F472574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 310 | 626 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10041951|Ga0070666_100419514 |
| Length | 288 |
| Sequence | MARFEPHPTRRPAIVAGASSGIGAATATALAARGFPVALGARRVEKCQELVDQIKAEGGEAIALPLDVTDTESVENFVAKATAALGDIEVLVTGAGDTNFGRLHEMSTDEFAQQLQIHLVGANRMARAVLDGMVERRRGDLIFVGSDVALRQRPHMGAYGAAKAGLVAMVTNLQMELEGTGVRASVVHPGPTMTSMGWSLPAEKIGPALEDWAKWGQARHSYFLRAADLARAITFIAETPRGGFIANMELQPEAPLAEAKERQSLALGEEGMPGHSEGRSEATGEEEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 6 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 7 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 8 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 9 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 10 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 11 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 12 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 13 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 14 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 15 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 16 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 17 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 18 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 19 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 20 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 21 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 22 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 23 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 24 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 25 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 26 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 196 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 199 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 200 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 202 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 203 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 204 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 205 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 206 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 207 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 264 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.16 |
| Metatranscriptomes | 0 |
| Isolates | 3.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.6 |
| Nodule | 0.15 |
| Rhizoplane | 10.75 |
| Rhizosphere | 65.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10001723 | 3300002077 | Bacteria | 4385 |
| 2 | JGI24751J29686_10003832 | 3300002459 | Bacteria | 3036 |
| 3 | rootH2_10026628 | 3300003320 | Bacteria | 1512 |
| 4 | Ga0055540_1000071 | 3300003792 | Bacteria | 117607 |
| 5 | Ga0070676_10020266 | 3300005328 | Bacteria | 3710 |
| 6 | Ga0070683_100097685 | 3300005329 | Bacteria | 2763 |
| 7 | Ga0070690_100009227 | 3300005330 | Bacteria | 5709 |
| 8 | Ga0068869_100035108 | 3300005334 | Bacteria | 3552 |
| 9 | Ga0068869_100112349 | 3300005334 | Bacteria | 2074 |
| 10 | Ga0070666_10041951 | 3300005335 | Bacteria | 3059 |
| 11 | Ga0070682_100143051 | 3300005337 | Bacteria | 1633 |
| 12 | Ga0070682_100209449 | 3300005337 | Bacteria | 1381 |
| 13 | Ga0068868_100245685 | 3300005338 | Bacteria | 1505 |
| 14 | Ga0070660_100081262 | 3300005339 | Bacteria | 2544 |
| 15 | Ga0070691_10009713 | 3300005341 | Bacteria | 4390 |
| 16 | Ga0070668_100064945 | 3300005347 | Bacteria | 2830 |
| 17 | Ga0070668_100135484 | 3300005347 | Bacteria | 1980 |
| 18 | Ga0070669_100014698 | 3300005353 | Bacteria | 5573 |
| 19 | Ga0070675_100236273 | 3300005354 | Bacteria | 1596 |
| 20 | Ga0070675_100288488 | 3300005354 | Bacteria | 1444 |
| 21 | Ga0070675_100355880 | 3300005354 | Bacteria | 1299 |
| 22 | Ga0070671_100012917 | 3300005355 | Bacteria | 6730 |
| 23 | Ga0070671_100072449 | 3300005355 | Bacteria | 2877 |
| 24 | Ga0070674_100029289 | 3300005356 | Bacteria | 3624 |
| 25 | Ga0070674_100280033 | 3300005356 | Bacteria | 1321 |
| 26 | Ga0070674_100580827 | 3300005356 | Bacteria | 944 |
| 27 | Ga0070688_100033363 | 3300005365 | Bacteria | 3111 |
| 28 | Ga0070688_100083368 | 3300005365 | Bacteria | 2075 |
| 29 | Ga0070659_100028276 | 3300005366 | Bacteria | 4328 |
| 30 | Ga0070667_100000324 | 3300005367 | Bacteria | 53403 |
| 31 | Ga0070667_100000487 | 3300005367 | Bacteria | 40279 |
| 32 | Ga0070667_100051434 | 3300005367 | Bacteria | 3474 |
| 33 | Ga0070667_100249837 | 3300005367 | Bacteria | 1585 |
| 34 | Ga0070709_10020029 | 3300005434 | Bacteria | 3877 |
| 35 | Ga0070709_10395981 | 3300005434 | Bacteria | 1030 |
| 36 | Ga0070714_100005497 | 3300005435 | Bacteria | 9672 |
| 37 | Ga0070714_100105457 | 3300005435 | Bacteria | 2489 |
| 38 | Ga0070714_100240534 | 3300005435 | Bacteria | 1670 |
| 39 | Ga0070714_100613305 | 3300005435 | Bacteria | 1045 |
| 40 | Ga0070713_100098824 | 3300005436 | Bacteria | 2524 |
| 41 | Ga0070710_10000927 | 3300005437 | Bacteria | 13974 |
| 42 | Ga0070710_10051683 | 3300005437 | Bacteria | 2308 |
| 43 | Ga0070701_10001711 | 3300005438 | Bacteria | 8242 |
| 44 | Ga0070711_100003543 | 3300005439 | Bacteria | 9108 |
| 45 | Ga0070705_100004167 | 3300005440 | Bacteria | 7065 |
| 46 | Ga0070700_100032254 | 3300005441 | Bacteria | 3147 |
| 47 | Ga0070663_100007666 | 3300005455 | Bacteria | 6586 |
| 48 | Ga0070663_100009243 | 3300005455 | Bacteria | 6095 |
| 49 | Ga0070663_100044819 | 3300005455 | Bacteria | 3121 |
| 50 | Ga0070678_100001013 | 3300005456 | Bacteria | 14617 |
| 51 | Ga0070662_100071228 | 3300005457 | Bacteria | 2563 |
| 52 | Ga0068867_100008434 | 3300005459 | Bacteria | 7270 |
| 53 | Ga0070685_10034804 | 3300005466 | Bacteria | 2839 |
| 54 | Ga0070685_10043257 | 3300005466 | Bacteria | 2574 |
| 55 | Ga0070679_100382584 | 3300005530 | Bacteria | 1354 |
| 56 | Ga0070684_100326862 | 3300005535 | Bacteria | 1409 |
| 57 | Ga0070672_100012044 | 3300005543 | Bacteria | 6053 |
| 58 | Ga0070672_100144039 | 3300005543 | Bacteria | 1968 |
| 59 | Ga0070672_100147164 | 3300005543 | Bacteria | 1947 |
| 60 | Ga0070672_100347558 | 3300005543 | Bacteria | 1264 |
| 61 | Ga0070686_100253374 | 3300005544 | Bacteria | 1287 |
| 62 | Ga0070695_100032619 | 3300005545 | Bacteria | 3256 |
| 63 | Ga0070696_100010973 | 3300005546 | Bacteria | 6067 |
| 64 | Ga0070696_100163589 | 3300005546 | Bacteria | 1641 |
| 65 | Ga0070696_100430733 | 3300005546 | Bacteria | 1037 |
| 66 | Ga0070665_100024159 | 3300005548 | Bacteria | 6121 |
| 67 | Ga0070665_100025634 | 3300005548 | Bacteria | 5940 |
| 68 | Ga0070665_100039882 | 3300005548 | Bacteria | 4721 |
| 69 | Ga0070665_100052834 | 3300005548 | Bacteria | 4075 |
| 70 | Ga0070704_100010458 | 3300005549 | Bacteria | 5647 |
| 71 | Ga0068855_100445033 | 3300005563 | Bacteria | 1414 |
| 72 | Ga0068854_100001661 | 3300005578 | Bacteria | 13545 |
| 73 | Ga0068856_100403371 | 3300005614 | Bacteria | 1387 |
| 74 | Ga0070702_100016568 | 3300005615 | Bacteria | 3784 |
| 75 | Ga0070702_100355001 | 3300005615 | Bacteria | 1034 |
| 76 | Ga0068852_100061404 | 3300005616 | Bacteria | 3266 |
| 77 | Ga0068852_100094130 | 3300005616 | Bacteria | 2687 |
| 78 | Ga0068852_100443990 | 3300005616 | Bacteria | 1283 |
| 79 | Ga0068859_100001593 | 3300005617 | Bacteria | 23142 |
| 80 | Ga0068859_100012513 | 3300005617 | Bacteria | 8537 |
| 81 | Ga0068859_100039617 | 3300005617 | Bacteria | 4727 |
| 82 | Ga0068859_100408678 | 3300005617 | Bacteria | 1453 |
| 83 | Ga0068859_100472641 | 3300005617 | Bacteria | 1349 |
| 84 | Ga0068861_100053061 | 3300005719 | Bacteria | 3083 |
| 85 | Ga0068851_10053411 | 3300005834 | Bacteria | 2057 |
| 86 | Ga0068863_100000143 | 3300005841 | Bacteria | 75127 |
| 87 | Ga0068863_100003638 | 3300005841 | Bacteria | 15225 |
| 88 | Ga0068863_100091564 | 3300005841 | Bacteria | 2884 |
| 89 | Ga0068858_100071964 | 3300005842 | Bacteria | 3207 |
| 90 | Ga0068858_100072593 | 3300005842 | Bacteria | 3193 |
| 91 | Ga0068858_100173277 | 3300005842 | Bacteria | 2035 |
| 92 | Ga0068860_100000079 | 3300005843 | Bacteria | 170752 |
| 93 | Ga0068860_100005332 | 3300005843 | Bacteria | 13048 |
| 94 | Ga0068860_100607901 | 3300005843 | Bacteria | 1099 |
| 95 | Ga0068862_100000093 | 3300005844 | Bacteria | 106838 |
| 96 | Ga0068862_100042656 | 3300005844 | Bacteria | 3865 |
| 97 | Ga0068862_100073395 | 3300005844 | Bacteria | 2957 |
| 98 | Ga0068862_100235685 | 3300005844 | Bacteria | 1662 |
| 99 | Ga0081455_10404205 | 3300005937 | Bacteria | 947 |
| 100 | Ga0081538_10129562 | 3300005981 | Bacteria | 1189 |
| 101 | Ga0081539_10011881 | 3300005985 | Bacteria | 6805 |
| 102 | Ga0075365_10004388 | 3300006038 | Bacteria | 7467 |
| 103 | Ga0075365_10024094 | 3300006038 | Bacteria | 3835 |
| 104 | Ga0075365_10039518 | 3300006038 | Bacteria | 3072 |
| 105 | Ga0075365_10266804 | 3300006038 | Bacteria | 1204 |
| 106 | Ga0075365_10426361 | 3300006038 | Bacteria | 936 |
| 107 | Ga0075363_100001134 | 3300006048 | Bacteria | 9723 |
| 108 | Ga0075363_100005404 | 3300006048 | Bacteria | 5677 |
| 109 | Ga0075363_100014757 | 3300006048 | Bacteria | 3827 |
| 110 | Ga0075363_100021949 | 3300006048 | Bacteria | 3222 |
| 111 | Ga0075363_100034794 | 3300006048 | Bacteria | 2631 |
| 112 | Ga0075363_100049716 | 3300006048 | Bacteria | 2233 |
| 113 | Ga0075363_100081878 | 3300006048 | Bacteria | 1766 |
| 114 | Ga0075363_100190669 | 3300006048 | Bacteria | 1169 |
| 115 | Ga0075364_10004041 | 3300006051 | Bacteria | 8423 |
| 116 | Ga0075364_10005464 | 3300006051 | Bacteria | 7387 |
| 117 | Ga0075364_10006554 | 3300006051 | Bacteria | 6848 |
| 118 | Ga0075364_10024282 | 3300006051 | Bacteria | 3847 |
| 119 | Ga0075364_10032394 | 3300006051 | Bacteria | 3360 |
| 120 | Ga0075364_10235411 | 3300006051 | Bacteria | 1244 |
| 121 | Ga0070715_10097834 | 3300006163 | Bacteria | 1363 |
| 122 | Ga0070716_100297001 | 3300006173 | Bacteria | 1122 |
| 123 | Ga0070712_100009663 | 3300006175 | Bacteria | 6080 |
| 124 | Ga0070712_100015167 | 3300006175 | Bacteria | 4956 |
| 125 | Ga0075362_10028730 | 3300006177 | Bacteria | 2391 |
| 126 | Ga0075362_10040478 | 3300006177 | Bacteria | 2052 |
| 127 | Ga0075367_10010291 | 3300006178 | Bacteria | 4909 |
| 128 | Ga0075367_10082365 | 3300006178 | Bacteria | 1948 |
| 129 | Ga0075367_10141418 | 3300006178 | Bacteria | 1491 |
| 130 | Ga0075369_10000029 | 3300006186 | Bacteria | 39213 |
| 131 | Ga0075369_10048200 | 3300006186 | Bacteria | 1838 |
| 132 | Ga0075369_10058467 | 3300006186 | Bacteria | 1679 |
| 133 | Ga0097621_100008957 | 3300006237 | Bacteria | 7239 |
| 134 | Ga0075370_10010734 | 3300006353 | Bacteria | 4802 |
| 135 | Ga0075370_10024117 | 3300006353 | Bacteria | 3357 |
| 136 | Ga0075370_10025841 | 3300006353 | Bacteria | 3249 |
| 137 | Ga0075428_100007875 | 3300006844 | Bacteria | 11813 |
| 138 | Ga0075428_100086121 | 3300006844 | Bacteria | 3427 |
| 139 | Ga0075430_100018039 | 3300006846 | Bacteria | 6006 |
| 140 | Ga0075429_100033298 | 3300006880 | Bacteria | 4477 |
| 141 | Ga0068865_100031398 | 3300006881 | Bacteria | 3542 |
| 142 | Ga0068865_100148738 | 3300006881 | Bacteria | 1774 |
| 143 | Ga0097620_100001593 | 3300006931 | Bacteria | 23142 |
| 144 | Ga0097620_100012512 | 3300006931 | Bacteria | 8537 |
| 145 | Ga0097620_100039617 | 3300006931 | Bacteria | 4727 |
| 146 | Ga0097620_100408685 | 3300006931 | Bacteria | 1453 |
| 147 | Ga0097620_100472679 | 3300006931 | Bacteria | 1349 |
| 148 | Ga0105245_10006858 | 3300009098 | Bacteria | 9988 |
| 149 | Ga0105245_10043781 | 3300009098 | Bacteria | 3994 |
| 150 | Ga0105245_10130542 | 3300009098 | Bacteria | 2356 |
| 151 | Ga0105245_10365107 | 3300009098 | Bacteria | 1434 |
| 152 | Ga0105245_10674334 | 3300009098 | Bacteria | 1065 |
| 153 | Ga0105247_10000044 | 3300009101 | Bacteria | 153728 |
| 154 | Ga0105247_10002130 | 3300009101 | Bacteria | 13679 |
| 155 | Ga0105247_10034465 | 3300009101 | Bacteria | 3083 |
| 156 | Ga0114129_10100127 | 3300009147 | Bacteria | 4010 |
| 157 | Ga0105243_10002819 | 3300009148 | Bacteria | 14433 |
| 158 | Ga0105243_10011604 | 3300009148 | Bacteria | 6666 |
| 159 | Ga0105241_10017700 | 3300009174 | Bacteria | 5239 |
| 160 | Ga0105242_10002099 | 3300009176 | Bacteria | 15700 |
| 161 | Ga0105248_10000060 | 3300009177 | Bacteria | 131634 |
| 162 | Ga0105237_10001746 | 3300009545 | Bacteria | 28078 |
| 163 | Ga0105237_10027148 | 3300009545 | Bacteria | 5847 |
| 164 | Ga0105237_10194481 | 3300009545 | Bacteria | 2028 |
| 165 | Ga0105238_10068604 | 3300009551 | Bacteria | 3547 |
| 166 | Ga0105249_10000049 | 3300009553 | Bacteria | 169899 |
| 167 | Ga0105249_10006471 | 3300009553 | Bacteria | 10189 |
| 168 | Ga0105249_10031917 | 3300009553 | Bacteria | 4764 |
| 169 | Ga0105249_10249935 | 3300009553 | Bacteria | 1758 |
| 170 | Ga0105249_10408912 | 3300009553 | Bacteria | 1389 |
| 171 | Ga0105249_10526973 | 3300009553 | Bacteria | 1229 |
| 172 | Ga0105239_10003558 | 3300010375 | Bacteria | 19045 |
| 173 | Ga0105239_10136848 | 3300010375 | Bacteria | 2727 |
| 174 | Ga0105239_10137217 | 3300010375 | Bacteria | 2723 |
| 175 | Ga0105239_10339415 | 3300010375 | Bacteria | 1695 |
| 176 | Ga0105246_10015077 | 3300011119 | Bacteria | 4871 |
| 177 | Ga0105246_10206848 | 3300011119 | Bacteria | 1529 |
| 178 | Ga0105246_10252536 | 3300011119 | Bacteria | 1400 |
| 179 | Ga0105246_10311319 | 3300011119 | Bacteria | 1276 |
| 180 | Ga0157371_10198870 | 3300013102 | Bacteria | 1436 |
| 181 | Ga0157374_10103932 | 3300013296 | Bacteria | 2727 |
| 182 | Ga0157378_10006985 | 3300013297 | Bacteria | 9850 |
| 183 | Ga0157378_10287840 | 3300013297 | Bacteria | 1586 |
| 184 | Ga0163162_10058900 | 3300013306 | Bacteria | 3871 |
| 185 | Ga0163162_10061855 | 3300013306 | Bacteria | 3782 |
| 186 | Ga0163162_10341042 | 3300013306 | Bacteria | 1631 |
| 187 | Ga0163162_10539497 | 3300013306 | Bacteria | 1295 |
| 188 | Ga0157372_10021406 | 3300013307 | Bacteria | 6985 |
| 189 | Ga0157375_10090288 | 3300013308 | Bacteria | 3122 |
| 190 | Ga0163163_10045830 | 3300014325 | Bacteria | 4294 |
| 191 | Ga0163163_10067722 | 3300014325 | Bacteria | 3550 |
| 192 | Ga0163163_10464585 | 3300014325 | Bacteria | 1326 |
| 193 | Ga0163163_10488096 | 3300014325 | Bacteria | 1293 |
| 194 | Ga0157380_10003346 | 3300014326 | Bacteria | 10992 |
| 195 | Ga0157380_10106390 | 3300014326 | Bacteria | 2347 |
| 196 | Ga0157377_10000892 | 3300014745 | Bacteria | 12459 |
| 197 | Ga0157377_10098470 | 3300014745 | Bacteria | 1738 |
| 198 | Ga0157379_10076026 | 3300014968 | Bacteria | 3007 |
| 199 | Ga0157379_10612246 | 3300014968 | Bacteria | 1017 |
| 200 | Ga0163161_10001520 | 3300017792 | Bacteria | 17172 |
| 201 | Ga0213874_10011657 | 3300021377 | Bacteria | 2234 |
| 202 | Ga0213876_10001760 | 3300021384 | Bacteria | 13128 |
| 203 | Ga0213875_10018469 | 3300021388 | Bacteria | 3360 |
| 204 | Ga0213875_10049004 | 3300021388 | Bacteria | 1980 |
| 205 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 206 | Ga0209051_1000776 | 3300025303 | Bacteria | 33909 |
| 207 | Ga0209051_1014386 | 3300025303 | Bacteria | 3697 |
| 208 | Ga0207692_10026329 | 3300025898 | Bacteria | 2727 |
| 209 | Ga0207692_10110014 | 3300025898 | Bacteria | 1527 |
| 210 | Ga0207692_10156047 | 3300025898 | Bacteria | 1311 |
| 211 | Ga0207642_10031402 | 3300025899 | Bacteria | 2224 |
| 212 | Ga0207710_10000066 | 3300025900 | Bacteria | 153734 |
| 213 | Ga0207710_10007366 | 3300025900 | Bacteria | 4661 |
| 214 | Ga0207688_10001970 | 3300025901 | Bacteria | 11004 |
| 215 | Ga0207688_10016401 | 3300025901 | Bacteria | 4017 |
| 216 | Ga0207680_10080750 | 3300025903 | Bacteria | 2043 |
| 217 | Ga0207647_10039971 | 3300025904 | Bacteria | 2956 |
| 218 | Ga0207685_10007375 | 3300025905 | Bacteria | 3061 |
| 219 | Ga0207699_10023723 | 3300025906 | Bacteria | 3342 |
| 220 | Ga0207699_10084238 | 3300025906 | Bacteria | 1980 |
| 221 | Ga0207645_10011325 | 3300025907 | Bacteria | 6095 |
| 222 | Ga0207654_10171912 | 3300025911 | Bacteria | 1407 |
| 223 | Ga0207671_10008052 | 3300025914 | Bacteria | 9008 |
| 224 | Ga0207671_10122033 | 3300025914 | Bacteria | 1992 |
| 225 | Ga0207693_10000197 | 3300025915 | Bacteria | 54675 |
| 226 | Ga0207693_10002311 | 3300025915 | Bacteria | 16577 |
| 227 | Ga0207663_10128567 | 3300025916 | Bacteria | 1746 |
| 228 | Ga0207663_10157453 | 3300025916 | Bacteria | 1599 |
| 229 | Ga0207652_10412153 | 3300025921 | Bacteria | 1219 |
| 230 | Ga0207681_10002233 | 3300025923 | Bacteria | 12310 |
| 231 | Ga0207681_10083257 | 3300025923 | Bacteria | 2264 |
| 232 | Ga0207694_10050232 | 3300025924 | Bacteria | 3229 |
| 233 | Ga0207659_10061826 | 3300025926 | Bacteria | 2701 |
| 234 | Ga0207659_10216117 | 3300025926 | Bacteria | 1539 |
| 235 | Ga0207659_10614339 | 3300025926 | Bacteria | 927 |
| 236 | Ga0207687_10063517 | 3300025927 | Bacteria | 2615 |
| 237 | Ga0207687_10068149 | 3300025927 | Bacteria | 2534 |
| 238 | Ga0207687_10235839 | 3300025927 | Bacteria | 1447 |
| 239 | Ga0207700_10017600 | 3300025928 | Bacteria | 4777 |
| 240 | Ga0207700_10175675 | 3300025928 | Bacteria | 1790 |
| 241 | Ga0207664_10082060 | 3300025929 | Bacteria | 2625 |
| 242 | Ga0207664_10144061 | 3300025929 | Bacteria | 2019 |
| 243 | Ga0207644_10019633 | 3300025931 | Bacteria | 4588 |
| 244 | Ga0207690_10239644 | 3300025932 | Bacteria | 1396 |
| 245 | Ga0207690_10347956 | 3300025932 | Bacteria | 1171 |
| 246 | Ga0207706_10002775 | 3300025933 | Bacteria | 17025 |
| 247 | Ga0207709_10012393 | 3300025935 | Bacteria | 4699 |
| 248 | Ga0207709_10414918 | 3300025935 | Bacteria | 1033 |
| 249 | Ga0207670_10050027 | 3300025936 | Bacteria | 2798 |
| 250 | Ga0207670_10291581 | 3300025936 | Bacteria | 1275 |
| 251 | Ga0207669_10004342 | 3300025937 | Bacteria | 6228 |
| 252 | Ga0207669_10170811 | 3300025937 | Bacteria | 1547 |
| 253 | Ga0207669_10203134 | 3300025937 | Bacteria | 1440 |
| 254 | Ga0207669_10599841 | 3300025937 | Bacteria | 895 |
| 255 | Ga0207665_10007522 | 3300025939 | Bacteria | 7201 |
| 256 | Ga0207665_10061230 | 3300025939 | Bacteria | 2550 |
| 257 | Ga0207665_10409517 | 3300025939 | Bacteria | 1034 |
| 258 | Ga0207691_10079226 | 3300025940 | Bacteria | 2957 |
| 259 | Ga0207691_10157649 | 3300025940 | Bacteria | 1993 |
| 260 | Ga0207711_10000058 | 3300025941 | Bacteria | 133317 |
| 261 | Ga0207711_10023946 | 3300025941 | Bacteria | 5110 |
| 262 | Ga0207689_10045502 | 3300025942 | Bacteria | 3628 |
| 263 | Ga0207689_10074866 | 3300025942 | Bacteria | 2782 |
| 264 | Ga0207667_10129394 | 3300025949 | Bacteria | 2600 |
| 265 | Ga0207651_10694486 | 3300025960 | Bacteria | 896 |
| 266 | Ga0207712_10000038 | 3300025961 | Bacteria | 192762 |
| 267 | Ga0207712_10090968 | 3300025961 | Bacteria | 2247 |
| 268 | Ga0207712_10099840 | 3300025961 | Bacteria | 2156 |
| 269 | Ga0207668_10001652 | 3300025972 | Bacteria | 13029 |
| 270 | Ga0207668_10025482 | 3300025972 | Bacteria | 3828 |
| 271 | Ga0207668_10121008 | 3300025972 | Bacteria | 1982 |
| 272 | Ga0207640_10059653 | 3300025981 | Bacteria | 2519 |
| 273 | Ga0207640_10279196 | 3300025981 | Bacteria | 1311 |
| 274 | Ga0207658_10000061 | 3300025986 | Bacteria | 119045 |
| 275 | Ga0207658_10006720 | 3300025986 | Bacteria | 7831 |
| 276 | Ga0207677_10006626 | 3300026023 | Bacteria | 6354 |
| 277 | Ga0207677_10207403 | 3300026023 | Bacteria | 1562 |
| 278 | Ga0207703_10069764 | 3300026035 | Bacteria | 2899 |
| 279 | Ga0207678_10010285 | 3300026067 | Bacteria | 8212 |
| 280 | Ga0207678_10039301 | 3300026067 | Bacteria | 4107 |
| 281 | Ga0207678_10576849 | 3300026067 | Bacteria | 985 |
| 282 | Ga0207708_10003700 | 3300026075 | Bacteria | 11290 |
| 283 | Ga0207708_10017860 | 3300026075 | Bacteria | 5338 |
| 284 | Ga0207702_10359874 | 3300026078 | Bacteria | 1394 |
| 285 | Ga0207702_10501162 | 3300026078 | Bacteria | 1184 |
| 286 | Ga0207641_10000232 | 3300026088 | Bacteria | 71885 |
| 287 | Ga0207641_10006641 | 3300026088 | Bacteria | 9711 |
| 288 | Ga0207641_10127987 | 3300026088 | Bacteria | 2276 |
| 289 | Ga0207648_10004179 | 3300026089 | Bacteria | 14923 |
| 290 | Ga0207648_10037367 | 3300026089 | Bacteria | 4277 |
| 291 | Ga0207675_100003156 | 3300026118 | Bacteria | 16170 |
| 292 | Ga0207675_100037611 | 3300026118 | Bacteria | 4514 |
| 293 | Ga0207675_100070125 | 3300026118 | Bacteria | 3276 |
| 294 | Ga0207675_100256663 | 3300026118 | Bacteria | 1693 |
| 295 | Ga0207683_10003067 | 3300026121 | Bacteria | 14603 |
| 296 | Ga0207683_10151606 | 3300026121 | Bacteria | 2092 |
| 297 | Ga0207698_10032304 | 3300026142 | Bacteria | 3791 |
| 298 | Ga0207698_10078825 | 3300026142 | Bacteria | 2647 |
| 299 | Ga0207698_10393654 | 3300026142 | Bacteria | 1322 |
| 300 | Ga0209813_10049296 | 3300027866 | Bacteria | 1310 |
| 301 | Ga0209813_10080888 | 3300027866 | Bacteria | 1074 |
| 302 | Ga0207428_10327152 | 3300027907 | Bacteria | 1131 |
| 303 | Ga0268266_10009675 | 3300028379 | Bacteria | 8474 |
| 304 | Ga0268266_10018080 | 3300028379 | Bacteria | 6008 |
| 305 | Ga0268265_10000053 | 3300028380 | Bacteria | 170215 |
| 306 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 307 | Ga0268264_10027953 | 3300028381 | Bacteria | 4611 |
| 308 | Ga0268264_10462886 | 3300028381 | Bacteria | 1230 |
| 309 | Ga0268264_10515638 | 3300028381 | Bacteria | 1168 |
| 310 | Ga0307511_10000896 | 3300030521 | Bacteria | 31348 |
| 311 | Ga0265327_10000128 | 3300031251 | Bacteria | 165601 |
| 312 | Ga0265327_10000477 | 3300031251 | Bacteria | 70613 |
| 313 | Ga0265327_10002212 | 3300031251 | Bacteria | 21240 |
| 314 | Ga0265327_10006336 | 3300031251 | Bacteria | 9495 |
| 315 | Ga0265327_10102573 | 3300031251 | Bacteria | 1378 |
| 316 | Ga0265327_10115145 | 3300031251 | Bacteria | 1280 |
| 317 | Ga0307408_100125838 | 3300031548 | Bacteria | 1993 |
| 318 | Ga0316576_10112230 | 3300031727 | Bacteria | 2044 |
| 319 | Ga0307413_10007594 | 3300031824 | Bacteria | 5051 |
| 320 | Ga0307410_10016048 | 3300031852 | Bacteria | 4455 |
| 321 | Ga0307410_10016844 | 3300031852 | Bacteria | 4370 |
| 322 | Ga0307410_10492175 | 3300031852 | Bacteria | 1008 |
| 323 | Ga0307406_10054494 | 3300031901 | Bacteria | 2553 |
| 324 | Ga0307406_10072081 | 3300031901 | Bacteria | 2266 |
| 325 | Ga0307409_100003692 | 3300031995 | Bacteria | 8393 |
| 326 | Ga0307409_100201500 | 3300031995 | Bacteria | 1781 |
| 327 | Ga0307416_100023582 | 3300032002 | Bacteria | 4469 |
| 328 | Ga0307416_100215654 | 3300032002 | Bacteria | 1836 |
| 329 | Ga0307414_10159849 | 3300032004 | Bacteria | 1788 |
| 330 | Ga0307415_100007009 | 3300032126 | Bacteria | 6129 |
| 331 | Ga0307510_10118779 | 3300033180 | Bacteria | 2356 |
| 332 | Ga0373932_0093643 | 3300035112 | Bacteria | 968 |
| 333 | Ga0373932_0170567 | 3300035112 | Bacteria | 758 |
| 334 | Ga0316584_0146764 | 3300036712 | Bacteria | 1757 |
| 335 | Ga0395898_0373492 | 3300037466 | Bacteria | 1360 |
| 336 | Ga0436364_0224006 | 3300037853 | Bacteria | 27953 |
| 337 | Ga0436364_0330612 | 3300037853 | Bacteria | 5117 |
| 338 | Ga0436364_1545518 | 3300037853 | Bacteria | 5045 |
| 339 | Ga0395901_0542194 | 3300038443 | Bacteria | 1180 |
| 340 | Ga0436365_0039491 | 3300039437 | Bacteria | 3739 |
| 341 | Ga0436365_0271296 | 3300039437 | Bacteria | 39035 |
| 342 | Ga0436365_0305981 | 3300039437 | Bacteria | 1440 |
| 343 | Ga0436365_0397989 | 3300039437 | Bacteria | 12470 |
| 344 | Ga0436365_0667324 | 3300039437 | Bacteria | 2894 |
| 345 | Ga0436365_1865812 | 3300039437 | Bacteria | 4654 |
| 346 | Ga0436360_0933631 | 3300039438 | Bacteria | 913 |
| 347 | Ga0436360_1088466 | 3300039438 | Bacteria | 1487 |
| 348 | Ga0436361_0877000 | 3300039447 | Bacteria | 1917 |
| 349 | Ga0436363_0064425 | 3300039450 | Bacteria | 3443 |
| 350 | Ga0439466_0006376 | 3300041411 | Bacteria | 4487 |
| 351 | Ga0439465_0003069 | 3300041413 | Bacteria | 5465 |
| 352 | Ga0439465_0004735 | 3300041413 | Bacteria | 4390 |
| 353 | Ga0439465_0005177 | 3300041413 | Bacteria | 4184 |
| 354 | Ga0451791_1164627 | 3300041451 | Bacteria | 1144 |
| 355 | Ga0451833_1108409 | 3300041491 | Bacteria | 1151 |
| 356 | Ga0439431_0015108 | 3300041997 | Bacteria | 1795 |
| 357 | Ga0439442_008348 | 3300042002 | Bacteria | 2090 |
| 358 | Ga0439445_0002867 | 3300042004 | Bacteria | 3850 |
| 359 | Ga0439448_0001702 | 3300042005 | Bacteria | 5793 |
| 360 | Ga0439434_0005195 | 3300042435 | Bacteria | 3807 |
| 361 | Ga0439435_0025868 | 3300042436 | Bacteria | 1559 |
| 362 | Ga0466969_0027920 | 3300044656 | Bacteria | 2888 |
| 363 | Ga0466972_0001604 | 3300044658 | Bacteria | 11046 |
| 364 | Ga0466972_0015260 | 3300044658 | Bacteria | 3841 |
| 365 | Ga0466972_0028614 | 3300044658 | Bacteria | 2748 |
| 366 | Ga0466972_0060937 | 3300044658 | Bacteria | 1810 |
| 367 | Ga0466972_0354514 | 3300044658 | Bacteria | 686 |
| 368 | Ga0466965_0000732 | 3300044683 | Bacteria | 12261 |
| 369 | Ga0466965_0009878 | 3300044683 | Bacteria | 4439 |
| 370 | Ga0466965_0029526 | 3300044683 | Bacteria | 2669 |
| 371 | Ga0466965_0078183 | 3300044683 | Bacteria | 1671 |
| 372 | Ga0466965_0212320 | 3300044683 | Bacteria | 1029 |
| 373 | Ga0466966_0000813 | 3300044684 | Bacteria | 19883 |
| 374 | Ga0466966_0002596 | 3300044684 | Bacteria | 11839 |
| 375 | Ga0466966_0030448 | 3300044684 | Bacteria | 3505 |
| 376 | Ga0466966_0068876 | 3300044684 | Bacteria | 2221 |
| 377 | Ga0466966_0250944 | 3300044684 | Bacteria | 1066 |
| 378 | Ga0466966_0324337 | 3300044684 | Bacteria | 925 |
| 379 | Ga0466961_0013845 | 3300044693 | Bacteria | 5169 |
| 380 | Ga0466961_0016015 | 3300044693 | Bacteria | 4813 |
| 381 | Ga0466961_0022099 | 3300044693 | Bacteria | 4093 |
| 382 | Ga0466961_0169704 | 3300044693 | Bacteria | 1357 |
| 383 | Ga0466961_0176666 | 3300044693 | Bacteria | 1326 |
| 384 | Ga0466963_0025090 | 3300044694 | Bacteria | 3799 |
| 385 | Ga0466963_0254140 | 3300044694 | Bacteria | 1233 |
| 386 | Ga0466964_0132745 | 3300044706 | Bacteria | 1136 |
| 387 | Ga0466971_0003487 | 3300044719 | Bacteria | 6718 |
| 388 | Ga0466971_0029775 | 3300044719 | Bacteria | 2442 |
| 389 | Ga0466968_0007528 | 3300044735 | Bacteria | 4144 |
| 390 | Ga0466968_0008858 | 3300044735 | Bacteria | 3862 |
| 391 | Ga0466968_0062049 | 3300044735 | Bacteria | 1613 |
| 392 | Ga0466970_0004676 | 3300044765 | Bacteria | 6759 |
| 393 | Ga0466970_0030645 | 3300044765 | Bacteria | 2837 |
| 394 | Ga0466970_0034811 | 3300044765 | Bacteria | 2667 |
| 395 | Ga0466970_0086437 | 3300044765 | Bacteria | 1699 |
| 396 | Ga0466957_0001665 | 3300044842 | Bacteria | 11671 |
| 397 | Ga0466957_0097691 | 3300044842 | Bacteria | 1847 |
| 398 | Ga0466960_0000220 | 3300044901 | Bacteria | 19822 |
| 399 | Ga0466960_0001412 | 3300044901 | Bacteria | 8731 |
| 400 | Ga0466959_0020200 | 3300045049 | Bacteria | 4904 |
| 401 | Ga0466959_0037158 | 3300045049 | Bacteria | 3598 |
| 402 | Ga0466959_0090397 | 3300045049 | Bacteria | 2199 |
| 403 | Ga0466959_0307855 | 3300045049 | Bacteria | 1084 |
| 404 | Ga0466958_0002045 | 3300045836 | Bacteria | 9966 |
| 405 | Ga0466958_0013952 | 3300045836 | Bacteria | 4581 |
| 406 | Ga0466958_0024005 | 3300045836 | Bacteria | 3585 |
| 407 | Ga0466958_0047984 | 3300045836 | Bacteria | 2579 |
| 408 | Ga0466958_0064199 | 3300045836 | Bacteria | 2239 |
| 409 | Ga0466967_0001559 | 3300045976 | Bacteria | 13444 |
| 410 | Ga0466967_0014046 | 3300045976 | Bacteria | 6219 |
| 411 | Ga0466967_0038199 | 3300045976 | Bacteria | 4116 |
| 412 | Ga0466967_0109327 | 3300045976 | Bacteria | 2538 |
| 413 | Ga0466967_0564149 | 3300045976 | Bacteria | 1121 |
| 414 | Ga0466967_0599314 | 3300045976 | Bacteria | 1087 |
| 415 | Ga0466967_0798539 | 3300045976 | Bacteria | 937 |
| 416 | Ga0495629_0211148 | 3300046459 | Bacteria | 1340 |
| 417 | Ga0495638_0044175 | 3300046460 | Bacteria | 2808 |
| 418 | Ga0495605_0075416 | 3300046474 | Bacteria | 1586 |
| 419 | Ga0495639_0033636 | 3300046475 | Bacteria | 2290 |
| 420 | Ga0495583_0034916 | 3300046506 | Bacteria | 2405 |
| 421 | Ga0495606_0119408 | 3300046507 | Bacteria | 1580 |
| 422 | Ga0495665_0009892 | 3300046531 | Bacteria | 5163 |
| 423 | Ga0495640_0061351 | 3300046533 | Bacteria | 2554 |
| 424 | Ga0495668_0068491 | 3300046616 | Bacteria | 1952 |
| 425 | Ga0495668_0215480 | 3300046616 | Bacteria | 1051 |
| 426 | Ga0495634_0209697 | 3300046642 | Bacteria | 1207 |
| 427 | Ga0495588_0052994 | 3300046674 | Bacteria | 2092 |
| 428 | Ga0495658_0001869 | 3300046683 | Bacteria | 10743 |
| 429 | Ga0495613_0191486 | 3300046689 | Bacteria | 1445 |
| 430 | Ga0495674_0150867 | 3300047319 | Bacteria | 1949 |
| 431 | Ga0495672_0004722 | 3300047320 | Bacteria | 11013 |
| 432 | Ga0495672_0124149 | 3300047320 | Bacteria | 1368 |
| 433 | Ga0495676_0326086 | 3300047321 | Bacteria | 1031 |
| 434 | Ga0495686_0158115 | 3300047472 | Bacteria | 1326 |
| 435 | Ga0495593_0018433 | 3300047673 | Bacteria | 3921 |
| 436 | Ga0496100_0000029 | 3300048903 | Bacteria | 110710 |
| 437 | Ga0496100_0000798 | 3300048903 | Bacteria | 15034 |
| 438 | Ga0496100_0002877 | 3300048903 | Bacteria | 8828 |
| 439 | Ga0496100_0009461 | 3300048903 | Bacteria | 5479 |
| 440 | Ga0496100_0019765 | 3300048903 | Bacteria | 4026 |
| 441 | Ga0496100_0467895 | 3300048903 | Bacteria | 968 |
| 442 | Ga0496101_0000015 | 3300048904 | Bacteria | 252368 |
| 443 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 444 | Ga0496101_0008430 | 3300048904 | Bacteria | 6733 |
| 445 | Ga0496101_0032368 | 3300048904 | Bacteria | 3680 |
| 446 | Ga0496101_0208648 | 3300048904 | Bacteria | 1513 |
| 447 | Ga0496102_0000065 | 3300048905 | Bacteria | 161370 |
| 448 | Ga0496102_0000336 | 3300048905 | Bacteria | 57396 |
| 449 | Ga0496102_0018476 | 3300048905 | Bacteria | 6128 |
| 450 | Ga0496102_0020404 | 3300048905 | Bacteria | 5856 |
| 451 | Ga0496102_0029754 | 3300048905 | Bacteria | 4887 |
| 452 | Ga0496102_0050101 | 3300048905 | Bacteria | 3801 |
| 453 | Ga0496102_0057448 | 3300048905 | Bacteria | 3553 |
| 454 | Ga0496102_0078800 | 3300048905 | Bacteria | 3033 |
| 455 | Ga0496102_0228372 | 3300048905 | Bacteria | 1755 |
| 456 | Ga0496102_0244389 | 3300048905 | Bacteria | 1692 |
| 457 | Ga0496102_0642914 | 3300048905 | Bacteria | 984 |
| 458 | Ga0496103_0000048 | 3300048906 | Bacteria | 160911 |
| 459 | Ga0496103_0000271 | 3300048906 | Bacteria | 49217 |
| 460 | Ga0496103_0001418 | 3300048906 | Bacteria | 16076 |
| 461 | Ga0496103_0018080 | 3300048906 | Bacteria | 4226 |
| 462 | Ga0496103_0048212 | 3300048906 | Bacteria | 2632 |
| 463 | Ga0496103_0094537 | 3300048906 | Bacteria | 1888 |
| 464 | Ga0496103_0148481 | 3300048906 | Bacteria | 1501 |
| 465 | Ga0496104_0027595 | 3300048907 | Bacteria | 5256 |
| 466 | Ga0496104_0198545 | 3300048907 | Bacteria | 1918 |
| 467 | Ga0496105_0283264 | 3300048908 | Bacteria | 1336 |
| 468 | Ga0496106_0000396 | 3300048909 | Bacteria | 31087 |
| 469 | Ga0496106_0006462 | 3300048909 | Bacteria | 8682 |
| 470 | Ga0496106_0098255 | 3300048909 | Bacteria | 2268 |
| 471 | Ga0496106_0683915 | 3300048909 | Bacteria | 818 |
| 472 | Ga0496107_0000649 | 3300048910 | Bacteria | 19601 |
| 473 | Ga0496107_0009198 | 3300048910 | Bacteria | 6846 |
| 474 | Ga0496107_0010437 | 3300048910 | Bacteria | 6453 |
| 475 | Ga0496107_0014326 | 3300048910 | Bacteria | 5552 |
| 476 | Ga0496108_0001208 | 3300048911 | Bacteria | 20256 |
| 477 | Ga0496108_0013765 | 3300048911 | Bacteria | 6599 |
| 478 | Ga0496108_0038239 | 3300048911 | Bacteria | 3998 |
| 479 | Ga0496108_0252065 | 3300048911 | Bacteria | 1535 |
| 480 | Ga0496108_0551448 | 3300048911 | Bacteria | 1006 |
| 481 | Ga0496109_0000022 | 3300048912 | Bacteria | 188901 |
| 482 | Ga0496109_0011896 | 3300048912 | Bacteria | 7491 |
| 483 | Ga0496109_0016720 | 3300048912 | Bacteria | 6417 |
| 484 | Ga0496109_0125113 | 3300048912 | Bacteria | 2397 |
| 485 | Ga0496110_0004126 | 3300048913 | Bacteria | 11225 |
| 486 | Ga0496110_0145954 | 3300048913 | Bacteria | 2140 |
| 487 | Ga0496110_0243188 | 3300048913 | Bacteria | 1638 |
| 488 | Ga0496111_0050073 | 3300048914 | Bacteria | 3012 |
| 489 | Ga0496112_0002704 | 3300048915 | Bacteria | 14341 |
| 490 | Ga0496112_0019097 | 3300048915 | Bacteria | 6461 |
| 491 | Ga0496112_0185734 | 3300048915 | Bacteria | 2042 |
| 492 | Ga0496112_0513419 | 3300048915 | Bacteria | 1133 |
| 493 | Ga0496113_0202789 | 3300048916 | Bacteria | 1577 |
| 494 | Ga0496113_0449706 | 3300048916 | Bacteria | 1035 |
| 495 | Ga0496113_0487351 | 3300048916 | Bacteria | 990 |
| 496 | Ga0496114_0000716 | 3300048917 | Bacteria | 24693 |
| 497 | Ga0496114_0002600 | 3300048917 | Bacteria | 13777 |
| 498 | Ga0496114_0027672 | 3300048917 | Bacteria | 4646 |
| 499 | Ga0496114_0155902 | 3300048917 | Bacteria | 1983 |
| 500 | Ga0496114_0616305 | 3300048917 | Bacteria | 956 |
| 501 | Ga0496115_0004673 | 3300048918 | Bacteria | 9923 |
| 502 | Ga0496115_0018996 | 3300048918 | Bacteria | 5285 |
| 503 | Ga0496115_0061266 | 3300048918 | Bacteria | 3034 |
| 504 | Ga0496115_0266868 | 3300048918 | Bacteria | 1407 |
| 505 | Ga0496116_0000125 | 3300048919 | Bacteria | 160885 |
| 506 | Ga0496116_0003462 | 3300048919 | Bacteria | 15566 |
| 507 | Ga0496117_0000111 | 3300048920 | Bacteria | 184570 |
| 508 | Ga0496117_0001352 | 3300048920 | Bacteria | 35887 |
| 509 | Ga0496117_0008331 | 3300048920 | Bacteria | 9863 |
| 510 | Ga0496117_0060123 | 3300048920 | Bacteria | 2621 |
| 511 | Ga0496118_0000083 | 3300048921 | Bacteria | 184570 |
| 512 | Ga0496118_0002892 | 3300048921 | Bacteria | 22351 |
| 513 | Ga0496118_0025250 | 3300048921 | Bacteria | 5101 |
| 514 | Ga0496119_0004014 | 3300048922 | Bacteria | 14877 |
| 515 | Ga0496119_0007493 | 3300048922 | Bacteria | 9809 |
| 516 | Ga0496119_0010640 | 3300048922 | Bacteria | 7711 |
| 517 | Ga0496120_0001769 | 3300048923 | Bacteria | 24335 |
| 518 | Ga0496120_0012983 | 3300048923 | Bacteria | 5635 |
| 519 | Ga0496120_0021299 | 3300048923 | Bacteria | 4099 |
| 520 | Ga0496120_0061325 | 3300048923 | Bacteria | 2100 |
| 521 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 522 | Ga0496121_0001000 | 3300048924 | Bacteria | 50532 |
| 523 | Ga0496121_0009717 | 3300048924 | Bacteria | 11008 |
| 524 | Ga0496122_0000138 | 3300048925 | Bacteria | 169434 |
| 525 | Ga0496122_0040074 | 3300048925 | Bacteria | 3728 |
| 526 | Ga0496122_0125513 | 3300048925 | Bacteria | 1644 |
| 527 | Ga0496123_0024813 | 3300048926 | Bacteria | 4541 |
| 528 | Ga0496123_0034379 | 3300048926 | Bacteria | 3632 |
| 529 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 530 | Ga0496124_0093145 | 3300048927 | Bacteria | 2452 |
| 531 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 532 | Ga0496125_0010602 | 3300048928 | Bacteria | 9309 |
| 533 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 534 | Ga0496126_0000220 | 3300048929 | Bacteria | 124547 |
| 535 | Ga0496126_0004252 | 3300048929 | Bacteria | 17240 |
| 536 | Ga0496126_0026981 | 3300048929 | Bacteria | 5496 |
| 537 | Ga0496126_0061092 | 3300048929 | Bacteria | 3386 |
| 538 | Ga0501032_0010663 | 3300049569 | Bacteria | 6616 |
| 539 | Ga0501032_0221685 | 3300049569 | Bacteria | 1231 |
| 540 | Ga0501033_0007899 | 3300049570 | Bacteria | 8240 |
| 541 | Ga0501033_0391902 | 3300049570 | Bacteria | 969 |
| 542 | Ga0501034_0007790 | 3300049571 | Bacteria | 11395 |
| 543 | Ga0501034_0016717 | 3300049571 | Bacteria | 7522 |
| 544 | Ga0501036_0008446 | 3300049572 | Bacteria | 8437 |
| 545 | Ga0501037_0000219 | 3300049573 | Bacteria | 49904 |
| 546 | Ga0501037_0010691 | 3300049573 | Bacteria | 6744 |
| 547 | Ga0501038_0059297 | 3300049574 | Bacteria | 3278 |
| 548 | Ga0501039_0000675 | 3300049575 | Bacteria | 24622 |
| 549 | Ga0501043_0001226 | 3300049579 | Bacteria | 22608 |
| 550 | Ga0501043_0071941 | 3300049579 | Bacteria | 2716 |
| 551 | Ga0501046_0000302 | 3300049580 | Bacteria | 49738 |
| 552 | Ga0501046_0190763 | 3300049580 | Bacteria | 1529 |
| 553 | Ga0501047_0017099 | 3300049581 | Bacteria | 6936 |
| 554 | Ga0501047_0146835 | 3300049581 | Bacteria | 2235 |
| 555 | Ga0501047_0285267 | 3300049581 | Bacteria | 1495 |
| 556 | Ga0501048_0032945 | 3300049582 | Bacteria | 3744 |
| 557 | Ga0501069_0230739 | 3300049585 | Bacteria | 1077 |
| 558 | Ga0501070_0004586 | 3300049586 | Bacteria | 11841 |
| 559 | Ga0501070_0004633 | 3300049586 | Bacteria | 11795 |
| 560 | Ga0501070_0072994 | 3300049586 | Bacteria | 2840 |
| 561 | Ga0501070_0328633 | 3300049586 | Bacteria | 1243 |
| 562 | Ga0501071_0116742 | 3300049587 | Bacteria | 1976 |
| 563 | Ga0501073_0058018 | 3300049589 | Bacteria | 2706 |
| 564 | Ga0501073_0419434 | 3300049589 | Bacteria | 925 |
| 565 | Ga0501035_0000665 | 3300049822 | Bacteria | 37870 |
| 566 | Ga0501035_0000742 | 3300049822 | Bacteria | 35160 |
| 567 | Ga0501044_0000313 | 3300049823 | Bacteria | 61310 |
| 568 | Ga0501044_0001249 | 3300049823 | Bacteria | 30175 |
| 569 | Ga0501044_0076396 | 3300049823 | Bacteria | 3399 |
| 570 | Ga0501044_0305946 | 3300049823 | Bacteria | 1517 |
| 571 | Ga0501045_0524870 | 3300049824 | Bacteria | 879 |
| 572 | nmdc:mga03683_62412_c1 | 3300050489 | Bacteria | 1578 |
| 573 | nmdc:mga03n38_181039_c1 | 3300050490 | Bacteria | 1080 |
| 574 | nmdc:mga03n38_202072_c1 | 3300050490 | Bacteria | 1029 |
| 575 | nmdc:mga03n38_3117_c1 | 3300050490 | Bacteria | 5271 |
| 576 | nmdc:mga03n38_48465_c1 | 3300050490 | Bacteria | 1885 |
| 577 | nmdc:mga03n38_514_c1 | 3300050490 | Bacteria | 9769 |
| 578 | nmdc:mga03n38_77644_c1 | 3300050490 | Bacteria | 1552 |
| 579 | nmdc:mga03n38_85572_c1 | 3300050490 | Bacteria | 1491 |
| 580 | nmdc:mga00v17_13060_c1 | 3300050491 | Bacteria | 4602 |
| 581 | nmdc:mga00v17_137800_c1 | 3300050491 | Bacteria | 1563 |
| 582 | nmdc:mga00v17_168840_c1 | 3300050491 | Bacteria | 1410 |
| 583 | nmdc:mga00v17_231009_c1 | 3300050491 | Bacteria | 1198 |
| 584 | nmdc:mga00v17_33164_c1 | 3300050491 | Bacteria | 3058 |
| 585 | nmdc:mga00v17_365685_c1 | 3300050491 | Bacteria | 938 |
| 586 | nmdc:mga00v17_440650_c1 | 3300050491 | Bacteria | 846 |
| 587 | nmdc:mga00v17_5765_c1 | 3300050491 | Bacteria | 6545 |
| 588 | nmdc:mga00v17_681_c1 | 3300050491 | Bacteria | 18678 |
| 589 | nmdc:mga0yw44_106161_c1 | 3300050492 | Bacteria | 1794 |
| 590 | nmdc:mga0yw44_234951_c1 | 3300050492 | Bacteria | 1217 |
| 591 | nmdc:mga0yw44_29716_c1 | 3300050492 | Bacteria | 3158 |
| 592 | nmdc:mga0yw44_40108_c1 | 3300050492 | Bacteria | 2780 |
| 593 | nmdc:mga0yw44_4095_c1 | 3300050492 | Bacteria | 6611 |
| 594 | nmdc:mga0yw44_47764_c1 | 3300050492 | Bacteria | 2578 |
| 595 | nmdc:mga0k408_262536_c1 | 3300050493 | Bacteria | 1031 |
| 596 | nmdc:mga06z11_119734_c1 | 3300050494 | Bacteria | 1467 |
| 597 | nmdc:mga06z11_126358_c1 | 3300050494 | Bacteria | 1431 |
| 598 | nmdc:mga06z11_13513_c1 | 3300050494 | Bacteria | 3588 |
| 599 | nmdc:mga06z11_41642_c1 | 3300050494 | Bacteria | 2299 |
| 600 | nmdc:mga04h51_18774_c1 | 3300050495 | Bacteria | 2041 |
| 601 | nmdc:mga07m45_117410_c1 | 3300050496 | Bacteria | 1535 |
| 602 | nmdc:mga07m45_15921_c1 | 3300050496 | Bacteria | 4021 |
| 603 | nmdc:mga07m45_2877_c1 | 3300050496 | Bacteria | 8156 |
| 604 | nmdc:mga07m45_300213_c1 | 3300050496 | Bacteria | 934 |
| 605 | nmdc:mga07m45_30412_c1 | 3300050496 | Bacteria | 2599 |
| 606 | nmdc:mga05p37_292603_c1 | 3300050507 | Bacteria | 1938 |
| 607 | nmdc:mga09592_267900_c1 | 3300050508 | Bacteria | 1481 |
| 608 | nmdc:mga0qj67_4393_c1 | 3300050509 | Bacteria | 10208 |
| 609 | nmdc:mga06r32_27527_c1 | 3300050510 | Bacteria | 5312 |
| 610 | nmdc:mga08y16_180117_c1 | 3300050511 | Bacteria | 2194 |
| 611 | nmdc:mga0sz30_1058_c1 | 3300050516 | Bacteria | 9925 |
| 612 | nmdc:mga0sz30_112759_c1 | 3300050516 | Bacteria | 1192 |
| 613 | nmdc:mga0sz30_3045_c1 | 3300050516 | Bacteria | 6001 |
| 614 | Ga0500635_0158296 | 3300053080 | Bacteria | 868 |
| 615 | Ga0495619_0212347 | 3300053085 | Bacteria | 1340 |
| 616 | Ga0495619_0297746 | 3300053085 | Bacteria | 1118 |
| 617 | Ga0500643_010917 | 3300053087 | Bacteria | 3350 |
| 618 | Ga0500643_022740 | 3300053087 | Bacteria | 2013 |
| 619 | Ga0500556_0075347 | 3300053104 | Bacteria | 1267 |
| 620 | Ga0500562_005526 | 3300053108 | Bacteria | 3174 |
| 621 | Ga0500642_0098975 | 3300053130 | Bacteria | 1355 |
| 622 | Ga0500559_0027977 | 3300053136 | Bacteria | 2407 |
| 623 | Ga0500616_0017253 | 3300053153 | Bacteria | 4099 |
| 624 | Ga0500645_000056 | 3300053730 | Bacteria | 92126 |
| 625 | Ga0501084_0000082 | 3300054114 | Bacteria | 69523 |
| 626 | Ga0466962_0035067 | 3300061719 | Bacteria | 2402 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0354514 | Ga0466972_0354514_19_675 | 218 |
| 2 | 3300044684 | Ga0466966_0324337 | Ga0466966_0324337_12_815 | 226 |
| 3 | 3300050490 | nmdc:mga03n38_202072_c1 | nmdc:mga03n38_202072_c1_22_720 | 231 |
| 4 | 3300035112 | Ga0373932_0170567 | Ga0373932_0170567_40_738 | 232 |
| 5 | 3300048917 | Ga0496114_0616305 | Ga0496114_0616305_38_736 | 232 |
| 6 | 3300030521 | Ga0307511_10000896 | Ga0307511_1000089629 | 245 |
| 7 | 3300033180 | Ga0307510_10118779 | Ga0307510_101187793 | 248 |
| 8 | 3300044693 | Ga0466961_0013845 | Ga0466961_0013845_2299_3045 | 248 |
| 9 | 3300042005 | Ga0439448_0001702 | Ga0439448_0001702_2888_3643 | 251 |
| 10 | 3300048905 | Ga0496102_0228372 | Ga0496102_0228372_943_1710 | 251 |
| 11 | 3300054114 | Ga0501084_0000082 | Ga0501084_0000082_44831_45595 | 253 |
| 12 | iso_pu_bacteria | 2773857762 | 2774392518 | 254 |
| 13 | iso_pu_bacteria | 2811994878 | 2812351538 | 254 |
| 14 | 3300005937 | Ga0081455_10404205 | Ga0081455_104042052 | 255 |
| 15 | 3300006038 | Ga0075365_10426361 | Ga0075365_104263612 | 255 |
| 16 | 3300044684 | Ga0466966_0068876 | Ga0466966_0068876_1432_2211 | 255 |
| 17 | 3300050491 | nmdc:mga00v17_440650_c1 | nmdc:mga00v17_440650_c1_46_822 | 255 |
| 18 | iso_pu_bacteria | 2744054611 | 2744953598 | 255 |
| 19 | 3300005354 | Ga0070675_100288488 | Ga0070675_1002884881 | 256 |
| 20 | 3300025926 | Ga0207659_10216117 | Ga0207659_102161172 | 256 |
| 21 | 3300044656 | Ga0466969_0027920 | Ga0466969_0027920_1901_2686 | 257 |
| 22 | 3300045049 | Ga0466959_0090397 | Ga0466959_0090397_1363_2148 | 257 |
| 23 | 3300041413 | Ga0439465_0004735 | Ga0439465_0004735_865_1641 | 258 |
| 24 | 3300041997 | Ga0439431_0015108 | Ga0439431_0015108_777_1553 | 258 |
| 25 | 3300042004 | Ga0439445_0002867 | Ga0439445_0002867_931_1707 | 258 |
| 26 | iso_pu_bacteria | 2751185725 | 2753035772 | 258 |
| 27 | iso_pu_bacteria | 2751185792 | 2753326203 | 258 |
| 28 | 3300031251 | Ga0265327_10102573 | Ga0265327_101025732 | 259 |
| 29 | 3300031727 | Ga0316576_10112230 | Ga0316576_101122302 | 259 |
| 30 | iso_pu_bacteria | 2643221692 | 2644517708 | 259 |
| 31 | 3300005356 | Ga0070674_100580827 | Ga0070674_1005808271 | 260 |
| 32 | 3300005563 | Ga0068855_100445033 | Ga0068855_1004450332 | 260 |
| 33 | 3300039438 | Ga0436360_1088466 | Ga0436360_1088466_529_1326 | 260 |
| 34 | 3300044693 | Ga0466961_0022099 | Ga0466961_0022099_1001_1804 | 260 |
| 35 | 3300044765 | Ga0466970_0030645 | Ga0466970_0030645_681_1484 | 260 |
| 36 | 3300045976 | Ga0466967_0038199 | Ga0466967_0038199_3013_3816 | 260 |
| 37 | 3300046531 | Ga0495665_0009892 | Ga0495665_0009892_996_1781 | 260 |
| 38 | 3300046674 | Ga0495588_0052994 | Ga0495588_0052994_1234_2019 | 260 |
| 39 | 3300048904 | Ga0496101_0208648 | Ga0496101_0208648_498_1280 | 260 |
| 40 | 3300048909 | Ga0496106_0683915 | Ga0496106_0683915_18_800 | 260 |
| 41 | 3300048916 | Ga0496113_0487351 | Ga0496113_0487351_18_800 | 260 |
| 42 | 3300049823 | Ga0501044_0305946 | Ga0501044_0305946_367_1149 | 260 |
| 43 | iso_pu_bacteria | 2551306166 | 2552105433 | 260 |
| 44 | 3300009098 | Ga0105245_10043781 | Ga0105245_100437813 | 261 |
| 45 | 3300025911 | Ga0207654_10171912 | Ga0207654_101719122 | 261 |
| 46 | 3300025927 | Ga0207687_10063517 | Ga0207687_100635172 | 261 |
| 47 | 3300026142 | Ga0207698_10078825 | Ga0207698_100788253 | 261 |
| 48 | 3300031251 | Ga0265327_10000477 | Ga0265327_1000047763 | 261 |
| 49 | 3300031251 | Ga0265327_10115145 | Ga0265327_101151452 | 261 |
| 50 | 3300049569 | Ga0501032_0221685 | Ga0501032_0221685_292_1077 | 261 |
| 51 | 3300049824 | Ga0501045_0524870 | Ga0501045_0524870_84_869 | 261 |
| 52 | 3300013102 | Ga0157371_10198870 | Ga0157371_101988701 | 262 |
| 53 | 3300048918 | Ga0496115_0061266 | Ga0496115_0061266_401_1189 | 262 |
| 54 | 3300053085 | Ga0495619_0297746 | Ga0495619_0297746_241_1056 | 262 |
| 55 | iso_pu_bacteria | 2565956761 | 2566992740 | 262 |
| 56 | iso_pu_bacteria | 2738541308 | 2738886801 | 262 |
| 57 | iso_pu_bacteria | 2904535858 | 2904540256 | 262 |
| 58 | iso_pu_bacteria | 2922554459 | 2922556286 | 262 |
| 59 | 3300005354 | Ga0070675_100355880 | Ga0070675_1003558801 | 264 |
| 60 | 3300005543 | Ga0070672_100012044 | Ga0070672_1000120443 | 264 |
| 61 | 3300009545 | Ga0105237_10194481 | Ga0105237_101944812 | 264 |
| 62 | 3300011119 | Ga0105246_10206848 | Ga0105246_102068481 | 264 |
| 63 | 3300025914 | Ga0207671_10122033 | Ga0207671_101220332 | 264 |
| 64 | 3300025926 | Ga0207659_10614339 | Ga0207659_106143391 | 264 |
| 65 | 3300025936 | Ga0207670_10291581 | Ga0207670_102915812 | 264 |
| 66 | 3300006048 | Ga0075363_100081878 | Ga0075363_1000818782 | 266 |
| 67 | 3300006178 | Ga0075367_10141418 | Ga0075367_101414182 | 266 |
| 68 | 3300006844 | Ga0075428_100086121 | Ga0075428_1000861212 | 266 |
| 69 | 3300006880 | Ga0075429_100033298 | Ga0075429_1000332983 | 266 |
| 70 | 3300047321 | Ga0495676_0326086 | Ga0495676_0326086_99_911 | 266 |
| 71 | 3300048911 | Ga0496108_0252065 | Ga0496108_0252065_402_1208 | 266 |
| 72 | 3300048911 | Ga0496108_0551448 | Ga0496108_0551448_16_828 | 266 |
| 73 | 3300048928 | Ga0496125_0010602 | Ga0496125_0010602_6348_7154 | 266 |
| 74 | 3300050490 | nmdc:mga03n38_181039_c1 | nmdc:mga03n38_181039_c1_142_948 | 266 |
| 75 | 3300050491 | nmdc:mga00v17_365685_c1 | nmdc:mga00v17_365685_c1_121_927 | 266 |
| 76 | 3300050494 | nmdc:mga06z11_126358_c1 | nmdc:mga06z11_126358_c1_322_1128 | 266 |
| 77 | 3300050496 | nmdc:mga07m45_117410_c1 | nmdc:mga07m45_117410_c1_604_1410 | 266 |
| 78 | 3300050496 | nmdc:mga07m45_30412_c1 | nmdc:mga07m45_30412_c1_1388_2194 | 266 |
| 79 | 3300050508 | nmdc:mga09592_267900_c1 | nmdc:mga09592_267900_c1_466_1278 | 266 |
| 80 | iso_pu_bacteria | 2738543011 | 2739238840 | 266 |
| 81 | iso_pu_bacteria | 2889300758 | 2889301115 | 266 |
| 82 | iso_pu_bacteria | 2939743619 | 2939744633 | 266 |
| 83 | 3300005985 | Ga0081539_10011881 | Ga0081539_100118815 | 267 |
| 84 | 3300005546 | Ga0070696_100163589 | Ga0070696_1001635892 | 268 |
| 85 | 3300031901 | Ga0307406_10054494 | Ga0307406_100544943 | 268 |
| 86 | 3300048905 | Ga0496102_0642914 | Ga0496102_0642914_90_929 | 268 |
| 87 | 3300021388 | Ga0213875_10049004 | Ga0213875_100490042 | 269 |
| 88 | 3300037853 | Ga0436364_0224006 | Ga0436364_0224006_23718_24527 | 269 |
| 89 | 3300048916 | Ga0496113_0449706 | Ga0496113_0449706_159_968 | 269 |
| 90 | 3300009148 | Ga0105243_10002819 | Ga0105243_1000281913 | 270 |
| 91 | iso_pu_bacteria | 2738541274 | 2738706391 | 270 |
| 92 | iso_pu_bacteria | 2738543028 | 2739328882 | 270 |
| 93 | iso_pu_bacteria | 2902799365 | 2902804165 | 270 |
| 94 | iso_pu_bacteria | 2902810491 | 2902814480 | 270 |
| 95 | iso_pu_bacteria | 2902837492 | 2902839197 | 270 |
| 96 | iso_pu_bacteria | 2929212328 | 2929217933 | 270 |
| 97 | iso_pu_bacteria | 2939582691 | 2939585159 | 270 |
| 98 | 3300005434 | Ga0070709_10395981 | Ga0070709_103959812 | 271 |
| 99 | 3300005981 | Ga0081538_10129562 | Ga0081538_101295622 | 271 |
| 100 | 3300025928 | Ga0207700_10175675 | Ga0207700_101756752 | 271 |
| 101 | 3300025939 | Ga0207665_10409517 | Ga0207665_104095171 | 271 |
| 102 | 3300036712 | Ga0316584_0146764 | Ga0316584_0146764_223_1041 | 271 |
| 103 | 3300037853 | Ga0436364_0330612 | Ga0436364_0330612_3438_4256 | 271 |
| 104 | 3300039437 | Ga0436365_0305981 | Ga0436365_0305981_130_948 | 271 |
| 105 | 3300039437 | Ga0436365_1865812 | Ga0436365_1865812_957_1775 | 271 |
| 106 | 3300044683 | Ga0466965_0212320 | Ga0466965_0212320_186_1004 | 271 |
| 107 | 3300044684 | Ga0466966_0000813 | Ga0466966_0000813_3725_4543 | 271 |
| 108 | 3300044693 | Ga0466961_0176666 | Ga0466961_0176666_483_1301 | 271 |
| 109 | 3300044694 | Ga0466963_0025090 | Ga0466963_0025090_2615_3433 | 271 |
| 110 | 3300044735 | Ga0466968_0008858 | Ga0466968_0008858_3003_3821 | 271 |
| 111 | 3300045836 | Ga0466958_0002045 | Ga0466958_0002045_189_1007 | 271 |
| 112 | iso_pu_bacteria | 2643221715 | 2644636436 | 271 |
| 113 | iso_pu_bacteria | 2738541264 | 2738667382 | 271 |
| 114 | iso_pu_bacteria | 2738541356 | 2739146225 | 271 |
| 115 | iso_pu_bacteria | 2842134933 | 2842140355 | 271 |
| 116 | 3300021377 | Ga0213874_10011657 | Ga0213874_100116572 | 272 |
| 117 | 3300039437 | Ga0436365_0397989 | Ga0436365_0397989_5955_6773 | 272 |
| 118 | 3300039450 | Ga0436363_0064425 | Ga0436363_0064425_1607_2428 | 272 |
| 119 | 3300039447 | Ga0436361_0877000 | Ga0436361_0877000_41_862 | 273 |
| 120 | 3300048905 | Ga0496102_0018476 | Ga0496102_0018476_1501_2322 | 273 |
| 121 | 3300048906 | Ga0496103_0148481 | Ga0496103_0148481_129_950 | 273 |
| 122 | 3300048920 | Ga0496117_0060123 | Ga0496117_0060123_928_1749 | 273 |
| 123 | 3300048921 | Ga0496118_0002892 | Ga0496118_0002892_15849_16670 | 273 |
| 124 | 3300005329 | Ga0070683_100097685 | Ga0070683_1000976852 | 274 |
| 125 | 3300005334 | Ga0068869_100035108 | Ga0068869_1000351082 | 274 |
| 126 | 3300005347 | Ga0070668_100135484 | Ga0070668_1001354842 | 274 |
| 127 | 3300005353 | Ga0070669_100014698 | Ga0070669_1000146982 | 274 |
| 128 | 3300005354 | Ga0070675_100236273 | Ga0070675_1002362732 | 274 |
| 129 | 3300005356 | Ga0070674_100280033 | Ga0070674_1002800332 | 274 |
| 130 | 3300005365 | Ga0070688_100033363 | Ga0070688_1000333632 | 274 |
| 131 | 3300005367 | Ga0070667_100000487 | Ga0070667_1000004874 | 274 |
| 132 | 3300005435 | Ga0070714_100613305 | Ga0070714_1006133052 | 274 |
| 133 | 3300005455 | Ga0070663_100044819 | Ga0070663_1000448192 | 274 |
| 134 | 3300005466 | Ga0070685_10034804 | Ga0070685_100348043 | 274 |
| 135 | 3300005530 | Ga0070679_100382584 | Ga0070679_1003825842 | 274 |
| 136 | 3300005535 | Ga0070684_100326862 | Ga0070684_1003268622 | 274 |
| 137 | 3300005543 | Ga0070672_100147164 | Ga0070672_1001471642 | 274 |
| 138 | 3300005546 | Ga0070696_100430733 | Ga0070696_1004307331 | 274 |
| 139 | 3300005548 | Ga0070665_100025634 | Ga0070665_1000256346 | 274 |
| 140 | 3300005548 | Ga0070665_100052834 | Ga0070665_1000528342 | 274 |
| 141 | 3300005616 | Ga0068852_100061404 | Ga0068852_1000614042 | 274 |
| 142 | 3300005616 | Ga0068852_100443990 | Ga0068852_1004439902 | 274 |
| 143 | 3300005617 | Ga0068859_100001593 | Ga0068859_1000015937 | 274 |
| 144 | 3300005617 | Ga0068859_100039617 | Ga0068859_1000396172 | 274 |
| 145 | 3300005719 | Ga0068861_100053061 | Ga0068861_1000530613 | 274 |
| 146 | 3300005834 | Ga0068851_10053411 | Ga0068851_100534112 | 274 |
| 147 | 3300005841 | Ga0068863_100000143 | Ga0068863_10000014341 | 274 |
| 148 | 3300005842 | Ga0068858_100071964 | Ga0068858_1000719643 | 274 |
| 149 | 3300005842 | Ga0068858_100173277 | Ga0068858_1001732772 | 274 |
| 150 | 3300005843 | Ga0068860_100000079 | Ga0068860_100000079107 | 274 |
| 151 | 3300005844 | Ga0068862_100000093 | Ga0068862_10000009343 | 274 |
| 152 | 3300005844 | Ga0068862_100042656 | Ga0068862_1000426563 | 274 |
| 153 | 3300006038 | Ga0075365_10024094 | Ga0075365_100240943 | 274 |
| 154 | 3300006038 | Ga0075365_10039518 | Ga0075365_100395182 | 274 |
| 155 | 3300006038 | Ga0075365_10266804 | Ga0075365_102668042 | 274 |
| 156 | 3300006048 | Ga0075363_100005404 | Ga0075363_1000054043 | 274 |
| 157 | 3300006048 | Ga0075363_100021949 | Ga0075363_1000219492 | 274 |
| 158 | 3300006048 | Ga0075363_100049716 | Ga0075363_1000497162 | 274 |
| 159 | 3300006048 | Ga0075363_100190669 | Ga0075363_1001906691 | 274 |
| 160 | 3300006051 | Ga0075364_10004041 | Ga0075364_100040419 | 274 |
| 161 | 3300006051 | Ga0075364_10032394 | Ga0075364_100323942 | 274 |
| 162 | 3300006051 | Ga0075364_10235411 | Ga0075364_102354112 | 274 |
| 163 | 3300006163 | Ga0070715_10097834 | Ga0070715_100978342 | 274 |
| 164 | 3300006173 | Ga0070716_100297001 | Ga0070716_1002970012 | 274 |
| 165 | 3300006175 | Ga0070712_100015167 | Ga0070712_1000151674 | 274 |
| 166 | 3300006177 | Ga0075362_10028730 | Ga0075362_100287302 | 274 |
| 167 | 3300006178 | Ga0075367_10010291 | Ga0075367_100102912 | 274 |
| 168 | 3300006178 | Ga0075367_10082365 | Ga0075367_100823652 | 274 |
| 169 | 3300006186 | Ga0075369_10058467 | Ga0075369_100584672 | 274 |
| 170 | 3300006353 | Ga0075370_10010734 | Ga0075370_100107344 | 274 |
| 171 | 3300006353 | Ga0075370_10024117 | Ga0075370_100241172 | 274 |
| 172 | 3300006353 | Ga0075370_10025841 | Ga0075370_100258414 | 274 |
| 173 | 3300006844 | Ga0075428_100007875 | Ga0075428_1000078755 | 274 |
| 174 | 3300006846 | Ga0075430_100018039 | Ga0075430_1000180394 | 274 |
| 175 | 3300006881 | Ga0068865_100148738 | Ga0068865_1001487381 | 274 |
| 176 | 3300006931 | Ga0097620_100001593 | Ga0097620_10000159319 | 274 |
| 177 | 3300006931 | Ga0097620_100039617 | Ga0097620_1000396174 | 274 |
| 178 | 3300009098 | Ga0105245_10130542 | Ga0105245_101305422 | 274 |
| 179 | 3300009101 | Ga0105247_10000044 | Ga0105247_1000004423 | 274 |
| 180 | 3300009101 | Ga0105247_10034465 | Ga0105247_100344653 | 274 |
| 181 | 3300009147 | Ga0114129_10100127 | Ga0114129_101001274 | 274 |
| 182 | 3300009177 | Ga0105248_10000060 | Ga0105248_10000060104 | 274 |
| 183 | 3300009545 | Ga0105237_10001746 | Ga0105237_1000174633 | 274 |
| 184 | 3300009551 | Ga0105238_10068604 | Ga0105238_100686044 | 274 |
| 185 | 3300009553 | Ga0105249_10000049 | Ga0105249_10000049106 | 274 |
| 186 | 3300009553 | Ga0105249_10249935 | Ga0105249_102499352 | 274 |
| 187 | 3300009553 | Ga0105249_10408912 | Ga0105249_104089121 | 274 |
| 188 | 3300010375 | Ga0105239_10003558 | Ga0105239_1000355813 | 274 |
| 189 | 3300010375 | Ga0105239_10137217 | Ga0105239_101372173 | 274 |
| 190 | 3300010375 | Ga0105239_10339415 | Ga0105239_103394152 | 274 |
| 191 | 3300011119 | Ga0105246_10015077 | Ga0105246_100150775 | 274 |
| 192 | 3300013296 | Ga0157374_10103932 | Ga0157374_101039322 | 274 |
| 193 | 3300013297 | Ga0157378_10287840 | Ga0157378_102878402 | 274 |
| 194 | 3300013306 | Ga0163162_10058900 | Ga0163162_100589003 | 274 |
| 195 | 3300013306 | Ga0163162_10341042 | Ga0163162_103410421 | 274 |
| 196 | 3300013306 | Ga0163162_10539497 | Ga0163162_105394972 | 274 |
| 197 | 3300014325 | Ga0163163_10067722 | Ga0163163_100677224 | 274 |
| 198 | 3300014326 | Ga0157380_10106390 | Ga0157380_101063902 | 274 |
| 199 | 3300014745 | Ga0157377_10000892 | Ga0157377_100008927 | 274 |
| 200 | 3300014968 | Ga0157379_10612246 | Ga0157379_106122461 | 274 |
| 201 | 3300021384 | Ga0213876_10001760 | Ga0213876_100017604 | 274 |
| 202 | 3300021388 | Ga0213875_10018469 | Ga0213875_100184692 | 274 |
| 203 | 3300025303 | Ga0209051_1000776 | Ga0209051_100077625 | 274 |
| 204 | 3300025898 | Ga0207692_10156047 | Ga0207692_101560472 | 274 |
| 205 | 3300025899 | Ga0207642_10031402 | Ga0207642_100314021 | 274 |
| 206 | 3300025900 | Ga0207710_10000066 | Ga0207710_10000066107 | 274 |
| 207 | 3300025901 | Ga0207688_10016401 | Ga0207688_100164014 | 274 |
| 208 | 3300025905 | Ga0207685_10007375 | Ga0207685_100073752 | 274 |
| 209 | 3300025906 | Ga0207699_10084238 | Ga0207699_100842382 | 274 |
| 210 | 3300025914 | Ga0207671_10008052 | Ga0207671_100080528 | 274 |
| 211 | 3300025915 | Ga0207693_10002311 | Ga0207693_100023115 | 274 |
| 212 | 3300025916 | Ga0207663_10157453 | Ga0207663_101574532 | 274 |
| 213 | 3300025921 | Ga0207652_10412153 | Ga0207652_104121532 | 274 |
| 214 | 3300025923 | Ga0207681_10002233 | Ga0207681_100022334 | 274 |
| 215 | 3300025924 | Ga0207694_10050232 | Ga0207694_100502324 | 274 |
| 216 | 3300025926 | Ga0207659_10061826 | Ga0207659_100618262 | 274 |
| 217 | 3300025927 | Ga0207687_10068149 | Ga0207687_100681492 | 274 |
| 218 | 3300025932 | Ga0207690_10239644 | Ga0207690_102396442 | 274 |
| 219 | 3300025935 | Ga0207709_10414918 | Ga0207709_104149182 | 274 |
| 220 | 3300025937 | Ga0207669_10170811 | Ga0207669_101708112 | 274 |
| 221 | 3300025937 | Ga0207669_10203134 | Ga0207669_102031342 | 274 |
| 222 | 3300025937 | Ga0207669_10599841 | Ga0207669_105998411 | 274 |
| 223 | 3300025939 | Ga0207665_10061230 | Ga0207665_100612302 | 274 |
| 224 | 3300025940 | Ga0207691_10157649 | Ga0207691_101576492 | 274 |
| 225 | 3300025941 | Ga0207711_10000058 | Ga0207711_1000005817 | 274 |
| 226 | 3300025942 | Ga0207689_10074866 | Ga0207689_100748662 | 274 |
| 227 | 3300025961 | Ga0207712_10000038 | Ga0207712_10000038120 | 274 |
| 228 | 3300025961 | Ga0207712_10090968 | Ga0207712_100909682 | 274 |
| 229 | 3300025961 | Ga0207712_10099840 | Ga0207712_100998402 | 274 |
| 230 | 3300025972 | Ga0207668_10121008 | Ga0207668_101210082 | 274 |
| 231 | 3300025981 | Ga0207640_10279196 | Ga0207640_102791961 | 274 |
| 232 | 3300025986 | Ga0207658_10000061 | Ga0207658_10000061106 | 274 |
| 233 | 3300026035 | Ga0207703_10069764 | Ga0207703_100697642 | 274 |
| 234 | 3300026067 | Ga0207678_10039301 | Ga0207678_100393012 | 274 |
| 235 | 3300026067 | Ga0207678_10576849 | Ga0207678_105768491 | 274 |
| 236 | 3300026075 | Ga0207708_10017860 | Ga0207708_100178604 | 274 |
| 237 | 3300026078 | Ga0207702_10501162 | Ga0207702_105011622 | 274 |
| 238 | 3300026088 | Ga0207641_10000232 | Ga0207641_1000023242 | 274 |
| 239 | 3300026089 | Ga0207648_10037367 | Ga0207648_100373674 | 274 |
| 240 | 3300026118 | Ga0207675_100037611 | Ga0207675_1000376114 | 274 |
| 241 | 3300026118 | Ga0207675_100070125 | Ga0207675_1000701253 | 274 |
| 242 | 3300026118 | Ga0207675_100256663 | Ga0207675_1002566631 | 274 |
| 243 | 3300026121 | Ga0207683_10151606 | Ga0207683_101516062 | 274 |
| 244 | 3300026142 | Ga0207698_10032304 | Ga0207698_100323045 | 274 |
| 245 | 3300026142 | Ga0207698_10393654 | Ga0207698_103936542 | 274 |
| 246 | 3300027866 | Ga0209813_10080888 | Ga0209813_100808882 | 274 |
| 247 | 3300027907 | Ga0207428_10327152 | Ga0207428_103271522 | 274 |
| 248 | 3300028379 | Ga0268266_10018080 | Ga0268266_100180802 | 274 |
| 249 | 3300028380 | Ga0268265_10000053 | Ga0268265_1000005343 | 274 |
| 250 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017105 | 274 |
| 251 | 3300028381 | Ga0268264_10462886 | Ga0268264_104628861 | 274 |
| 252 | 3300031251 | Ga0265327_10000128 | Ga0265327_1000012895 | 274 |
| 253 | 3300031251 | Ga0265327_10006336 | Ga0265327_100063364 | 274 |
| 254 | 3300031548 | Ga0307408_100125838 | Ga0307408_1001258382 | 274 |
| 255 | 3300031824 | Ga0307413_10007594 | Ga0307413_100075942 | 274 |
| 256 | 3300031852 | Ga0307410_10016048 | Ga0307410_100160484 | 274 |
| 257 | 3300031852 | Ga0307410_10016844 | Ga0307410_100168444 | 274 |
| 258 | 3300031852 | Ga0307410_10492175 | Ga0307410_104921752 | 274 |
| 259 | 3300031901 | Ga0307406_10072081 | Ga0307406_100720812 | 274 |
| 260 | 3300031995 | Ga0307409_100003692 | Ga0307409_1000036928 | 274 |
| 261 | 3300031995 | Ga0307409_100201500 | Ga0307409_1002015002 | 274 |
| 262 | 3300032002 | Ga0307416_100023582 | Ga0307416_1000235823 | 274 |
| 263 | 3300032002 | Ga0307416_100215654 | Ga0307416_1002156542 | 274 |
| 264 | 3300032004 | Ga0307414_10159849 | Ga0307414_101598492 | 274 |
| 265 | 3300032126 | Ga0307415_100007009 | Ga0307415_1000070092 | 274 |
| 266 | 3300035112 | Ga0373932_0093643 | Ga0373932_0093643_15_839 | 274 |
| 267 | 3300037853 | Ga0436364_1545518 | Ga0436364_1545518_894_1718 | 274 |
| 268 | 3300039437 | Ga0436365_0271296 | Ga0436365_0271296_3367_4191 | 274 |
| 269 | 3300039437 | Ga0436365_0667324 | Ga0436365_0667324_249_1076 | 274 |
| 270 | 3300041413 | Ga0439465_0003069 | Ga0439465_0003069_3150_3974 | 274 |
| 271 | 3300044683 | Ga0466965_0078183 | Ga0466965_0078183_146_970 | 274 |
| 272 | 3300044684 | Ga0466966_0002596 | Ga0466966_0002596_2127_2951 | 274 |
| 273 | 3300044684 | Ga0466966_0250944 | Ga0466966_0250944_33_857 | 274 |
| 274 | 3300044693 | Ga0466961_0169704 | Ga0466961_0169704_275_1099 | 274 |
| 275 | 3300044694 | Ga0466963_0254140 | Ga0466963_0254140_165_989 | 274 |
| 276 | 3300044765 | Ga0466970_0034811 | Ga0466970_0034811_1497_2321 | 274 |
| 277 | 3300045049 | Ga0466959_0037158 | Ga0466959_0037158_468_1292 | 274 |
| 278 | 3300045836 | Ga0466958_0064199 | Ga0466958_0064199_1259_2083 | 274 |
| 279 | 3300045976 | Ga0466967_0109327 | Ga0466967_0109327_244_1068 | 274 |
| 280 | 3300045976 | Ga0466967_0599314 | Ga0466967_0599314_134_958 | 274 |
| 281 | 3300045976 | Ga0466967_0798539 | Ga0466967_0798539_64_888 | 274 |
| 282 | 3300047320 | Ga0495672_0124149 | Ga0495672_0124149_200_1024 | 274 |
| 283 | 3300048903 | Ga0496100_0002877 | Ga0496100_0002877_3194_4021 | 274 |
| 284 | 3300048903 | Ga0496100_0009461 | Ga0496100_0009461_377_1204 | 274 |
| 285 | 3300048903 | Ga0496100_0467895 | Ga0496100_0467895_95_919 | 274 |
| 286 | 3300048904 | Ga0496101_0000031 | Ga0496101_0000031_13338_14165 | 274 |
| 287 | 3300048904 | Ga0496101_0032368 | Ga0496101_0032368_182_1009 | 274 |
| 288 | 3300048905 | Ga0496102_0000065 | Ga0496102_0000065_59927_60754 | 274 |
| 289 | 3300048905 | Ga0496102_0000336 | Ga0496102_0000336_55637_56464 | 274 |
| 290 | 3300048905 | Ga0496102_0050101 | Ga0496102_0050101_12_836 | 274 |
| 291 | 3300048905 | Ga0496102_0078800 | Ga0496102_0078800_1860_2687 | 274 |
| 292 | 3300048905 | Ga0496102_0244389 | Ga0496102_0244389_280_1104 | 274 |
| 293 | 3300048906 | Ga0496103_0000048 | Ga0496103_0000048_59468_60295 | 274 |
| 294 | 3300048906 | Ga0496103_0000271 | Ga0496103_0000271_3921_4748 | 274 |
| 295 | 3300048906 | Ga0496103_0048212 | Ga0496103_0048212_546_1370 | 274 |
| 296 | 3300048907 | Ga0496104_0198545 | Ga0496104_0198545_391_1215 | 274 |
| 297 | 3300048908 | Ga0496105_0283264 | Ga0496105_0283264_36_863 | 274 |
| 298 | 3300048909 | Ga0496106_0098255 | Ga0496106_0098255_64_891 | 274 |
| 299 | 3300048910 | Ga0496107_0010437 | Ga0496107_0010437_5372_6199 | 274 |
| 300 | 3300048911 | Ga0496108_0001208 | Ga0496108_0001208_6365_7189 | 274 |
| 301 | 3300048912 | Ga0496109_0016720 | Ga0496109_0016720_853_1677 | 274 |
| 302 | 3300048913 | Ga0496110_0145954 | Ga0496110_0145954_193_1017 | 274 |
| 303 | 3300048915 | Ga0496112_0019097 | Ga0496112_0019097_5158_5982 | 274 |
| 304 | 3300048916 | Ga0496113_0202789 | Ga0496113_0202789_79_903 | 274 |
| 305 | 3300048917 | Ga0496114_0155902 | Ga0496114_0155902_852_1676 | 274 |
| 306 | 3300048918 | Ga0496115_0266868 | Ga0496115_0266868_273_1097 | 274 |
| 307 | 3300048919 | Ga0496116_0000125 | Ga0496116_0000125_100617_101444 | 274 |
| 308 | 3300048920 | Ga0496117_0000111 | Ga0496117_0000111_100617_101444 | 274 |
| 309 | 3300048920 | Ga0496117_0001352 | Ga0496117_0001352_26804_27631 | 274 |
| 310 | 3300048921 | Ga0496118_0000083 | Ga0496118_0000083_100617_101444 | 274 |
| 311 | 3300048922 | Ga0496119_0004014 | Ga0496119_0004014_10461_11288 | 274 |
| 312 | 3300048922 | Ga0496119_0010640 | Ga0496119_0010640_510_1337 | 274 |
| 313 | 3300048923 | Ga0496120_0001769 | Ga0496120_0001769_9650_10477 | 274 |
| 314 | 3300048923 | Ga0496120_0012983 | Ga0496120_0012983_696_1523 | 274 |
| 315 | 3300048924 | Ga0496121_0001000 | Ga0496121_0001000_40904_41731 | 274 |
| 316 | 3300048924 | Ga0496121_0009717 | Ga0496121_0009717_8740_9567 | 274 |
| 317 | 3300048927 | Ga0496124_0093145 | Ga0496124_0093145_755_1582 | 274 |
| 318 | 3300048929 | Ga0496126_0000220 | Ga0496126_0000220_17383_18210 | 274 |
| 319 | 3300048929 | Ga0496126_0004252 | Ga0496126_0004252_4479_5303 | 274 |
| 320 | 3300048929 | Ga0496126_0026981 | Ga0496126_0026981_30_857 | 274 |
| 321 | 3300048929 | Ga0496126_0061092 | Ga0496126_0061092_2195_3019 | 274 |
| 322 | 3300049581 | Ga0501047_0285267 | Ga0501047_0285267_85_912 | 274 |
| 323 | 3300049586 | Ga0501070_0072994 | Ga0501070_0072994_1578_2405 | 274 |
| 324 | 3300049586 | Ga0501070_0328633 | Ga0501070_0328633_21_845 | 274 |
| 325 | 3300050490 | nmdc:mga03n38_3117_c1 | nmdc:mga03n38_3117_c1_2319_3143 | 274 |
| 326 | 3300050491 | nmdc:mga00v17_137800_c1 | nmdc:mga00v17_137800_c1_207_1034 | 274 |
| 327 | 3300050491 | nmdc:mga00v17_231009_c1 | nmdc:mga00v17_231009_c1_269_1093 | 274 |
| 328 | 3300050491 | nmdc:mga00v17_33164_c1 | nmdc:mga00v17_33164_c1_408_1235 | 274 |
| 329 | 3300050491 | nmdc:mga00v17_5765_c1 | nmdc:mga00v17_5765_c1_5612_6436 | 274 |
| 330 | 3300050492 | nmdc:mga0yw44_106161_c1 | nmdc:mga0yw44_106161_c1_184_1008 | 274 |
| 331 | 3300050492 | nmdc:mga0yw44_234951_c1 | nmdc:mga0yw44_234951_c1_280_1107 | 274 |
| 332 | 3300050492 | nmdc:mga0yw44_29716_c1 | nmdc:mga0yw44_29716_c1_384_1211 | 274 |
| 333 | 3300050492 | nmdc:mga0yw44_4095_c1 | nmdc:mga0yw44_4095_c1_2377_3201 | 274 |
| 334 | 3300050494 | nmdc:mga06z11_119734_c1 | nmdc:mga06z11_119734_c1_317_1144 | 274 |
| 335 | 3300050496 | nmdc:mga07m45_15921_c1 | nmdc:mga07m45_15921_c1_2159_2986 | 274 |
| 336 | 3300050507 | nmdc:mga05p37_292603_c1 | nmdc:mga05p37_292603_c1_764_1588 | 274 |
| 337 | 3300050509 | nmdc:mga0qj67_4393_c1 | nmdc:mga0qj67_4393_c1_8873_9697 | 274 |
| 338 | 3300050510 | nmdc:mga06r32_27527_c1 | nmdc:mga06r32_27527_c1_2321_3145 | 274 |
| 339 | 3300050511 | nmdc:mga08y16_180117_c1 | nmdc:mga08y16_180117_c1_656_1483 | 274 |
| 340 | 3300050516 | nmdc:mga0sz30_112759_c1 | nmdc:mga0sz30_112759_c1_291_1115 | 274 |
| 341 | 3300053080 | Ga0500635_0158296 | Ga0500635_0158296_32_856 | 274 |
| 342 | 3300053104 | Ga0500556_0075347 | Ga0500556_0075347_383_1210 | 274 |
| 343 | 3300053108 | Ga0500562_005526 | Ga0500562_005526_333_1160 | 274 |
| 344 | 3300053130 | Ga0500642_0098975 | Ga0500642_0098975_138_962 | 274 |
| 345 | 3300053136 | Ga0500559_0027977 | Ga0500559_0027977_827_1651 | 274 |
| 346 | 3300053730 | Ga0500645_000056 | Ga0500645_000056_11327_12151 | 274 |
| 347 | 3300002077 | JGI24744J21845_10001723 | JGI24744J21845_100017233 | 275 |
| 348 | 3300002459 | JGI24751J29686_10003832 | JGI24751J29686_100038322 | 275 |
| 349 | 3300003320 | rootH2_10026628 | rootH2_100266282 | 275 |
| 350 | 3300003792 | Ga0055540_1000071 | Ga0055540_1000071101 | 275 |
| 351 | 3300005328 | Ga0070676_10020266 | Ga0070676_100202662 | 275 |
| 352 | 3300005330 | Ga0070690_100009227 | Ga0070690_1000092273 | 275 |
| 353 | 3300005334 | Ga0068869_100112349 | Ga0068869_1001123492 | 275 |
| 354 | 3300005335 | Ga0070666_10041951 | Ga0070666_100419514 | 275 |
| 355 | 3300005337 | Ga0070682_100143051 | Ga0070682_1001430512 | 275 |
| 356 | 3300005337 | Ga0070682_100209449 | Ga0070682_1002094492 | 275 |
| 357 | 3300005338 | Ga0068868_100245685 | Ga0068868_1002456852 | 275 |
| 358 | 3300005339 | Ga0070660_100081262 | Ga0070660_1000812622 | 275 |
| 359 | 3300005341 | Ga0070691_10009713 | Ga0070691_100097132 | 275 |
| 360 | 3300005347 | Ga0070668_100064945 | Ga0070668_1000649452 | 275 |
| 361 | 3300005355 | Ga0070671_100012917 | Ga0070671_1000129175 | 275 |
| 362 | 3300005355 | Ga0070671_100072449 | Ga0070671_1000724492 | 275 |
| 363 | 3300005356 | Ga0070674_100029289 | Ga0070674_1000292894 | 275 |
| 364 | 3300005365 | Ga0070688_100083368 | Ga0070688_1000833682 | 275 |
| 365 | 3300005366 | Ga0070659_100028276 | Ga0070659_1000282765 | 275 |
| 366 | 3300005367 | Ga0070667_100000324 | Ga0070667_1000003245 | 275 |
| 367 | 3300005367 | Ga0070667_100051434 | Ga0070667_1000514342 | 275 |
| 368 | 3300005367 | Ga0070667_100249837 | Ga0070667_1002498372 | 275 |
| 369 | 3300005434 | Ga0070709_10020029 | Ga0070709_100200295 | 275 |
| 370 | 3300005435 | Ga0070714_100005497 | Ga0070714_1000054972 | 275 |
| 371 | 3300005435 | Ga0070714_100105457 | Ga0070714_1001054573 | 275 |
| 372 | 3300005435 | Ga0070714_100240534 | Ga0070714_1002405342 | 275 |
| 373 | 3300005436 | Ga0070713_100098824 | Ga0070713_1000988242 | 275 |
| 374 | 3300005437 | Ga0070710_10000927 | Ga0070710_1000092712 | 275 |
| 375 | 3300005437 | Ga0070710_10051683 | Ga0070710_100516832 | 275 |
| 376 | 3300005438 | Ga0070701_10001711 | Ga0070701_100017116 | 275 |
| 377 | 3300005439 | Ga0070711_100003543 | Ga0070711_1000035436 | 275 |
| 378 | 3300005440 | Ga0070705_100004167 | Ga0070705_1000041678 | 275 |
| 379 | 3300005441 | Ga0070700_100032254 | Ga0070700_1000322544 | 275 |
| 380 | 3300005455 | Ga0070663_100007666 | Ga0070663_1000076664 | 275 |
| 381 | 3300005455 | Ga0070663_100009243 | Ga0070663_1000092436 | 275 |
| 382 | 3300005456 | Ga0070678_100001013 | Ga0070678_10000101312 | 275 |
| 383 | 3300005457 | Ga0070662_100071228 | Ga0070662_1000712282 | 275 |
| 384 | 3300005459 | Ga0068867_100008434 | Ga0068867_1000084346 | 275 |
| 385 | 3300005466 | Ga0070685_10043257 | Ga0070685_100432572 | 275 |
| 386 | 3300005543 | Ga0070672_100144039 | Ga0070672_1001440392 | 275 |
| 387 | 3300005543 | Ga0070672_100347558 | Ga0070672_1003475582 | 275 |
| 388 | 3300005544 | Ga0070686_100253374 | Ga0070686_1002533742 | 275 |
| 389 | 3300005545 | Ga0070695_100032619 | Ga0070695_1000326195 | 275 |
| 390 | 3300005546 | Ga0070696_100010973 | Ga0070696_1000109735 | 275 |
| 391 | 3300005548 | Ga0070665_100024159 | Ga0070665_1000241594 | 275 |
| 392 | 3300005548 | Ga0070665_100039882 | Ga0070665_1000398824 | 275 |
| 393 | 3300005549 | Ga0070704_100010458 | Ga0070704_1000104584 | 275 |
| 394 | 3300005578 | Ga0068854_100001661 | Ga0068854_1000016616 | 275 |
| 395 | 3300005614 | Ga0068856_100403371 | Ga0068856_1004033712 | 275 |
| 396 | 3300005615 | Ga0070702_100016568 | Ga0070702_1000165685 | 275 |
| 397 | 3300005615 | Ga0070702_100355001 | Ga0070702_1003550011 | 275 |
| 398 | 3300005616 | Ga0068852_100094130 | Ga0068852_1000941302 | 275 |
| 399 | 3300005617 | Ga0068859_100012513 | Ga0068859_1000125138 | 275 |
| 400 | 3300005617 | Ga0068859_100408678 | Ga0068859_1004086782 | 275 |
| 401 | 3300005617 | Ga0068859_100472641 | Ga0068859_1004726412 | 275 |
| 402 | 3300005841 | Ga0068863_100003638 | Ga0068863_1000036385 | 275 |
| 403 | 3300005841 | Ga0068863_100091564 | Ga0068863_1000915642 | 275 |
| 404 | 3300005842 | Ga0068858_100072593 | Ga0068858_1000725932 | 275 |
| 405 | 3300005843 | Ga0068860_100005332 | Ga0068860_10000533211 | 275 |
| 406 | 3300005843 | Ga0068860_100607901 | Ga0068860_1006079012 | 275 |
| 407 | 3300005844 | Ga0068862_100073395 | Ga0068862_1000733953 | 275 |
| 408 | 3300005844 | Ga0068862_100235685 | Ga0068862_1002356852 | 275 |
| 409 | 3300006038 | Ga0075365_10004388 | Ga0075365_100043882 | 275 |
| 410 | 3300006048 | Ga0075363_100001134 | Ga0075363_1000011344 | 275 |
| 411 | 3300006048 | Ga0075363_100014757 | Ga0075363_1000147572 | 275 |
| 412 | 3300006048 | Ga0075363_100034794 | Ga0075363_1000347942 | 275 |
| 413 | 3300006051 | Ga0075364_10005464 | Ga0075364_100054642 | 275 |
| 414 | 3300006051 | Ga0075364_10006554 | Ga0075364_100065548 | 275 |
| 415 | 3300006051 | Ga0075364_10024282 | Ga0075364_100242822 | 275 |
| 416 | 3300006175 | Ga0070712_100009663 | Ga0070712_1000096634 | 275 |
| 417 | 3300006177 | Ga0075362_10040478 | Ga0075362_100404782 | 275 |
| 418 | 3300006186 | Ga0075369_10000029 | Ga0075369_1000002910 | 275 |
| 419 | 3300006186 | Ga0075369_10048200 | Ga0075369_100482002 | 275 |
| 420 | 3300006237 | Ga0097621_100008957 | Ga0097621_1000089578 | 275 |
| 421 | 3300006881 | Ga0068865_100031398 | Ga0068865_1000313983 | 275 |
| 422 | 3300006931 | Ga0097620_100012512 | Ga0097620_1000125128 | 275 |
| 423 | 3300006931 | Ga0097620_100408685 | Ga0097620_1004086852 | 275 |
| 424 | 3300006931 | Ga0097620_100472679 | Ga0097620_1004726792 | 275 |
| 425 | 3300009098 | Ga0105245_10006858 | Ga0105245_100068586 | 275 |
| 426 | 3300009098 | Ga0105245_10365107 | Ga0105245_103651072 | 275 |
| 427 | 3300009098 | Ga0105245_10674334 | Ga0105245_106743341 | 275 |
| 428 | 3300009101 | Ga0105247_10002130 | Ga0105247_100021306 | 275 |
| 429 | 3300009148 | Ga0105243_10011604 | Ga0105243_100116044 | 275 |
| 430 | 3300009174 | Ga0105241_10017700 | Ga0105241_100177005 | 275 |
| 431 | 3300009176 | Ga0105242_10002099 | Ga0105242_100020994 | 275 |
| 432 | 3300009545 | Ga0105237_10027148 | Ga0105237_100271487 | 275 |
| 433 | 3300009553 | Ga0105249_10006471 | Ga0105249_1000647110 | 275 |
| 434 | 3300009553 | Ga0105249_10031917 | Ga0105249_100319172 | 275 |
| 435 | 3300009553 | Ga0105249_10526973 | Ga0105249_105269732 | 275 |
| 436 | 3300010375 | Ga0105239_10136848 | Ga0105239_101368484 | 275 |
| 437 | 3300011119 | Ga0105246_10252536 | Ga0105246_102525362 | 275 |
| 438 | 3300011119 | Ga0105246_10311319 | Ga0105246_103113192 | 275 |
| 439 | 3300013297 | Ga0157378_10006985 | Ga0157378_100069852 | 275 |
| 440 | 3300013306 | Ga0163162_10061855 | Ga0163162_100618552 | 275 |
| 441 | 3300013307 | Ga0157372_10021406 | Ga0157372_100214064 | 275 |
| 442 | 3300013308 | Ga0157375_10090288 | Ga0157375_100902883 | 275 |
| 443 | 3300014325 | Ga0163163_10045830 | Ga0163163_100458303 | 275 |
| 444 | 3300014325 | Ga0163163_10464585 | Ga0163163_104645852 | 275 |
| 445 | 3300014325 | Ga0163163_10488096 | Ga0163163_104880961 | 275 |
| 446 | 3300014326 | Ga0157380_10003346 | Ga0157380_1000334610 | 275 |
| 447 | 3300014745 | Ga0157377_10098470 | Ga0157377_100984702 | 275 |
| 448 | 3300014968 | Ga0157379_10076026 | Ga0157379_100760262 | 275 |
| 449 | 3300017792 | Ga0163161_10001520 | Ga0163161_1000152016 | 275 |
| 450 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033334 | 275 |
| 451 | 3300025303 | Ga0209051_1014386 | Ga0209051_10143861 | 275 |
| 452 | 3300025898 | Ga0207692_10026329 | Ga0207692_100263293 | 275 |
| 453 | 3300025898 | Ga0207692_10110014 | Ga0207692_101100142 | 275 |
| 454 | 3300025900 | Ga0207710_10007366 | Ga0207710_100073662 | 275 |
| 455 | 3300025901 | Ga0207688_10001970 | Ga0207688_100019702 | 275 |
| 456 | 3300025903 | Ga0207680_10080750 | Ga0207680_100807502 | 275 |
| 457 | 3300025904 | Ga0207647_10039971 | Ga0207647_100399712 | 275 |
| 458 | 3300025906 | Ga0207699_10023723 | Ga0207699_100237232 | 275 |
| 459 | 3300025907 | Ga0207645_10011325 | Ga0207645_100113254 | 275 |
| 460 | 3300025915 | Ga0207693_10000197 | Ga0207693_100001975 | 275 |
| 461 | 3300025916 | Ga0207663_10128567 | Ga0207663_101285672 | 275 |
| 462 | 3300025923 | Ga0207681_10083257 | Ga0207681_100832573 | 275 |
| 463 | 3300025927 | Ga0207687_10235839 | Ga0207687_102358392 | 275 |
| 464 | 3300025928 | Ga0207700_10017600 | Ga0207700_100176002 | 275 |
| 465 | 3300025929 | Ga0207664_10082060 | Ga0207664_100820602 | 275 |
| 466 | 3300025929 | Ga0207664_10144061 | Ga0207664_101440612 | 275 |
| 467 | 3300025931 | Ga0207644_10019633 | Ga0207644_100196332 | 275 |
| 468 | 3300025932 | Ga0207690_10347956 | Ga0207690_103479562 | 275 |
| 469 | 3300025933 | Ga0207706_10002775 | Ga0207706_100027756 | 275 |
| 470 | 3300025935 | Ga0207709_10012393 | Ga0207709_100123934 | 275 |
| 471 | 3300025936 | Ga0207670_10050027 | Ga0207670_100500272 | 275 |
| 472 | 3300025937 | Ga0207669_10004342 | Ga0207669_100043426 | 275 |
| 473 | 3300025939 | Ga0207665_10007522 | Ga0207665_100075226 | 275 |
| 474 | 3300025940 | Ga0207691_10079226 | Ga0207691_100792262 | 275 |
| 475 | 3300025941 | Ga0207711_10023946 | Ga0207711_100239464 | 275 |
| 476 | 3300025942 | Ga0207689_10045502 | Ga0207689_100455023 | 275 |
| 477 | 3300025949 | Ga0207667_10129394 | Ga0207667_101293942 | 275 |
| 478 | 3300025960 | Ga0207651_10694486 | Ga0207651_106944861 | 275 |
| 479 | 3300025972 | Ga0207668_10001652 | Ga0207668_100016524 | 275 |
| 480 | 3300025972 | Ga0207668_10025482 | Ga0207668_100254822 | 275 |
| 481 | 3300025981 | Ga0207640_10059653 | Ga0207640_100596532 | 275 |
| 482 | 3300025986 | Ga0207658_10006720 | Ga0207658_100067207 | 275 |
| 483 | 3300026023 | Ga0207677_10006626 | Ga0207677_100066264 | 275 |
| 484 | 3300026023 | Ga0207677_10207403 | Ga0207677_102074032 | 275 |
| 485 | 3300026067 | Ga0207678_10010285 | Ga0207678_100102854 | 275 |
| 486 | 3300026075 | Ga0207708_10003700 | Ga0207708_100037005 | 275 |
| 487 | 3300026078 | Ga0207702_10359874 | Ga0207702_103598742 | 275 |
| 488 | 3300026088 | Ga0207641_10006641 | Ga0207641_100066416 | 275 |
| 489 | 3300026088 | Ga0207641_10127987 | Ga0207641_101279872 | 275 |
| 490 | 3300026089 | Ga0207648_10004179 | Ga0207648_100041794 | 275 |
| 491 | 3300026118 | Ga0207675_100003156 | Ga0207675_1000031566 | 275 |
| 492 | 3300026121 | Ga0207683_10003067 | Ga0207683_1000306712 | 275 |
| 493 | 3300027866 | Ga0209813_10049296 | Ga0209813_100492962 | 275 |
| 494 | 3300028379 | Ga0268266_10009675 | Ga0268266_100096755 | 275 |
| 495 | 3300028381 | Ga0268264_10027953 | Ga0268264_100279533 | 275 |
| 496 | 3300028381 | Ga0268264_10515638 | Ga0268264_105156381 | 275 |
| 497 | 3300031251 | Ga0265327_10002212 | Ga0265327_1000221221 | 275 |
| 498 | 3300037466 | Ga0395898_0373492 | Ga0395898_0373492_133_960 | 275 |
| 499 | 3300038443 | Ga0395901_0542194 | Ga0395901_0542194_208_1035 | 275 |
| 500 | 3300039437 | Ga0436365_0039491 | Ga0436365_0039491_2117_2944 | 275 |
| 501 | 3300039438 | Ga0436360_0933631 | Ga0436360_0933631_42_869 | 275 |
| 502 | 3300041411 | Ga0439466_0006376 | Ga0439466_0006376_2729_3556 | 275 |
| 503 | 3300041413 | Ga0439465_0005177 | Ga0439465_0005177_2935_3762 | 275 |
| 504 | 3300041451 | Ga0451791_1164627 | Ga0451791_1164627_128_991 | 275 |
| 505 | 3300041491 | Ga0451833_1108409 | Ga0451833_1108409_217_1071 | 275 |
| 506 | 3300042002 | Ga0439442_008348 | Ga0439442_008348_261_1088 | 275 |
| 507 | 3300042435 | Ga0439434_0005195 | Ga0439434_0005195_630_1457 | 275 |
| 508 | 3300042436 | Ga0439435_0025868 | Ga0439435_0025868_707_1534 | 275 |
| 509 | 3300044658 | Ga0466972_0001604 | Ga0466972_0001604_8984_9838 | 275 |
| 510 | 3300044658 | Ga0466972_0015260 | Ga0466972_0015260_2685_3512 | 275 |
| 511 | 3300044658 | Ga0466972_0028614 | Ga0466972_0028614_1001_1828 | 275 |
| 512 | 3300044658 | Ga0466972_0060937 | Ga0466972_0060937_318_1145 | 275 |
| 513 | 3300044683 | Ga0466965_0000732 | Ga0466965_0000732_6820_7647 | 275 |
| 514 | 3300044683 | Ga0466965_0009878 | Ga0466965_0009878_1262_2089 | 275 |
| 515 | 3300044683 | Ga0466965_0029526 | Ga0466965_0029526_1252_2079 | 275 |
| 516 | 3300044684 | Ga0466966_0030448 | Ga0466966_0030448_16_843 | 275 |
| 517 | 3300044693 | Ga0466961_0016015 | Ga0466961_0016015_335_1162 | 275 |
| 518 | 3300044706 | Ga0466964_0132745 | Ga0466964_0132745_252_1079 | 275 |
| 519 | 3300044719 | Ga0466971_0003487 | Ga0466971_0003487_3073_3900 | 275 |
| 520 | 3300044719 | Ga0466971_0029775 | Ga0466971_0029775_588_1415 | 275 |
| 521 | 3300044735 | Ga0466968_0007528 | Ga0466968_0007528_482_1336 | 275 |
| 522 | 3300044735 | Ga0466968_0062049 | Ga0466968_0062049_643_1470 | 275 |
| 523 | 3300044765 | Ga0466970_0004676 | Ga0466970_0004676_2356_3183 | 275 |
| 524 | 3300044765 | Ga0466970_0086437 | Ga0466970_0086437_41_895 | 275 |
| 525 | 3300044842 | Ga0466957_0001665 | Ga0466957_0001665_1209_2063 | 275 |
| 526 | 3300044842 | Ga0466957_0097691 | Ga0466957_0097691_143_970 | 275 |
| 527 | 3300044901 | Ga0466960_0000220 | Ga0466960_0000220_8646_9473 | 275 |
| 528 | 3300044901 | Ga0466960_0001412 | Ga0466960_0001412_5420_6247 | 275 |
| 529 | 3300045049 | Ga0466959_0020200 | Ga0466959_0020200_421_1248 | 275 |
| 530 | 3300045049 | Ga0466959_0307855 | Ga0466959_0307855_238_1065 | 275 |
| 531 | 3300045836 | Ga0466958_0013952 | Ga0466958_0013952_888_1715 | 275 |
| 532 | 3300045836 | Ga0466958_0024005 | Ga0466958_0024005_19_846 | 275 |
| 533 | 3300045836 | Ga0466958_0047984 | Ga0466958_0047984_897_1751 | 275 |
| 534 | 3300045976 | Ga0466967_0001559 | Ga0466967_0001559_609_1463 | 275 |
| 535 | 3300045976 | Ga0466967_0014046 | Ga0466967_0014046_4691_5518 | 275 |
| 536 | 3300045976 | Ga0466967_0564149 | Ga0466967_0564149_269_1096 | 275 |
| 537 | 3300046459 | Ga0495629_0211148 | Ga0495629_0211148_286_1116 | 275 |
| 538 | 3300046460 | Ga0495638_0044175 | Ga0495638_0044175_162_992 | 275 |
| 539 | 3300046474 | Ga0495605_0075416 | Ga0495605_0075416_22_852 | 275 |
| 540 | 3300046475 | Ga0495639_0033636 | Ga0495639_0033636_1253_2083 | 275 |
| 541 | 3300046506 | Ga0495583_0034916 | Ga0495583_0034916_1137_1964 | 275 |
| 542 | 3300046507 | Ga0495606_0119408 | Ga0495606_0119408_726_1553 | 275 |
| 543 | 3300046533 | Ga0495640_0061351 | Ga0495640_0061351_553_1383 | 275 |
| 544 | 3300046616 | Ga0495668_0068491 | Ga0495668_0068491_65_892 | 275 |
| 545 | 3300046616 | Ga0495668_0215480 | Ga0495668_0215480_128_955 | 275 |
| 546 | 3300046642 | Ga0495634_0209697 | Ga0495634_0209697_296_1126 | 275 |
| 547 | 3300046683 | Ga0495658_0001869 | Ga0495658_0001869_8160_8990 | 275 |
| 548 | 3300046689 | Ga0495613_0191486 | Ga0495613_0191486_237_1067 | 275 |
| 549 | 3300047319 | Ga0495674_0150867 | Ga0495674_0150867_480_1310 | 275 |
| 550 | 3300047320 | Ga0495672_0004722 | Ga0495672_0004722_683_1510 | 275 |
| 551 | 3300047472 | Ga0495686_0158115 | Ga0495686_0158115_433_1293 | 275 |
| 552 | 3300047673 | Ga0495593_0018433 | Ga0495593_0018433_792_1622 | 275 |
| 553 | 3300048903 | Ga0496100_0000029 | Ga0496100_0000029_82581_83447 | 275 |
| 554 | 3300048903 | Ga0496100_0000798 | Ga0496100_0000798_479_1342 | 275 |
| 555 | 3300048903 | Ga0496100_0019765 | Ga0496100_0019765_1689_2516 | 275 |
| 556 | 3300048904 | Ga0496101_0000015 | Ga0496101_0000015_51251_52117 | 275 |
| 557 | 3300048904 | Ga0496101_0008430 | Ga0496101_0008430_107_970 | 275 |
| 558 | 3300048905 | Ga0496102_0020404 | Ga0496102_0020404_1650_2477 | 275 |
| 559 | 3300048905 | Ga0496102_0029754 | Ga0496102_0029754_1344_2210 | 275 |
| 560 | 3300048905 | Ga0496102_0057448 | Ga0496102_0057448_1040_1870 | 275 |
| 561 | 3300048906 | Ga0496103_0001418 | Ga0496103_0001418_1939_2805 | 275 |
| 562 | 3300048906 | Ga0496103_0018080 | Ga0496103_0018080_3181_4008 | 275 |
| 563 | 3300048906 | Ga0496103_0094537 | Ga0496103_0094537_653_1480 | 275 |
| 564 | 3300048907 | Ga0496104_0027595 | Ga0496104_0027595_2783_3610 | 275 |
| 565 | 3300048909 | Ga0496106_0000396 | Ga0496106_0000396_22815_23681 | 275 |
| 566 | 3300048909 | Ga0496106_0006462 | Ga0496106_0006462_4713_5576 | 275 |
| 567 | 3300048910 | Ga0496107_0000649 | Ga0496107_0000649_13286_14149 | 275 |
| 568 | 3300048910 | Ga0496107_0009198 | Ga0496107_0009198_3884_4711 | 275 |
| 569 | 3300048910 | Ga0496107_0014326 | Ga0496107_0014326_2542_3408 | 275 |
| 570 | 3300048911 | Ga0496108_0013765 | Ga0496108_0013765_2530_3357 | 275 |
| 571 | 3300048911 | Ga0496108_0038239 | Ga0496108_0038239_2571_3437 | 275 |
| 572 | 3300048912 | Ga0496109_0000022 | Ga0496109_0000022_3396_4262 | 275 |
| 573 | 3300048912 | Ga0496109_0011896 | Ga0496109_0011896_2024_2851 | 275 |
| 574 | 3300048912 | Ga0496109_0125113 | Ga0496109_0125113_203_1066 | 275 |
| 575 | 3300048913 | Ga0496110_0004126 | Ga0496110_0004126_6302_7168 | 275 |
| 576 | 3300048913 | Ga0496110_0243188 | Ga0496110_0243188_747_1574 | 275 |
| 577 | 3300048914 | Ga0496111_0050073 | Ga0496111_0050073_1901_2728 | 275 |
| 578 | 3300048915 | Ga0496112_0002704 | Ga0496112_0002704_2276_3103 | 275 |
| 579 | 3300048915 | Ga0496112_0185734 | Ga0496112_0185734_727_1554 | 275 |
| 580 | 3300048915 | Ga0496112_0513419 | Ga0496112_0513419_220_1047 | 275 |
| 581 | 3300048917 | Ga0496114_0000716 | Ga0496114_0000716_14854_15720 | 275 |
| 582 | 3300048917 | Ga0496114_0002600 | Ga0496114_0002600_7447_8310 | 275 |
| 583 | 3300048917 | Ga0496114_0027672 | Ga0496114_0027672_2752_3579 | 275 |
| 584 | 3300048918 | Ga0496115_0004673 | Ga0496115_0004673_3030_3893 | 275 |
| 585 | 3300048918 | Ga0496115_0018996 | Ga0496115_0018996_3888_4754 | 275 |
| 586 | 3300048919 | Ga0496116_0003462 | Ga0496116_0003462_3865_4731 | 275 |
| 587 | 3300048920 | Ga0496117_0008331 | Ga0496117_0008331_5933_6799 | 275 |
| 588 | 3300048921 | Ga0496118_0025250 | Ga0496118_0025250_3065_3931 | 275 |
| 589 | 3300048922 | Ga0496119_0007493 | Ga0496119_0007493_4472_5338 | 275 |
| 590 | 3300048923 | Ga0496120_0021299 | Ga0496120_0021299_205_1071 | 275 |
| 591 | 3300048923 | Ga0496120_0061325 | Ga0496120_0061325_977_1840 | 275 |
| 592 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_586381_587247 | 275 |
| 593 | 3300048925 | Ga0496122_0000138 | Ga0496122_0000138_88364_89230 | 275 |
| 594 | 3300048925 | Ga0496122_0040074 | Ga0496122_0040074_2157_3020 | 275 |
| 595 | 3300048925 | Ga0496122_0125513 | Ga0496122_0125513_110_970 | 275 |
| 596 | 3300048926 | Ga0496123_0024813 | Ga0496123_0024813_2174_3037 | 275 |
| 597 | 3300048926 | Ga0496123_0034379 | Ga0496123_0034379_2223_3089 | 275 |
| 598 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_311174_312040 | 275 |
| 599 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_602521_603387 | 275 |
| 600 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_586381_587247 | 275 |
| 601 | 3300049569 | Ga0501032_0010663 | Ga0501032_0010663_2648_3475 | 275 |
| 602 | 3300049570 | Ga0501033_0007899 | Ga0501033_0007899_5680_6507 | 275 |
| 603 | 3300049570 | Ga0501033_0391902 | Ga0501033_0391902_50_877 | 275 |
| 604 | 3300049571 | Ga0501034_0007790 | Ga0501034_0007790_2034_2861 | 275 |
| 605 | 3300049571 | Ga0501034_0016717 | Ga0501034_0016717_5610_6437 | 275 |
| 606 | 3300049572 | Ga0501036_0008446 | Ga0501036_0008446_504_1331 | 275 |
| 607 | 3300049573 | Ga0501037_0000219 | Ga0501037_0000219_22818_23645 | 275 |
| 608 | 3300049573 | Ga0501037_0010691 | Ga0501037_0010691_4907_5734 | 275 |
| 609 | 3300049574 | Ga0501038_0059297 | Ga0501038_0059297_2224_3051 | 275 |
| 610 | 3300049575 | Ga0501039_0000675 | Ga0501039_0000675_19821_20648 | 275 |
| 611 | 3300049579 | Ga0501043_0001226 | Ga0501043_0001226_4288_5115 | 275 |
| 612 | 3300049579 | Ga0501043_0071941 | Ga0501043_0071941_1031_1858 | 275 |
| 613 | 3300049580 | Ga0501046_0000302 | Ga0501046_0000302_38338_39165 | 275 |
| 614 | 3300049580 | Ga0501046_0190763 | Ga0501046_0190763_298_1125 | 275 |
| 615 | 3300049581 | Ga0501047_0017099 | Ga0501047_0017099_4490_5317 | 275 |
| 616 | 3300049581 | Ga0501047_0146835 | Ga0501047_0146835_979_1806 | 275 |
| 617 | 3300049582 | Ga0501048_0032945 | Ga0501048_0032945_1965_2792 | 275 |
| 618 | 3300049585 | Ga0501069_0230739 | Ga0501069_0230739_103_930 | 275 |
| 619 | 3300049586 | Ga0501070_0004586 | Ga0501070_0004586_7738_8565 | 275 |
| 620 | 3300049586 | Ga0501070_0004633 | Ga0501070_0004633_6062_6889 | 275 |
| 621 | 3300049587 | Ga0501071_0116742 | Ga0501071_0116742_683_1510 | 275 |
| 622 | 3300049589 | Ga0501073_0058018 | Ga0501073_0058018_1740_2567 | 275 |
| 623 | 3300049589 | Ga0501073_0419434 | Ga0501073_0419434_64_891 | 275 |
| 624 | 3300049822 | Ga0501035_0000665 | Ga0501035_0000665_10790_11617 | 275 |
| 625 | 3300049822 | Ga0501035_0000742 | Ga0501035_0000742_32340_33167 | 275 |
| 626 | 3300049823 | Ga0501044_0000313 | Ga0501044_0000313_49354_50181 | 275 |
| 627 | 3300049823 | Ga0501044_0001249 | Ga0501044_0001249_24859_25686 | 275 |
| 628 | 3300049823 | Ga0501044_0076396 | Ga0501044_0076396_1982_2809 | 275 |
| 629 | 3300050489 | nmdc:mga03683_62412_c1 | nmdc:mga03683_62412_c1_363_1220 | 275 |
| 630 | 3300050490 | nmdc:mga03n38_48465_c1 | nmdc:mga03n38_48465_c1_852_1679 | 275 |
| 631 | 3300050490 | nmdc:mga03n38_514_c1 | nmdc:mga03n38_514_c1_2567_3424 | 275 |
| 632 | 3300050490 | nmdc:mga03n38_77644_c1 | nmdc:mga03n38_77644_c1_72_899 | 275 |
| 633 | 3300050490 | nmdc:mga03n38_85572_c1 | nmdc:mga03n38_85572_c1_437_1264 | 275 |
| 634 | 3300050491 | nmdc:mga00v17_13060_c1 | nmdc:mga00v17_13060_c1_603_1430 | 275 |
| 635 | 3300050491 | nmdc:mga00v17_168840_c1 | nmdc:mga00v17_168840_c1_296_1123 | 275 |
| 636 | 3300050491 | nmdc:mga00v17_681_c1 | nmdc:mga00v17_681_c1_16487_17317 | 275 |
| 637 | 3300050492 | nmdc:mga0yw44_40108_c1 | nmdc:mga0yw44_40108_c1_965_1822 | 275 |
| 638 | 3300050492 | nmdc:mga0yw44_47764_c1 | nmdc:mga0yw44_47764_c1_1543_2373 | 275 |
| 639 | 3300050493 | nmdc:mga0k408_262536_c1 | nmdc:mga0k408_262536_c1_44_901 | 275 |
| 640 | 3300050494 | nmdc:mga06z11_13513_c1 | nmdc:mga06z11_13513_c1_2597_3454 | 275 |
| 641 | 3300050494 | nmdc:mga06z11_41642_c1 | nmdc:mga06z11_41642_c1_1419_2246 | 275 |
| 642 | 3300050495 | nmdc:mga04h51_18774_c1 | nmdc:mga04h51_18774_c1_318_1175 | 275 |
| 643 | 3300050496 | nmdc:mga07m45_2877_c1 | nmdc:mga07m45_2877_c1_4633_5490 | 275 |
| 644 | 3300050496 | nmdc:mga07m45_300213_c1 | nmdc:mga07m45_300213_c1_12_839 | 275 |
| 645 | 3300050516 | nmdc:mga0sz30_1058_c1 | nmdc:mga0sz30_1058_c1_1555_2385 | 275 |
| 646 | 3300050516 | nmdc:mga0sz30_3045_c1 | nmdc:mga0sz30_3045_c1_3505_4332 | 275 |
| 647 | 3300053085 | Ga0495619_0212347 | Ga0495619_0212347_478_1308 | 275 |
| 648 | 3300053087 | Ga0500643_010917 | Ga0500643_010917_2358_3185 | 275 |
| 649 | 3300053087 | Ga0500643_022740 | Ga0500643_022740_360_1220 | 275 |
| 650 | 3300053153 | Ga0500616_0017253 | Ga0500616_0017253_701_1531 | 275 |
| 651 | 3300061719 | Ga0466962_0035067 | Ga0466962_0035067_354_1181 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2et6-assembly1.cif.gz_A | (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 | 0.9702 | 11 | 191 |
| 3tfo-assembly1.cif.gz_D | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9619 | 11 | 255 |
| 3tfo-assembly1.cif.gz_B | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.961 | 10 | 254 |
| 3tfo-assembly1.cif.gz_C | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9529 | 11 | 252 |
| 3tfo-assembly1.cif.gz_B | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9523 | 10 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6WZD9_7_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9958 | 7 | 258 | 3.40.50.720 |
| af_I6WZD9_7_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9841 | 7 | 258 | 3.40.50.720 |
| 2et6A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9702 | 11 | 191 | 3.40.50.720 |
| 3tfoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.961 | 10 | 254 | 3.40.50.720 |
| 2et6A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9603 | 11 | 193 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3UY48-F1-model_v4 | deleted | 0.9888 | 37 | 256 |
|
| AF-I4ELG6-F1-model_v4 | Putative Oxidoreductase | 0.9798 | 11 | 192 |
GO:0016020
GO:0016491 |
| AF-A0A6G3UY48-F1-model_v4 | deleted | 0.9756 | 37 | 256 |
|
| AF-A0A1F4BCM0-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9727 | 11 | 194 |
GO:0016491
|
| AF-A0A2W6T3P7-F1-model_v4 | Short-chain dehydrogenase | 0.972 | 11 | 189 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar