bacteria 5347
373 Ga0466966_0059651 3300044684 Bacteria 2409
374 Ga0466966_0114587 3300044684 Bacteria 1660
375 Ga0466966_0378601 3300044684 Bacteria 850
376 Ga0466961_0013520 3300044693 Bacteria 5226
377 Ga0466961_0371731 3300044693 Bacteria 869
378 Ga0466964_0001168 3300044706 Bacteria 8877
379 Ga0466964_0047079 3300044706 Bacteria 1759
380 Ga0453684_0022196 3300044712 Bacteria 9433
381 Ga0466971_0053378 3300044719 Bacteria 1821
382 Ga0466971_0175691 3300044719 Bacteria 1006
383 Ga0466970_0159370 3300044765 Bacteria 1248
384 Ga0466957_0000301 3300044842 Bacteria 24184
385 Ga0466957_0029441 3300044842 Bacteria 3274
386 Ga0466957_0147278 3300044842 Bacteria 1520
387 Ga0466957_0176358 3300044842 Bacteria 1394
388 Ga0466957_0229855 3300044842 Bacteria 1228
389 Ga0466957_0711135 3300044842 Bacteria 709
390 Ga0466960_0113618 3300044901 Bacteria 1410
391 Ga0466959_0029619 3300045049 Bacteria 4056
392 Ga0466959_0033854 3300045049 Bacteria 3779
393 Ga0466959_0107663 3300045049 Bacteria 1992
394 Ga0466959_0162681 3300045049 Bacteria 1568
395 Ga0451576_0016907 3300045051 Bacteria 8034
396 Ga0466958_0270156 3300045836 Bacteria 1089
397 Ga0466967_0442515 3300045976 Bacteria 1269
398 Ga0495617_000055 3300046452 Bacteria 102065
399 Ga0495627_000123 3300046453 Bacteria 94862
400 Ga0495590_0005483 3300046457 Bacteria 5028
401 Ga0495590_0166937 3300046457 Bacteria 801
402 Ga0495629_0016433 3300046459 Bacteria 5313
403 Ga0495638_0010532 3300046460 Bacteria 6407
404 Ga0495653_0004577 3300046463 Bacteria 11177
405 Ga0495653_0046362 3300046463 Bacteria 3366
406 Ga0495580_0022065 3300046472 Bacteria 4691
407 Ga0495582_0087705 3300046473 Bacteria 1732
408 Ga0495582_0127194 3300046473 Bacteria 1438
409 Ga0495605_0000035 3300046474 Bacteria 208069
410 Ga0495605_0000295 3300046474 Bacteria 54687
411 Ga0495584_0000269 3300046491 Bacteria 36879
412 Ga0495584_0005974 3300046491 Bacteria 6412
413 Ga0495584_0090251 3300046491 Bacteria 1545
414 Ga0495584_0263438 3300046491 Bacteria 876
415 Ga0495585_0001645 3300046492 Bacteria 17084
416 Ga0495585_0017999 3300046492 Bacteria 4076
417 Ga0495585_0034628 3300046492 Bacteria 2855
418 Ga0495585_0037463 3300046492 Bacteria 2731
419 Ga0495585_0043338 3300046492 Bacteria 2517
420 Ga0495585_0070487 3300046492 Bacteria 1906
421 Ga0495585_0156323 3300046492 Bacteria 1186
422 Ga0495594_0138356 3300046499 Bacteria 1380
423 Ga0495596_0007503 3300046500 Bacteria 4917
424 Ga0495596_0017215 3300046500 Bacteria 2996
425 Ga0495596_0022359 3300046500 Bacteria 2575
426 Ga0495596_0029961 3300046500 Bacteria 2180
427 Ga0495596_0064843 3300046500 Bacteria 1421
428 Ga0495607_0001166 3300046501 Bacteria 23766
429 Ga0495607_0003986 3300046501 Bacteria 11098
430 Ga0495607_0012237 3300046501 Bacteria 5671
431 Ga0495607_0088538 3300046501 Bacteria 1682
432 Ga0495607_0116750 3300046501 Bacteria 1407
433 Ga0495583_0000903 3300046506 Bacteria 35338
434 Ga0495583_0001133 3300046506 Bacteria 29196
435 Ga0495606_0002110 3300046507 Bacteria 24150
436 Ga0495606_0006889 3300046507 Bacteria 10351
437 Ga0495606_0009787 3300046507 Bacteria 8055
438 Ga0495606_0047018 3300046507 Bacteria 2848
439 Ga0495616_0011495 3300046513 Bacteria 5068
440 Ga0495616_0043694 3300046513 Bacteria 2276
441 Ga0495628_0197955 3300046516 Bacteria 1515
442 Ga0495630_0137322 3300046517 Bacteria 1858
443 Ga0495631_0006475 3300046518 Bacteria 6041
444 Ga0495631_0009245 3300046518 Bacteria 4931
445 Ga0495631_0055530 3300046518 Bacteria 1725
446 Ga0495631_0286979 3300046518 Bacteria 700
447 Ga0495631_0290905 3300046518 Bacteria 695
448 Ga0495632_0000236 3300046519 Bacteria 55200
449 Ga0495632_0010207 3300046519 Bacteria 5580
450 Ga0495632_0218884 3300046519 Bacteria 861
451 Ga0495643_0004661 3300046522 Bacteria 9523
452 Ga0495643_0005473 3300046522 Bacteria 8587
453 Ga0495643_0023090 3300046522 Bacteria 3540
454 Ga0495644_0015854 3300046523 Bacteria 2887
455 Ga0495644_0039529 3300046523 Bacteria 1778
456 Ga0495648_0000527 3300046524 Bacteria 41184
457 Ga0495663_0005202 3300046525 Bacteria 3622
458 Ga0495666_0060180 3300046526 Bacteria 1815
459 Ga0495666_0076299 3300046526 Bacteria 1588
460 Ga0495666_0241371 3300046526 Bacteria 824
461 Ga0495642_0000005 3300046528 Bacteria 176726
462 Ga0495642_0000174 3300046528 Bacteria 37880
463 Ga0495642_0007222 3300046528 Bacteria 4263
464 Ga0495642_0059570 3300046528 Bacteria 1582
465 Ga0495652_0007357 3300046529 Bacteria 10153
466 Ga0495665_0002419 3300046531 Bacteria 10086
467 Ga0495665_0160109 3300046531 Bacteria 1173
468 Ga0495586_0053153 3300046535 Bacteria 2194
469 Ga0495586_0101643 3300046535 Bacteria 1595
470 Ga0495587_0012772 3300046536 Bacteria 5283
471 Ga0495587_0047504 3300046536 Bacteria 2544
472 Ga0495587_0298236 3300046536 Unclassified 902
473 Ga0495621_0094562 3300046539 Bacteria 1130
474 Ga0495597_0000456 3300046542 Bacteria 34898
475 Ga0495597_0011359 3300046542 Bacteria 4320
476 Ga0495597_0031190 3300046542 Bacteria 2427
477 Ga0495597_0147443 3300046542 Bacteria 967
478 Ga0495622_0033222 3300046557 Bacteria 2409
479 Ga0495622_0039083 3300046557 Bacteria 2209
480 Ga0495622_0074292 3300046557 Bacteria 1568
481 Ga0495622_0093130 3300046557 Bacteria 1383
482 Ga0495633_0013034 3300046558 Bacteria 4397
483 Ga0495633_0068025 3300046558 Bacteria 1663
484 Ga0495633_0073545 3300046558 Bacteria 1593
485 Ga0495633_0152118 3300046558 Bacteria 1068
486 Ga0495633_0265541 3300046558 Bacteria 782
487 Ga0495656_0014217 3300046615 Bacteria 2980
488 Ga0495656_0067639 3300046615 Bacteria 1577
489 Ga0495668_0003850 3300046616 Bacteria 10985
490 Ga0495668_0004835 3300046616 Bacteria 9371
491 Ga0495611_0005156 3300046648 Bacteria 5600
492 Ga0495611_0005581 3300046648 Bacteria 5367
493 Ga0495611_0075600 3300046648 Bacteria 1543
494 Ga0495625_0046978 3300046660 Bacteria 3113
495 Ga0495635_0453283 3300046663 Bacteria 848
496 Ga0495661_0001403 3300046665 Bacteria 20212
497 Ga0495661_0002211 3300046665 Bacteria 15176
498 Ga0495661_0003246 3300046665 Bacteria 12115
499 Ga0495661_0015341 3300046665 Bacteria 5114
500 Ga0495661_0018291 3300046665 Bacteria 4612
501 Ga0495661_0029067 3300046665 Bacteria 3531
502 Ga0495661_0042329 3300046665 Bacteria 2808
503 Ga0495661_0053722 3300046665 Bacteria 2421
504 Ga0495661_0166614 3300046665 Bacteria 1178
505 Ga0495588_0000174 3300046674 Bacteria 81329
506 Ga0495588_0027385 3300046674 Bacteria 2848
507 Ga0495588_0034367 3300046674 Bacteria 2565
508 Ga0495588_0178136 3300046674 Bacteria 1123
509 Ga0495623_0013243 3300046679 Bacteria 5349
510 Ga0495623_0021712 3300046679 Bacteria 4146
511 Ga0495623_0069013 3300046679 Bacteria 2203
512 Ga0495669_0010777 3300046684 Bacteria 3869
513 Ga0495669_0172800 3300046684 Bacteria 1028
514 Ga0495670_0010488 3300046691 Bacteria 4552
515 Ga0495670_0190866 3300046691 Bacteria 1083
516 Ga0495671_0000294 3300046692 Bacteria 41764
517 Ga0495671_0044757 3300046692 Bacteria 2218
518 Ga0495649_0255050 3300046694 Bacteria 900
519 Ga0495589_0000161 3300046794 Bacteria 62057
520 Ga0495589_0002183 3300046794 Bacteria 11015
521 Ga0495589_0061727 3300046794 Bacteria 1839
522 Ga0495589_0181485 3300046794 Bacteria 998
523 Ga0495600_0218517 3300046809 Bacteria 1219
524 Ga0495600_0239498 3300046809 Bacteria 1156
525 Ga0495660_0000157 3300046810 Bacteria 73772
526 Ga0495660_0007122 3300046810 Bacteria 6589
527 Ga0495660_0022472 3300046810 Bacteria 3602
528 Ga0495660_0072648 3300046810 Bacteria 1821
529 Ga0495581_0070697 3300047315 Bacteria 2019
530 Ga0495581_0155345 3300047315 Bacteria 1337
531 Ga0495604_0013177 3300047317 Bacteria 6583
532 Ga0495604_0027495 3300047317 Bacteria 4523
533 Ga0495636_0001470 3300047318 Bacteria 8916
534 Ga0495636_0159480 3300047318 Unclassified 1016
535 Ga0495674_0317131 3300047319 Bacteria 1271
536 Ga0495672_0001930 3300047320 Bacteria 19604
537 Ga0495672_0099452 3300047320 Bacteria 1581
538 Ga0495676_0078378 3300047321 Bacteria 2516
539 Ga0495680_0247980 3300047322 Bacteria 1263
540 Ga0495683_0018703 3300047323 Bacteria 3580
541 Ga0495683_0024581 3300047323 Bacteria 3091
542 Ga0495683_0048730 3300047323 Bacteria 2123
543 Ga0495687_000215 3300047443 Bacteria 82752
544 Ga0495687_000298 3300047443 Bacteria 65591
545 Ga0495675_0002719 3300047444 Bacteria 10601
546 Ga0495677_0000109 3300047445 Bacteria 41192
547 Ga0495677_0002072 3300047445 Bacteria 7988
548 Ga0495677_0013665 3300047445 Bacteria 2955
549 Ga0495677_0056799 3300047445 Bacteria 1446
550 Ga0495679_007882 3300047446 Bacteria 4386
551 Ga0495685_137303 3300047447 Unclassified 797
552 Ga0495673_0000003 3300047469 Bacteria 1491337
553 Ga0495681_0020236 3300047470 Bacteria 3614
554 Ga0495681_0020485 3300047470 Bacteria 3588
555 Ga0495681_0053813 3300047470 Bacteria 1883
556 Ga0495686_0000142 3300047472 Bacteria 143655
557 Ga0495686_0006640 3300047472 Bacteria 8812
558 Ga0495686_0086030 3300047472 Bacteria 1913
559 Ga0495593_0033938 3300047673 Bacteria 2777
560 Ga0495602_0126083 3300048088 Bacteria 2051
561 Ga0495614_0098752 3300048089 Bacteria 1275
562 Ga0495626_0000016 3300048091 Bacteria 232214
563 Ga0495626_0013785 3300048091 Bacteria 4192
564 Ga0496101_0281329 3300048904 Bacteria 1300
565 Ga0496101_0362972 3300048904 Bacteria 1139
566 Ga0496102_0000173 3300048905 Bacteria 87737
567 Ga0496102_0002646 3300048905 Bacteria 15218
568 Ga0496102_0478709 3300048905 Bacteria 1166
569 Ga0496103_0000131 3300048906 Bacteria 79787
570 Ga0496103_0016801 3300048906 Bacteria 4370
571 Ga0496104_0037026 3300048907 Bacteria 4563
572 Ga0496105_0001020 3300048908 Bacteria 19340
573 Ga0496105_0105614 3300048908 Bacteria 2325
574 Ga0496107_0120691 3300048910 Bacteria 1931
575 Ga0496109_0101966 3300048912 Bacteria 2664
576 Ga0496111_0086704 3300048914 Bacteria 2291
577 Ga0496111_0103346 3300048914 Bacteria 2095
578 Ga0496112_0199407 3300048915 Bacteria 1961
579 Ga0496113_0001294 3300048916 Bacteria 13820
580 Ga0496113_0180622 3300048916 Bacteria 1673
581 Ga0496113_0238693 3300048916 Bacteria 1450
582 Ga0496113_0694742 3300048916 Bacteria 812
583 Ga0496114_0054285 3300048917 Bacteria 3342
584 Ga0496114_1030596 3300048917 Bacteria 707
585 Ga0496115_0000133 3300048918 Bacteria 67951
586 Ga0496115_0002099 3300048918 Bacteria 14267
587 Ga0496116_0005419 3300048919 Bacteria 11859
588 Ga0496117_0002127 3300048920 Bacteria 25909
589 Ga0496118_0000092 3300048921 Bacteria 169106
590 Ga0496119_0005121 3300048922 Bacteria 12704
591 Ga0496121_0005979 3300048924 Bacteria 15374
592 Ga0496122_0002763 3300048925 Bacteria 24229
593 Ga0496122_0122443 3300048925 Bacteria 1673
594 Ga0496123_0002753 3300048926 Bacteria 21034
595 Ga0496123_0004315 3300048926 Bacteria 15093
596 Ga0496123_0024484 3300048926 Bacteria 4586
597 Ga0496124_0000081 3300048927 Bacteria 208413
598 Ga0496124_0027915 3300048927 Bacteria 5055
599 Ga0496124_0109338 3300048927 Bacteria 2228
600 Ga0496125_0002309 3300048928 Bacteria 25170
601 Ga0496125_0055441 3300048928 Bacteria 3229
602 Ga0496126_0000283 3300048929 Bacteria 107129
603 Ga0495678_052232 3300049459 Bacteria 1575
604 Ga0495682_0001423 3300049460 Bacteria 12956
605 Ga0495682_0019235 3300049460 Bacteria 2569
606 Ga0501031_0158274 3300049568 Bacteria 1480
607 Ga0501034_0153494 3300049571 Bacteria 2278
608 Ga0501037_0008162 3300049573 Bacteria 7675
609 Ga0501040_0161456 3300049576 Bacteria 1584
610 Ga0501042_0229728 3300049578 Bacteria 1338
611 Ga0501046_0086394 3300049580 Bacteria 2418
612 Ga0501047_0065616 3300049581 Bacteria 3499
613 Ga0501070_0742247 3300049586 Bacteria 774
614 Ga0501071_0067106 3300049587 Bacteria 2608
615 Ga0501072_0049126 3300049588 Bacteria 3321
616 Ga0501074_0091035 3300049590 Bacteria 2184
617 Ga0501075_0023475 3300049591 Bacteria 4517
618 Ga0501222_006383 3300049662 Bacteria 1585
619 Ga0501079_0188111 3300049741 Bacteria 1611
620 Ga0501081_0392019 3300049743 Bacteria 1027
621 Ga0501083_0001990 3300049744 Bacteria 14063
622 Ga0501283_051438 3300049779 Bacteria 731
623 Ga0501035_0265361 3300049822 Bacteria 1454
624 Ga0501044_0185662 3300049823 Bacteria 2044
625 Ga0501045_0017114 3300049824 Bacteria 5147
626 Ga0501045_0208587 3300049824 Bacteria 1455
627 nmdc:mga0yw44_403469_c1 3300050492 Bacteria 924
628 nmdc:mga0k408_143932_c1 3300050493 Bacteria 1419
629 nmdc:mga0qj67_4962_c1 3300050509 Bacteria 9670
630 nmdc:mga06r32_4146_c1 3300050510 Bacteria 12977
631 nmdc:mga08y16_128079_c1 3300050511 Bacteria 2640
632 nmdc:mga08x19_181460_c1 3300050514 Bacteria 1437
633 nmdc:mga0a205_147214_c1 3300050515 Bacteria 2255
634 nmdc:mga0a205_292167_c1 3300050515 Bacteria 1504
635 Ga0500641_0150984 3300053096 Bacteria 1003
636 Ga0500658_0118260 3300053134 Bacteria 1173
637 Ga0500577_0038633 3300053142 Bacteria 1725
638 Ga0500637_0001526 3300053178 Bacteria 9882
639 Ga0501084_0080215 3300054114 Bacteria 2736
640 Ga0501082_0004352 3300060353 Bacteria 12381
641 Ga0501082_0039000 3300060353 Bacteria 4097
642 Ga0466962_0047367 3300061719 Bacteria 2054
643 Ga0530510_0105239 3300061734 Bacteria 2065

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042436 Ga0439435_0096948 Ga0439435_0096948_144_752 201
2 3300009147 Ga0114129_10244340 Ga0114129_102443402 204
3 3300042005 Ga0439448_0029711 Ga0439448_0029711_1085_1702 204
4 3300046457 Ga0495590_0005483 Ga0495590_0005483_821_1438 204
5 3300046474 Ga0495605_0000295 Ga0495605_0000295_53515_54132 204
6 3300046501 Ga0495607_0003986 Ga0495607_0003986_4647_5264 204
7 3300046518 Ga0495631_0286979 Ga0495631_0286979_31_648 204
8 3300046518 Ga0495631_0290905 Ga0495631_0290905_39_656 204
9 3300046522 Ga0495643_0005473 Ga0495643_0005473_3324_3941 204
10 3300046536 Ga0495587_0298236 Ga0495587_0298236_237_854 204
11 3300046542 Ga0495597_0031190 Ga0495597_0031190_1792_2409 204
12 3300046542 Ga0495597_0147443 Ga0495597_0147443_28_645 204
13 3300046665 Ga0495661_0029067 Ga0495661_0029067_684_1301 204
14 3300046674 Ga0495588_0000174 Ga0495588_0000174_14160_14777 204
15 3300046794 Ga0495589_0000161 Ga0495589_0000161_53515_54132 204
16 3300046810 Ga0495660_0000157 Ga0495660_0000157_14839_15456 204
17 3300047320 Ga0495672_0001930 Ga0495672_0001930_3174_3791 204
18 3300047323 Ga0495683_0024581 Ga0495683_0024581_1185_1802 204
19 3300047443 Ga0495687_000298 Ga0495687_000298_46709_47326 204
20 3300047445 Ga0495677_0002072 Ga0495677_0002072_2013_2630 204
21 3300048091 Ga0495626_0000016 Ga0495626_0000016_193221_193838 204
22 3300049459 Ga0495678_052232 Ga0495678_052232_530_1147 204
23 3300049662 Ga0501222_006383 Ga0501222_006383_357_974 204
24 3300025912 Ga0207707_10360714 Ga0207707_103607142 208
25 iso_pu_bacteria 2738541337 2739056719 209
26 iso_pu_bacteria 2791355260 2793323047 209
27 iso_pu_bacteria 2839993093 2839995432 209
28 3300046507 Ga0495606_0009787 Ga0495606_0009787_898_1530 210
29 iso_pu_bacteria 2643221556 2643802205 210
30 iso_pu_bacteria 2643221684 2644475713 210
31 iso_pu_bacteria 2808606418 2809143030 210
32 iso_pu_bacteria 2904424332 2904428217 210
33 iso_pu_bacteria 8047673197 8047673937 210
34 3300005614 Ga0068856_100000233 Ga0068856_10000023345 212
35 3300005618 Ga0068864_100428668 Ga0068864_1004286682 212
36 3300005841 Ga0068863_100012982 Ga0068863_1000129825 212
37 3300009093 Ga0105240_10033636 Ga0105240_100336366 212
38 3300025913 Ga0207695_10106857 Ga0207695_101068572 212
39 3300026078 Ga0207702_10000577 Ga0207702_100005771 212
40 3300026088 Ga0207641_10009111 Ga0207641_100091115 212
41 3300026095 Ga0207676_10208514 Ga0207676_102085142 212
42 3300028794 Ga0307515_10000043 Ga0307515_1000004358 212
43 3300039447 Ga0436361_0106978 Ga0436361_0106978_1830_2471 212
44 3300048908 Ga0496105_0105614 Ga0496105_0105614_1465_2106 212
45 3300005290 Ga0065712_10134503 Ga0065712_101345032 213
46 3300005336 Ga0070680_100281145 Ga0070680_1002811452 213
47 3300005445 Ga0070708_100239078 Ga0070708_1002390782 213
48 3300005518 Ga0070699_100344869 Ga0070699_1003448691 213
49 3300005616 Ga0068852_100001585 Ga0068852_10000158516 213
50 3300005985 Ga0081539_10017714 Ga0081539_100177146 213
51 3300006195 Ga0075366_10094432 Ga0075366_100944321 213
52 3300006353 Ga0075370_10105980 Ga0075370_101059802 213
53 3300025916 Ga0207663_10347038 Ga0207663_103470381 213
54 3300026142 Ga0207698_10000978 Ga0207698_100009786 213
55 3300028573 Ga0265334_10126410 Ga0265334_101264102 213
56 3300031241 Ga0265325_10047554 Ga0265325_100475542 213
57 3300035114 Ga0373939_0249952 Ga0373939_0249952_10_654 213
58 3300037471 Ga0395905_0057275 Ga0395905_0057275_660_1301 213
59 3300044693 Ga0466961_0371731 Ga0466961_0371731_215_859 213
60 3300044712 Ga0453684_0022196 Ga0453684_0022196_7715_8368 213
61 3300045976 Ga0466967_0442515 Ga0466967_0442515_595_1239 213
62 3300046460 Ga0495638_0010532 Ga0495638_0010532_5354_5998 213
63 3300046463 Ga0495653_0004577 Ga0495653_0004577_1753_2397 213
64 3300046472 Ga0495580_0022065 Ga0495580_0022065_568_1212 213
65 3300046473 Ga0495582_0087705 Ga0495582_0087705_1048_1692 213
66 3300046499 Ga0495594_0138356 Ga0495594_0138356_158_802 213
67 3300046517 Ga0495630_0137322 Ga0495630_0137322_648_1292 213
68 3300046526 Ga0495666_0076299 Ga0495666_0076299_270_914 213
69 3300046529 Ga0495652_0007357 Ga0495652_0007357_5695_6339 213
70 3300046531 Ga0495665_0002419 Ga0495665_0002419_2953_3597 213
71 3300046536 Ga0495587_0012772 Ga0495587_0012772_3884_4528 213
72 3300046557 Ga0495622_0039083 Ga0495622_0039083_726_1370 213
73 3300046679 Ga0495623_0021712 Ga0495623_0021712_2527_3171 213
74 3300046809 Ga0495600_0218517 Ga0495600_0218517_529_1173 213
75 3300047317 Ga0495604_0013177 Ga0495604_0013177_4407_5051 213
76 3300047444 Ga0495675_0002719 Ga0495675_0002719_8282_8926 213
77 3300049568 Ga0501031_0158274 Ga0501031_0158274_452_1096 213
78 3300049573 Ga0501037_0008162 Ga0501037_0008162_581_1225 213
79 3300049578 Ga0501042_0229728 Ga0501042_0229728_120_764 213
80 3300049822 Ga0501035_0265361 Ga0501035_0265361_414_1058 213
81 3300049823 Ga0501044_0185662 Ga0501044_0185662_417_1061 213
82 3300049824 Ga0501045_0017114 Ga0501045_0017114_1471_2115 213
83 3300050493 nmdc:mga0k408_143932_c1 nmdc:mga0k408_143932_c1_95_748 213
84 3300053096 Ga0500641_0150984 Ga0500641_0150984_62_706 213
85 3300053134 Ga0500658_0118260 Ga0500658_0118260_74_718 213
86 3300053142 Ga0500577_0038633 Ga0500577_0038633_728_1426 213
87 3300060353 Ga0501082_0004352 Ga0501082_0004352_5238_5882 213
88 3300003322 rootL2_10027771 rootL2_100277717 214
89 3300003322 rootL2_10054306 rootL2_100543063 214
90 3300003322 rootL2_10091597 rootL2_100915971 214
91 3300003323 rootH1_10055722 rootH1_100557222 214
92 3300005262 Ga0065165_1002492 Ga0065165_100249211 214
93 3300005262 Ga0065165_1013808 Ga0065165_10138083 214
94 3300005295 Ga0065707_10040339 Ga0065707_100403391 214
95 3300005327 Ga0070658_10024394 Ga0070658_100243944 214
96 3300005328 Ga0070676_10008198 Ga0070676_100081982 214
97 3300005330 Ga0070690_100626752 Ga0070690_1006267521 214
98 3300005334 Ga0068869_100016813 Ga0068869_1000168135 214
99 3300005339 Ga0070660_100015927 Ga0070660_1000159274 214
100 3300005340 Ga0070689_100472999 Ga0070689_1004729992 214
101 3300005344 Ga0070661_100244263 Ga0070661_1002442632 214
102 3300005347 Ga0070668_100088445 Ga0070668_1000884453 214
103 3300005347 Ga0070668_100108246 Ga0070668_1001082463 214
104 3300005353 Ga0070669_100002931 Ga0070669_1000029313 214
105 3300005354 Ga0070675_100002140 Ga0070675_1000021404 214
106 3300005355 Ga0070671_100362960 Ga0070671_1003629601 214
107 3300005364 Ga0070673_100054587 Ga0070673_1000545873 214
108 3300005365 Ga0070688_100069415 Ga0070688_1000694151 214
109 3300005366 Ga0070659_100043712 Ga0070659_1000437122 214
110 3300005366 Ga0070659_100098610 Ga0070659_1000986103 214
111 3300005367 Ga0070667_100112647 Ga0070667_1001126473 214
112 3300005438 Ga0070701_10030817 Ga0070701_100308174 214
113 3300005441 Ga0070700_100452926 Ga0070700_1004529261 214
114 3300005444 Ga0070694_100605285 Ga0070694_1006052851 214
115 3300005455 Ga0070663_100046491 Ga0070663_1000464914 214
116 3300005457 Ga0070662_100003414 Ga0070662_1000034144 214
117 3300005457 Ga0070662_100114029 Ga0070662_1001140293 214
118 3300005466 Ga0070685_10006909 Ga0070685_100069093 214
119 3300005466 Ga0070685_10273431 Ga0070685_102734312 214
120 3300005468 Ga0070707_100154998 Ga0070707_1001549981 214
121 3300005535 Ga0070684_100013866 Ga0070684_1000138665 214
122 3300005535 Ga0070684_100112329 Ga0070684_1001123291 214
123 3300005539 Ga0068853_100005136 Ga0068853_1000051363 214
124 3300005543 Ga0070672_100079864 Ga0070672_1000798641 214
125 3300005544 Ga0070686_100452398 Ga0070686_1004523981 214
126 3300005563 Ga0068855_100008710 Ga0068855_1000087108 214
127 3300005563 Ga0068855_100047031 Ga0068855_1000470311 214
128 3300005564 Ga0070664_100657232 Ga0070664_1006572322 214
129 3300005577 Ga0068857_100016081 Ga0068857_1000160813 214
130 3300005616 Ga0068852_100003813 Ga0068852_1000038136 214
131 3300005616 Ga0068852_100051386 Ga0068852_1000513863 214
132 3300005616 Ga0068852_100055860 Ga0068852_1000558604 214
133 3300005616 Ga0068852_100293144 Ga0068852_1002931442 214
134 3300005719 Ga0068861_100001729 Ga0068861_1000017294 214
135 3300005719 Ga0068861_100053641 Ga0068861_1000536411 214
136 3300005834 Ga0068851_10042740 Ga0068851_100427403 214
137 3300005841 Ga0068863_100018013 Ga0068863_1000180137 214
138 3300005841 Ga0068863_100041920 Ga0068863_1000419203 214
139 3300005842 Ga0068858_100594133 Ga0068858_1005941332 214
140 3300005844 Ga0068862_100007098 Ga0068862_1000070985 214
141 3300006051 Ga0075364_10007757 Ga0075364_100077577 214
142 3300006195 Ga0075366_10014006 Ga0075366_100140062 214
143 3300006195 Ga0075366_10360109 Ga0075366_103601092 214
144 3300006852 Ga0075433_10136374 Ga0075433_101363743 214
145 3300006880 Ga0075429_100820861 Ga0075429_1008208612 214
146 3300006881 Ga0068865_100086587 Ga0068865_1000865871 214
147 3300009036 Ga0105244_10194078 Ga0105244_101940782 214
148 3300009093 Ga0105240_10343586 Ga0105240_103435863 214
149 3300009093 Ga0105240_10697331 Ga0105240_106973312 214
150 3300009094 Ga0111539_10004167 Ga0111539_1000416717 214
151 3300009098 Ga0105245_11171294 Ga0105245_111712941 214
152 3300009148 Ga0105243_10033833 Ga0105243_100338332 214
153 3300009148 Ga0105243_11065297 Ga0105243_110652971 214
154 3300009176 Ga0105242_10076586 Ga0105242_100765861 214
155 3300009177 Ga0105248_10294006 Ga0105248_102940062 214
156 3300013100 Ga0157373_10336949 Ga0157373_103369492 214
157 3300013102 Ga0157371_10054470 Ga0157371_100544702 214
158 3300013296 Ga0157374_10032897 Ga0157374_100328973 214
159 3300013297 Ga0157378_11117195 Ga0157378_111171951 214
160 3300013306 Ga0163162_10009068 Ga0163162_100090686 214
161 3300013307 Ga0157372_10654979 Ga0157372_106549791 214
162 3300013308 Ga0157375_10010853 Ga0157375_100108536 214
163 3300014326 Ga0157380_10020507 Ga0157380_100205072 214
164 3300014326 Ga0157380_11087100 Ga0157380_110871001 214
165 3300014497 Ga0182008_10099300 Ga0182008_100993002 214
166 3300014968 Ga0157379_10042066 Ga0157379_100420661 214
167 3300017792 Ga0163161_10094713 Ga0163161_100947133 214
168 3300020082 Ga0206353_10927837 Ga0206353_109278371 214
169 3300025295 Ga0209564_1024324 Ga0209564_10243242 214
170 3300025321 Ga0207656_10090576 Ga0207656_100905762 214
171 3300025901 Ga0207688_10427838 Ga0207688_104278381 214
172 3300025904 Ga0207647_10025339 Ga0207647_100253392 214
173 3300025907 Ga0207645_10001466 Ga0207645_100014663 214
174 3300025909 Ga0207705_10006844 Ga0207705_100068445 214
175 3300025909 Ga0207705_10008375 Ga0207705_100083754 214
176 3300025918 Ga0207662_10019987 Ga0207662_100199873 214
177 3300025919 Ga0207657_10007757 Ga0207657_100077578 214
178 3300025919 Ga0207657_10021906 Ga0207657_100219064 214
179 3300025923 Ga0207681_10060318 Ga0207681_100603184 214
180 3300025926 Ga0207659_10011262 Ga0207659_100112623 214
181 3300025927 Ga0207687_10065552 Ga0207687_100655521 214
182 3300025931 Ga0207644_10144510 Ga0207644_101445102 214
183 3300025932 Ga0207690_10554807 Ga0207690_105548072 214
184 3300025932 Ga0207690_10594783 Ga0207690_105947831 214
185 3300025933 Ga0207706_10002793 Ga0207706_1000279311 214
186 3300025933 Ga0207706_10068785 Ga0207706_100687853 214
187 3300025934 Ga0207686_10003830 Ga0207686_100038302 214
188 3300025935 Ga0207709_10142024 Ga0207709_101420241 214
189 3300025936 Ga0207670_10144375 Ga0207670_101443752 214
190 3300025938 Ga0207704_10067479 Ga0207704_100674791 214
191 3300025940 Ga0207691_10000481 Ga0207691_1000048124 214
192 3300025941 Ga0207711_10259372 Ga0207711_102593722 214
193 3300025942 Ga0207689_10027062 Ga0207689_100270621 214
194 3300025944 Ga0207661_10102718 Ga0207661_101027182 214
195 3300025945 Ga0207679_10008470 Ga0207679_100084706 214
196 3300025945 Ga0207679_10044727 Ga0207679_100447271 214
197 3300025961 Ga0207712_10007809 Ga0207712_100078094 214
198 3300025972 Ga0207668_10239362 Ga0207668_102393622 214
199 3300026023 Ga0207677_10041185 Ga0207677_100411851 214
200 3300026041 Ga0207639_10386896 Ga0207639_103868961 214
201 3300026067 Ga0207678_10285260 Ga0207678_102852601 214
202 3300026075 Ga0207708_10641043 Ga0207708_106410431 214
203 3300026078 Ga0207702_11166354 Ga0207702_111663541 214
204 3300026088 Ga0207641_10011616 Ga0207641_100116162 214
205 3300026088 Ga0207641_10110562 Ga0207641_101105623 214
206 3300026116 Ga0207674_10010814 Ga0207674_100108142 214
207 3300026118 Ga0207675_100000450 Ga0207675_10000045021 214
208 3300026142 Ga0207698_10019541 Ga0207698_100195413 214
209 3300028380 Ga0268265_10072385 Ga0268265_100723851 214
210 3300028381 Ga0268264_10125645 Ga0268264_101256453 214
211 3300028563 Ga0265319_1006243 Ga0265319_10062433 214
212 3300028794 Ga0307515_10089387 Ga0307515_100893873 214
213 3300031238 Ga0265332_10120583 Ga0265332_101205831 214
214 3300031595 Ga0265313_10002098 Ga0265313_1000209811 214
215 3300031616 Ga0307508_10000096 Ga0307508_1000009643 214
216 3300031691 Ga0316579_10185865 Ga0316579_101858651 214
217 3300031711 Ga0265314_10015645 Ga0265314_100156453 214
218 3300031728 Ga0316578_10217856 Ga0316578_102178562 214
219 3300031731 Ga0307405_10746366 Ga0307405_107463661 214
220 3300031824 Ga0307413_10225434 Ga0307413_102254342 214
221 3300031901 Ga0307406_10375483 Ga0307406_103754832 214
222 3300031911 Ga0307412_10690586 Ga0307412_106905862 214
223 3300031995 Ga0307409_100279673 Ga0307409_1002796732 214
224 3300032002 Ga0307416_100342597 Ga0307416_1003425972 214
225 3300032005 Ga0307411_10260085 Ga0307411_102600852 214
226 3300035119 Ga0373956_0122156 Ga0373956_0122156_519_1166 214
227 3300035172 Ga0373955_0005149 Ga0373955_0005149_2170_2817 214
228 3300037068 Ga0373925_0237970 Ga0373925_0237970_45_692 214
229 3300037312 Ga0395899_0022522 Ga0395899_0022522_2174_2821 214
230 3300037312 Ga0395899_0029567 Ga0395899_0029567_2064_2711 214
231 3300037312 Ga0395899_0367839 Ga0395899_0367839_185_832 214
232 3300037418 Ga0395900_0002740 Ga0395900_0002740_11717_12364 214
233 3300037418 Ga0395900_0032713 Ga0395900_0032713_3291_3938 214
234 3300037418 Ga0395900_0062721 Ga0395900_0062721_2829_3476 214
235 3300037418 Ga0395900_0482881 Ga0395900_0482881_340_987 214
236 3300037466 Ga0395898_0083998 Ga0395898_0083998_1092_1739 214
237 3300037466 Ga0395898_0109850 Ga0395898_0109850_918_1565 214
238 3300037471 Ga0395905_0111218 Ga0395905_0111218_345_992 214
239 3300038443 Ga0395901_0002267 Ga0395901_0002267_10320_10967 214
240 3300038443 Ga0395901_0130418 Ga0395901_0130418_1682_2329 214
241 3300038443 Ga0395901_0336351 Ga0395901_0336351_743_1390 214
242 3300041459 Ga0451800_0732284 Ga0451800_0732284_82_765 214
243 3300042876 Ga0451577_0199955 Ga0451577_0199955_100_747 214
244 3300044658 Ga0466972_0000929 Ga0466972_0000929_655_1302 214
245 3300044673 Ga0453683_0266213 Ga0453683_0266213_269_916 214
246 3300044683 Ga0466965_0006307 Ga0466965_0006307_4029_4676 214
247 3300044683 Ga0466965_0006393 Ga0466965_0006393_2679_3326 214
248 3300044684 Ga0466966_0059651 Ga0466966_0059651_47_694 214
249 3300044684 Ga0466966_0114587 Ga0466966_0114587_973_1620 214
250 3300044684 Ga0466966_0378601 Ga0466966_0378601_29_676 214
251 3300044706 Ga0466964_0001168 Ga0466964_0001168_527_1174 214
252 3300044719 Ga0466971_0175691 Ga0466971_0175691_83_730 214
253 3300044765 Ga0466970_0159370 Ga0466970_0159370_532_1179 214
254 3300044842 Ga0466957_0000301 Ga0466957_0000301_10243_10965 214
255 3300044842 Ga0466957_0029441 Ga0466957_0029441_1811_2458 214
256 3300044842 Ga0466957_0147278 Ga0466957_0147278_327_974 214
257 3300044842 Ga0466957_0229855 Ga0466957_0229855_312_959 214
258 3300044842 Ga0466957_0711135 Ga0466957_0711135_34_681 214
259 3300044901 Ga0466960_0113618 Ga0466960_0113618_690_1337 214
260 3300045049 Ga0466959_0029619 Ga0466959_0029619_2566_3210 214
261 3300045049 Ga0466959_0033854 Ga0466959_0033854_310_957 214
262 3300045049 Ga0466959_0107663 Ga0466959_0107663_1134_1781 214
263 3300045836 Ga0466958_0270156 Ga0466958_0270156_293_940 214
264 3300046452 Ga0495617_000055 Ga0495617_000055_31668_32315 214
265 3300046453 Ga0495627_000123 Ga0495627_000123_62284_62931 214
266 3300046457 Ga0495590_0166937 Ga0495590_0166937_41_691 214
267 3300046459 Ga0495629_0016433 Ga0495629_0016433_3644_4291 214
268 3300046463 Ga0495653_0046362 Ga0495653_0046362_1533_2180 214
269 3300046473 Ga0495582_0127194 Ga0495582_0127194_639_1286 214
270 3300046474 Ga0495605_0000035 Ga0495605_0000035_133138_133785 214
271 3300046491 Ga0495584_0000269 Ga0495584_0000269_16807_17454 214
272 3300046491 Ga0495584_0005974 Ga0495584_0005974_1176_1823 214
273 3300046491 Ga0495584_0090251 Ga0495584_0090251_467_1114 214
274 3300046491 Ga0495584_0263438 Ga0495584_0263438_188_835 214
275 3300046492 Ga0495585_0001645 Ga0495585_0001645_675_1322 214
276 3300046492 Ga0495585_0017999 Ga0495585_0017999_274_921 214
277 3300046492 Ga0495585_0034628 Ga0495585_0034628_836_1486 214
278 3300046492 Ga0495585_0037463 Ga0495585_0037463_473_1123 214
279 3300046492 Ga0495585_0043338 Ga0495585_0043338_1817_2464 214
280 3300046492 Ga0495585_0070487 Ga0495585_0070487_711_1361 214
281 3300046492 Ga0495585_0156323 Ga0495585_0156323_22_669 214
282 3300046500 Ga0495596_0007503 Ga0495596_0007503_4048_4695 214
283 3300046500 Ga0495596_0017215 Ga0495596_0017215_188_835 214
284 3300046500 Ga0495596_0022359 Ga0495596_0022359_1462_2112 214
285 3300046500 Ga0495596_0029961 Ga0495596_0029961_265_912 214
286 3300046501 Ga0495607_0001166 Ga0495607_0001166_7301_7948 214
287 3300046501 Ga0495607_0012237 Ga0495607_0012237_1659_2306 214
288 3300046501 Ga0495607_0088538 Ga0495607_0088538_517_1164 214
289 3300046501 Ga0495607_0116750 Ga0495607_0116750_605_1255 214
290 3300046506 Ga0495583_0000903 Ga0495583_0000903_5197_5847 214
291 3300046506 Ga0495583_0001133 Ga0495583_0001133_17743_18393 214
292 3300046507 Ga0495606_0002110 Ga0495606_0002110_7920_8678 214
293 3300046507 Ga0495606_0006889 Ga0495606_0006889_3727_4374 214
294 3300046507 Ga0495606_0047018 Ga0495606_0047018_774_1424 214
295 3300046513 Ga0495616_0011495 Ga0495616_0011495_1222_1869 214
296 3300046513 Ga0495616_0043694 Ga0495616_0043694_761_1408 214
297 3300046516 Ga0495628_0197955 Ga0495628_0197955_62_709 214
298 3300046518 Ga0495631_0006475 Ga0495631_0006475_3699_4349 214
299 3300046518 Ga0495631_0009245 Ga0495631_0009245_3214_3861 214
300 3300046518 Ga0495631_0055530 Ga0495631_0055530_310_957 214
301 3300046519 Ga0495632_0000236 Ga0495632_0000236_23354_24001 214
302 3300046519 Ga0495632_0010207 Ga0495632_0010207_3341_3991 214
303 3300046519 Ga0495632_0218884 Ga0495632_0218884_191_841 214
304 3300046522 Ga0495643_0004661 Ga0495643_0004661_6676_7323 214
305 3300046522 Ga0495643_0023090 Ga0495643_0023090_2103_2750 214
306 3300046523 Ga0495644_0015854 Ga0495644_0015854_1659_2309 214
307 3300046523 Ga0495644_0039529 Ga0495644_0039529_358_1005 214
308 3300046524 Ga0495648_0000527 Ga0495648_0000527_8870_9517 214
309 3300046525 Ga0495663_0005202 Ga0495663_0005202_724_1371 214
310 3300046526 Ga0495666_0060180 Ga0495666_0060180_206_853 214
311 3300046526 Ga0495666_0241371 Ga0495666_0241371_89_736 214
312 3300046528 Ga0495642_0000005 Ga0495642_0000005_95286_95933 214
313 3300046528 Ga0495642_0000174 Ga0495642_0000174_13209_13856 214
314 3300046528 Ga0495642_0007222 Ga0495642_0007222_2752_3399 214
315 3300046528 Ga0495642_0059570 Ga0495642_0059570_627_1277 214
316 3300046531 Ga0495665_0160109 Ga0495665_0160109_340_1038 214
317 3300046535 Ga0495586_0053153 Ga0495586_0053153_362_1012 214
318 3300046535 Ga0495586_0101643 Ga0495586_0101643_210_857 214
319 3300046536 Ga0495587_0047504 Ga0495587_0047504_63_710 214
320 3300046542 Ga0495597_0000456 Ga0495597_0000456_29925_30575 214
321 3300046542 Ga0495597_0011359 Ga0495597_0011359_2893_3543 214
322 3300046557 Ga0495622_0033222 Ga0495622_0033222_325_1023 214
323 3300046557 Ga0495622_0074292 Ga0495622_0074292_804_1496 214
324 3300046557 Ga0495622_0093130 Ga0495622_0093130_715_1362 214
325 3300046558 Ga0495633_0013034 Ga0495633_0013034_3059_3709 214
326 3300046558 Ga0495633_0073545 Ga0495633_0073545_117_764 214
327 3300046558 Ga0495633_0152118 Ga0495633_0152118_267_917 214
328 3300046558 Ga0495633_0265541 Ga0495633_0265541_66_713 214
329 3300046615 Ga0495656_0014217 Ga0495656_0014217_1004_1651 214
330 3300046615 Ga0495656_0067639 Ga0495656_0067639_758_1420 214
331 3300046616 Ga0495668_0003850 Ga0495668_0003850_8240_8887 214
332 3300046616 Ga0495668_0004835 Ga0495668_0004835_5102_5749 214
333 3300046648 Ga0495611_0005156 Ga0495611_0005156_1574_2224 214
334 3300046648 Ga0495611_0005581 Ga0495611_0005581_4549_5199 214
335 3300046648 Ga0495611_0075600 Ga0495611_0075600_206_853 214
336 3300046660 Ga0495625_0046978 Ga0495625_0046978_578_1228 214
337 3300046663 Ga0495635_0453283 Ga0495635_0453283_76_726 214
338 3300046665 Ga0495661_0001403 Ga0495661_0001403_14918_15565 214
339 3300046665 Ga0495661_0002211 Ga0495661_0002211_11544_12191 214
340 3300046665 Ga0495661_0003246 Ga0495661_0003246_5915_6562 214
341 3300046665 Ga0495661_0015341 Ga0495661_0015341_764_1411 214
342 3300046665 Ga0495661_0018291 Ga0495661_0018291_1553_2200 214
343 3300046665 Ga0495661_0042329 Ga0495661_0042329_1372_2019 214
344 3300046665 Ga0495661_0053722 Ga0495661_0053722_396_1046 214
345 3300046665 Ga0495661_0166614 Ga0495661_0166614_309_959 214
346 3300046674 Ga0495588_0034367 Ga0495588_0034367_1546_2193 214
347 3300046674 Ga0495588_0178136 Ga0495588_0178136_113_805 214
348 3300046679 Ga0495623_0013243 Ga0495623_0013243_1745_2392 214
349 3300046679 Ga0495623_0069013 Ga0495623_0069013_1394_2041 214
350 3300046684 Ga0495669_0010777 Ga0495669_0010777_1488_2135 214
351 3300046684 Ga0495669_0172800 Ga0495669_0172800_79_729 214
352 3300046691 Ga0495670_0010488 Ga0495670_0010488_3432_4079 214
353 3300046691 Ga0495670_0190866 Ga0495670_0190866_240_890 214
354 3300046692 Ga0495671_0000294 Ga0495671_0000294_8988_9635 214
355 3300046692 Ga0495671_0044757 Ga0495671_0044757_1283_2047 214
356 3300046694 Ga0495649_0255050 Ga0495649_0255050_123_770 214
357 3300046794 Ga0495589_0002183 Ga0495589_0002183_5138_5785 214
358 3300046794 Ga0495589_0061727 Ga0495589_0061727_978_1625 214
359 3300046794 Ga0495589_0181485 Ga0495589_0181485_18_665 214
360 3300046809 Ga0495600_0239498 Ga0495600_0239498_313_960 214
361 3300046810 Ga0495660_0007122 Ga0495660_0007122_2045_2692 214
362 3300046810 Ga0495660_0022472 Ga0495660_0022472_1977_2624 214
363 3300046810 Ga0495660_0072648 Ga0495660_0072648_529_1179 214
364 3300047315 Ga0495581_0070697 Ga0495581_0070697_549_1199 214
365 3300047315 Ga0495581_0155345 Ga0495581_0155345_127_825 214
366 3300047317 Ga0495604_0027495 Ga0495604_0027495_750_1442 214
367 3300047318 Ga0495636_0001470 Ga0495636_0001470_6429_7076 214
368 3300047318 Ga0495636_0159480 Ga0495636_0159480_28_678 214
369 3300047319 Ga0495674_0317131 Ga0495674_0317131_182_829 214
370 3300047320 Ga0495672_0099452 Ga0495672_0099452_398_1048 214
371 3300047321 Ga0495676_0078378 Ga0495676_0078378_1509_2159 214
372 3300047322 Ga0495680_0247980 Ga0495680_0247980_456_1103 214
373 3300047323 Ga0495683_0018703 Ga0495683_0018703_196_846 214
374 3300047323 Ga0495683_0048730 Ga0495683_0048730_74_721 214
375 3300047443 Ga0495687_000215 Ga0495687_000215_33338_33985 214
376 3300047445 Ga0495677_0000109 Ga0495677_0000109_32152_32799 214
377 3300047445 Ga0495677_0013665 Ga0495677_0013665_1619_2266 214
378 3300047445 Ga0495677_0056799 Ga0495677_0056799_736_1386 214
379 3300047446 Ga0495679_007882 Ga0495679_007882_528_1175 214
380 3300047447 Ga0495685_137303 Ga0495685_137303_117_767 214
381 3300047469 Ga0495673_0000003 Ga0495673_0000003_422396_423043 214
382 3300047470 Ga0495681_0020236 Ga0495681_0020236_1617_2267 214
383 3300047470 Ga0495681_0020485 Ga0495681_0020485_1015_1665 214
384 3300047470 Ga0495681_0053813 Ga0495681_0053813_874_1521 214
385 3300047472 Ga0495686_0000142 Ga0495686_0000142_43818_44465 214
386 3300047472 Ga0495686_0006640 Ga0495686_0006640_7447_8094 214
387 3300047472 Ga0495686_0086030 Ga0495686_0086030_1150_1797 214
388 3300047673 Ga0495593_0033938 Ga0495593_0033938_1814_2464 214
389 3300048088 Ga0495602_0126083 Ga0495602_0126083_595_1242 214
390 3300048089 Ga0495614_0098752 Ga0495614_0098752_534_1184 214
391 3300048091 Ga0495626_0013785 Ga0495626_0013785_1457_2107 214
392 3300048905 Ga0496102_0000173 Ga0496102_0000173_12128_12775 214
393 3300048905 Ga0496102_0478709 Ga0496102_0478709_194_841 214
394 3300048906 Ga0496103_0016801 Ga0496103_0016801_1663_2310 214
395 3300048912 Ga0496109_0101966 Ga0496109_0101966_1113_1760 214
396 3300048914 Ga0496111_0086704 Ga0496111_0086704_1464_2111 214
397 3300048915 Ga0496112_0199407 Ga0496112_0199407_445_1092 214
398 3300048916 Ga0496113_0001294 Ga0496113_0001294_3635_4282 214
399 3300048916 Ga0496113_0238693 Ga0496113_0238693_362_1009 214
400 3300048916 Ga0496113_0694742 Ga0496113_0694742_31_678 214
401 3300048918 Ga0496115_0002099 Ga0496115_0002099_1109_1756 214
402 3300048925 Ga0496122_0002763 Ga0496122_0002763_6992_7639 214
403 3300048925 Ga0496122_0122443 Ga0496122_0122443_815_1462 214
404 3300048926 Ga0496123_0004315 Ga0496123_0004315_11649_12401 214
405 3300048926 Ga0496123_0024484 Ga0496123_0024484_1776_2423 214
406 3300048927 Ga0496124_0027915 Ga0496124_0027915_2866_3513 214
407 3300048927 Ga0496124_0109338 Ga0496124_0109338_1065_1712 214
408 3300048928 Ga0496125_0055441 Ga0496125_0055441_335_982 214
409 3300049460 Ga0495682_0001423 Ga0495682_0001423_5912_6559 214
410 3300049460 Ga0495682_0019235 Ga0495682_0019235_421_1071 214
411 3300049571 Ga0501034_0153494 Ga0501034_0153494_210_857 214
412 3300049580 Ga0501046_0086394 Ga0501046_0086394_1384_2055 214
413 3300049581 Ga0501047_0065616 Ga0501047_0065616_657_1328 214
414 3300049586 Ga0501070_0742247 Ga0501070_0742247_97_747 214
415 3300049744 Ga0501083_0001990 Ga0501083_0001990_10318_10989 214
416 3300049779 Ga0501283_051438 Ga0501283_051438_77_721 214
417 3300050492 nmdc:mga0yw44_403469_c1 nmdc:mga0yw44_403469_c1_101_763 214
418 3300050515 nmdc:mga0a205_292167_c1 nmdc:mga0a205_292167_c1_701_1348 214
419 3300053178 Ga0500637_0001526 Ga0500637_0001526_7963_8610 214
420 3300061719 Ga0466962_0047367 Ga0466962_0047367_1338_1985 214
421 3300003203 JGI25406J46586_10001197 JGI25406J46586_1000119711 215
422 3300005328 Ga0070676_10009376 Ga0070676_100093762 215
423 3300005330 Ga0070690_100127247 Ga0070690_1001272472 215
424 3300005331 Ga0070670_100094777 Ga0070670_1000947772 215
425 3300005333 Ga0070677_10158214 Ga0070677_101582141 215
426 3300005334 Ga0068869_100003195 Ga0068869_1000031958 215
427 3300005335 Ga0070666_10008823 Ga0070666_100088232 215
428 3300005343 Ga0070687_100045346 Ga0070687_1000453463 215
429 3300005344 Ga0070661_100002899 Ga0070661_1000028992 215
430 3300005347 Ga0070668_100000574 Ga0070668_1000005749 215
431 3300005353 Ga0070669_100000765 Ga0070669_1000007656 215
432 3300005353 Ga0070669_100314309 Ga0070669_1003143092 215
433 3300005354 Ga0070675_100049796 Ga0070675_1000497962 215
434 3300005354 Ga0070675_100098419 Ga0070675_1000984194 215
435 3300005355 Ga0070671_100431307 Ga0070671_1004313072 215
436 3300005356 Ga0070674_100011152 Ga0070674_1000111524 215
437 3300005364 Ga0070673_100050730 Ga0070673_1000507302 215
438 3300005364 Ga0070673_100189764 Ga0070673_1001897641 215
439 3300005364 Ga0070673_100283758 Ga0070673_1002837581 215
440 3300005364 Ga0070673_100290054 Ga0070673_1002900542 215
441 3300005367 Ga0070667_100007739 Ga0070667_1000077397 215
442 3300005436 Ga0070713_100077183 Ga0070713_1000771832 215
443 3300005441 Ga0070700_100006109 Ga0070700_1000061096 215
444 3300005455 Ga0070663_100074650 Ga0070663_1000746503 215
445 3300005456 Ga0070678_100015798 Ga0070678_1000157985 215
446 3300005456 Ga0070678_100093070 Ga0070678_1000930702 215
447 3300005456 Ga0070678_100314383 Ga0070678_1003143832 215
448 3300005456 Ga0070678_100540255 Ga0070678_1005402552 215
449 3300005457 Ga0070662_100000783 Ga0070662_1000007838 215
450 3300005459 Ga0068867_100005514 Ga0068867_1000055146 215
451 3300005518 Ga0070699_100020444 Ga0070699_1000204447 215
452 3300005543 Ga0070672_100005134 Ga0070672_1000051346 215
453 3300005543 Ga0070672_100133928 Ga0070672_1001339282 215
454 3300005543 Ga0070672_100175199 Ga0070672_1001751991 215
455 3300005548 Ga0070665_100461152 Ga0070665_1004611522 215
456 3300005564 Ga0070664_100001492 Ga0070664_1000014928 215
457 3300005564 Ga0070664_100213965 Ga0070664_1002139652 215
458 3300005577 Ga0068857_100000223 Ga0068857_10000022321 215
459 3300005615 Ga0070702_100497747 Ga0070702_1004977471 215
460 3300005616 Ga0068852_100008232 Ga0068852_1000082327 215
461 3300005616 Ga0068852_100287673 Ga0068852_1002876732 215
462 3300005617 Ga0068859_100104541 Ga0068859_1001045412 215
463 3300005617 Ga0068859_100275730 Ga0068859_1002757303 215
464 3300005618 Ga0068864_100134405 Ga0068864_1001344052 215
465 3300005618 Ga0068864_101357713 Ga0068864_1013577131 215
466 3300005718 Ga0068866_10002119 Ga0068866_1000211910 215
467 3300005719 Ga0068861_100004658 Ga0068861_1000046587 215
468 3300005834 Ga0068851_10015869 Ga0068851_100158694 215
469 3300005840 Ga0068870_10268516 Ga0068870_102685162 215
470 3300005841 Ga0068863_100001215 Ga0068863_1000012157 215
471 3300005841 Ga0068863_100555689 Ga0068863_1005556892 215
472 3300005842 Ga0068858_100011059 Ga0068858_1000110595 215
473 3300005843 Ga0068860_100009850 Ga0068860_1000098506 215
474 3300005843 Ga0068860_100434683 Ga0068860_1004346832 215
475 3300005844 Ga0068862_100020474 Ga0068862_1000204745 215
476 3300005983 Ga0081540_1010528 Ga0081540_10105286 215
477 3300005983 Ga0081540_1011231 Ga0081540_10112315 215
478 3300005985 Ga0081539_10002106 Ga0081539_100021069 215
479 3300006237 Ga0097621_100233119 Ga0097621_1002331192 215
480 3300006846 Ga0075430_100009271 Ga0075430_1000092716 215
481 3300006847 Ga0075431_100006662 Ga0075431_1000066626 215
482 3300006852 Ga0075433_10478595 Ga0075433_104785951 215
483 3300006881 Ga0068865_100003044 Ga0068865_1000030446 215
484 3300006931 Ga0097620_100104540 Ga0097620_1001045402 215
485 3300006931 Ga0097620_100275734 Ga0097620_1002757343 215
486 3300009098 Ga0105245_10087074 Ga0105245_100870743 215
487 3300009148 Ga0105243_10015973 Ga0105243_100159737 215
488 3300009176 Ga0105242_10378330 Ga0105242_103783302 215
489 3300009177 Ga0105248_10027004 Ga0105248_100270046 215
490 3300009177 Ga0105248_10477784 Ga0105248_104777842 215
491 3300009553 Ga0105249_10013028 Ga0105249_100130286 215
492 3300010159 Ga0099796_10020039 Ga0099796_100200392 215
493 3300013105 Ga0157369_10386620 Ga0157369_103866202 215
494 3300013296 Ga0157374_10012857 Ga0157374_100128574 215
495 3300013306 Ga0163162_10000769 Ga0163162_1000076910 215
496 3300013307 Ga0157372_10267770 Ga0157372_102677702 215
497 3300013308 Ga0157375_10004451 Ga0157375_100044519 215
498 3300013308 Ga0157375_10098672 Ga0157375_100986725 215
499 3300014325 Ga0163163_10004692 Ga0163163_100046927 215
500 3300014325 Ga0163163_10311894 Ga0163163_103118941 215
501 3300014326 Ga0157380_10004895 Ga0157380_100048952 215
502 3300014326 Ga0157380_10064490 Ga0157380_100644902 215
503 3300014745 Ga0157377_10243610 Ga0157377_102436101 215
504 3300014968 Ga0157379_10224998 Ga0157379_102249982 215
505 3300015683 Ga0183362_10002 Ga0183362_10002238 215
506 3300017792 Ga0163161_10002372 Ga0163161_1000237214 215
507 3300017792 Ga0163161_10158155 Ga0163161_101581553 215
508 3300025315 Ga0207697_10039525 Ga0207697_100395253 215
509 3300025315 Ga0207697_10110172 Ga0207697_101101722 215
510 3300025893 Ga0207682_10081342 Ga0207682_100813422 215
511 3300025899 Ga0207642_10027248 Ga0207642_100272484 215
512 3300025907 Ga0207645_10004020 Ga0207645_100040207 215
513 3300025908 Ga0207643_10247080 Ga0207643_102470802 215
514 3300025912 Ga0207707_10802301 Ga0207707_108023011 215
515 3300025917 Ga0207660_10246050 Ga0207660_102460502 215
516 3300025918 Ga0207662_10049144 Ga0207662_100491444 215
517 3300025919 Ga0207657_10132680 Ga0207657_101326802 215
518 3300025920 Ga0207649_10004404 Ga0207649_100044042 215
519 3300025921 Ga0207652_10207532 Ga0207652_102075322 215
520 3300025921 Ga0207652_10847863 Ga0207652_108478631 215
521 3300025923 Ga0207681_10000340 Ga0207681_100003408 215
522 3300025925 Ga0207650_10056224 Ga0207650_100562244 215
523 3300025926 Ga0207659_10089935 Ga0207659_100899352 215
524 3300025927 Ga0207687_10075001 Ga0207687_100750013 215
525 3300025928 Ga0207700_10101063 Ga0207700_101010633 215
526 3300025933 Ga0207706_10025515 Ga0207706_100255152 215
527 3300025934 Ga0207686_10038506 Ga0207686_100385064 215
528 3300025935 Ga0207709_10078676 Ga0207709_100786763 215
529 3300025937 Ga0207669_10005760 Ga0207669_100057605 215
530 3300025938 Ga0207704_10003619 Ga0207704_100036194 215
531 3300025938 Ga0207704_10162713 Ga0207704_101627133 215
532 3300025940 Ga0207691_10044292 Ga0207691_100442922 215
533 3300025940 Ga0207691_10085217 Ga0207691_100852174 215
534 3300025940 Ga0207691_10260662 Ga0207691_102606622 215
535 3300025941 Ga0207711_10013198 Ga0207711_100131986 215
536 3300025942 Ga0207689_10002255 Ga0207689_100022554 215
537 3300025944 Ga0207661_10577259 Ga0207661_105772592 215
538 3300025945 Ga0207679_10706342 Ga0207679_107063421 215
539 3300025961 Ga0207712_10003827 Ga0207712_100038276 215
540 3300025972 Ga0207668_10008601 Ga0207668_100086012 215
541 3300025972 Ga0207668_10645974 Ga0207668_106459741 215
542 3300025986 Ga0207658_10000756 Ga0207658_100007564 215
543 3300026035 Ga0207703_10001349 Ga0207703_100013494 215
544 3300026041 Ga0207639_10259996 Ga0207639_102599962 215
545 3300026067 Ga0207678_10036525 Ga0207678_100365256 215
546 3300026067 Ga0207678_10169207 Ga0207678_101692072 215
547 3300026075 Ga0207708_10002372 Ga0207708_1000237215 215
548 3300026088 Ga0207641_10005453 Ga0207641_100054535 215
549 3300026089 Ga0207648_10002846 Ga0207648_100028464 215
550 3300026089 Ga0207648_10176800 Ga0207648_101768003 215
551 3300026095 Ga0207676_10049440 Ga0207676_100494403 215
552 3300026095 Ga0207676_10348940 Ga0207676_103489402 215
553 3300026095 Ga0207676_10364508 Ga0207676_103645082 215
554 3300026116 Ga0207674_10000571 Ga0207674_1000057128 215
555 3300026118 Ga0207675_100003938 Ga0207675_1000039387 215
556 3300026118 Ga0207675_100518626 Ga0207675_1005186262 215
557 3300026121 Ga0207683_10035993 Ga0207683_100359932 215
558 3300026121 Ga0207683_10116160 Ga0207683_101161602 215
559 3300026121 Ga0207683_10207273 Ga0207683_102072732 215
560 3300026121 Ga0207683_10392242 Ga0207683_103922422 215
561 3300026142 Ga0207698_10005678 Ga0207698_100056787 215
562 3300028380 Ga0268265_10014242 Ga0268265_100142423 215
563 3300028381 Ga0268264_10011337 Ga0268264_100113376 215
564 3300028563 Ga0265319_1003521 Ga0265319_10035218 215
565 3300028577 Ga0265318_10000412 Ga0265318_1000041218 215
566 3300028800 Ga0265338_10151912 Ga0265338_101519122 215
567 3300031235 Ga0265330_10000345 Ga0265330_1000034518 215
568 3300031235 Ga0265330_10000624 Ga0265330_1000062414 215
569 3300031238 Ga0265332_10000406 Ga0265332_1000040614 215
570 3300031238 Ga0265332_10000614 Ga0265332_1000061416 215
571 3300031239 Ga0265328_10004041 Ga0265328_100040413 215
572 3300031240 Ga0265320_10000433 Ga0265320_1000043317 215
573 3300031240 Ga0265320_10001865 Ga0265320_100018652 215
574 3300031240 Ga0265320_10013162 Ga0265320_100131622 215
575 3300031242 Ga0265329_10007656 Ga0265329_100076563 215
576 3300031250 Ga0265331_10000573 Ga0265331_1000057317 215
577 3300031250 Ga0265331_10001570 Ga0265331_100015703 215
578 3300031344 Ga0265316_10005925 Ga0265316_100059255 215
579 3300031344 Ga0265316_10029349 Ga0265316_100293492 215
580 3300031595 Ga0265313_10000755 Ga0265313_1000075517 215
581 3300031595 Ga0265313_10036387 Ga0265313_100363872 215
582 3300031711 Ga0265314_10001005 Ga0265314_1000100518 215
583 3300031711 Ga0265314_10001934 Ga0265314_100019343 215
584 3300031712 Ga0265342_10002483 Ga0265342_100024833 215
585 3300031712 Ga0265342_10010321 Ga0265342_100103214 215
586 3300031824 Ga0307413_10308756 Ga0307413_103087562 215
587 3300031901 Ga0307406_10466191 Ga0307406_104661912 215
588 3300031903 Ga0307407_10147327 Ga0307407_101473272 215
589 3300031911 Ga0307412_10448459 Ga0307412_104484591 215
590 3300031995 Ga0307409_100215933 Ga0307409_1002159332 215
591 3300032002 Ga0307416_100219733 Ga0307416_1002197331 215
592 3300032002 Ga0307416_101131994 Ga0307416_1011319941 215
593 3300032004 Ga0307414_10491420 Ga0307414_104914201 215
594 3300032005 Ga0307411_10278969 Ga0307411_102789691 215
595 3300032005 Ga0307411_10498596 Ga0307411_104985962 215
596 3300032126 Ga0307415_100347096 Ga0307415_1003470961 215
597 3300035692 Ga0373935_0045836 Ga0373935_0045836_1765_2439 215
598 3300037471 Ga0395905_0014949 Ga0395905_0014949_1374_2027 215
599 3300038443 Ga0395901_0969797 Ga0395901_0969797_38_688 215
600 3300039447 Ga0436361_0561101 Ga0436361_0561101_3264_3914 215
601 3300041453 Ga0451797_0421985 Ga0451797_0421985_131_790 215
602 3300041486 Ga0451807_0601123 Ga0451807_0601123_10_657 215
603 3300044656 Ga0466969_0042599 Ga0466969_0042599_539_1201 215
604 3300044673 Ga0453683_0003988 Ga0453683_0003988_8132_8782 215
605 3300044693 Ga0466961_0013520 Ga0466961_0013520_3951_4613 215
606 3300044706 Ga0466964_0047079 Ga0466964_0047079_734_1396 215
607 3300044719 Ga0466971_0053378 Ga0466971_0053378_648_1310 215
608 3300044842 Ga0466957_0176358 Ga0466957_0176358_673_1335 215
609 3300045049 Ga0466959_0162681 Ga0466959_0162681_103_765 215
610 3300045051 Ga0451576_0016907 Ga0451576_0016907_2484_3134 215
611 3300046500 Ga0495596_0064843 Ga0495596_0064843_119_781 215
612 3300046539 Ga0495621_0094562 Ga0495621_0094562_166_828 215
613 3300046558 Ga0495633_0068025 Ga0495633_0068025_326_979 215
614 3300046674 Ga0495588_0027385 Ga0495588_0027385_1257_1910 215
615 3300048904 Ga0496101_0281329 Ga0496101_0281329_214_867 215
616 3300048904 Ga0496101_0362972 Ga0496101_0362972_15_677 215
617 3300048905 Ga0496102_0002646 Ga0496102_0002646_11505_12158 215
618 3300048906 Ga0496103_0000131 Ga0496103_0000131_11375_12028 215
619 3300048907 Ga0496104_0037026 Ga0496104_0037026_2019_2672 215
620 3300048908 Ga0496105_0001020 Ga0496105_0001020_12018_12671 215
621 3300048910 Ga0496107_0120691 Ga0496107_0120691_661_1314 215
622 3300048914 Ga0496111_0103346 Ga0496111_0103346_1365_2018 215
623 3300048916 Ga0496113_0180622 Ga0496113_0180622_18_671 215
624 3300048917 Ga0496114_0054285 Ga0496114_0054285_2675_3328 215
625 3300048917 Ga0496114_1030596 Ga0496114_1030596_17_679 215
626 3300048918 Ga0496115_0000133 Ga0496115_0000133_56001_56654 215
627 3300048919 Ga0496116_0005419 Ga0496116_0005419_2831_3484 215
628 3300048920 Ga0496117_0002127 Ga0496117_0002127_13486_14139 215
629 3300048921 Ga0496118_0000092 Ga0496118_0000092_73692_74345 215
630 3300048922 Ga0496119_0005121 Ga0496119_0005121_8484_9137 215
631 3300048924 Ga0496121_0005979 Ga0496121_0005979_3520_4173 215
632 3300048926 Ga0496123_0002753 Ga0496123_0002753_8450_9103 215
633 3300048927 Ga0496124_0000081 Ga0496124_0000081_133997_134650 215
634 3300048928 Ga0496125_0002309 Ga0496125_0002309_13184_13837 215
635 3300048929 Ga0496126_0000283 Ga0496126_0000283_94770_95423 215
636 3300049576 Ga0501040_0161456 Ga0501040_0161456_325_972 215
637 3300049587 Ga0501071_0067106 Ga0501071_0067106_420_1067 215
638 3300049588 Ga0501072_0049126 Ga0501072_0049126_453_1100 215
639 3300049590 Ga0501074_0091035 Ga0501074_0091035_398_1045 215
640 3300049591 Ga0501075_0023475 Ga0501075_0023475_809_1456 215
641 3300049741 Ga0501079_0188111 Ga0501079_0188111_637_1284 215
642 3300049743 Ga0501081_0392019 Ga0501081_0392019_225_872 215
643 3300049824 Ga0501045_0208587 Ga0501045_0208587_182_829 215
644 3300050509 nmdc:mga0qj67_4962_c1 nmdc:mga0qj67_4962_c1_3425_4075 215
645 3300050510 nmdc:mga06r32_4146_c1 nmdc:mga06r32_4146_c1_1116_1766 215
646 3300050511 nmdc:mga08y16_128079_c1 nmdc:mga08y16_128079_c1_1039_1701 215
647 3300050514 nmdc:mga08x19_181460_c1 nmdc:mga08x19_181460_c1_54_707 215
648 3300050515 nmdc:mga0a205_147214_c1 nmdc:mga0a205_147214_c1_345_998 215
649 3300054114 Ga0501084_0080215 Ga0501084_0080215_1582_2229 215
650 3300060353 Ga0501082_0039000 Ga0501082_0039000_851_1498 215
651 3300061734 Ga0530510_0105239 Ga0530510_0105239_471_1118 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

20

224

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8782 1 214
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8625 1 214
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8037 1 215
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7912 1 215
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7835 1 214
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8709 2 214 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8436 2 214 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8037 1 215 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7912 1 215 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7639 1 214 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A239M7J6-F1-model_v4 RibD C-terminal domain-containing protein 0.9968 1 215 GO:0008703
GO:0009231
AF-A0A6B9YSD1-F1-model_v4 Dihydrofolate reductase 0.995 1 214 GO:0008703
GO:0009231
AF-A0A2A6JSK4-F1-model_v4 Deaminase 0.9948 1 213 GO:0008703
GO:0009231
AF-A0A536U3N6-F1-model_v4 Dihydrofolate reductase 0.9946 1 215 GO:0008703
GO:0009231
AF-A0A2N7SFS6-F1-model_v4 deleted 0.9946 59 214

Feature Viewer

pLDDT pTM Quality
95.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map