F472574

General Info

Members Datasets Scaffolds Average Seq Length
651 310 626 274

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10041951|Ga0070666_100419514
Length 288
Sequence MARFEPHPTRRPAIVAGASSGIGAATATALAARGFPVALGARRVEKCQELVDQIKAEGGEAIALPLDVTDTESVENFVAKATAALGDIEVLVTGAGDTNFGRLHEMSTDEFAQQLQIHLVGANRMARAVLDGMVERRRGDLIFVGSDVALRQRPHMGAYGAAKAGLVAMVTNLQMELEGTGVRASVVHPGPTMTSMGWSLPAEKIGPALEDWAKWGQARHSYFLRAADLARAITFIAETPRGGFIANMELQPEAPLAEAKERQSLALGEEGMPGHSEGRSEATGEEEK

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221692 Nocardia sp. Root136 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
8 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
9 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
10 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
11 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
12 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
13 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
14 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
15 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
16 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
17 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
18 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
19 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
20 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
21 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
22 2922554459 Rhodococcus sp. 66b Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
25 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
201 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0
Isolates 3.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 0.15
Rhizoplane 10.75
Rhizosphere 65.9
Stem 0
Stem Tuber 0
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10001723 3300002077 Bacteria 4385
2 JGI24751J29686_10003832 3300002459 Bacteria 3036
3 rootH2_10026628 3300003320 Bacteria 1512
4 Ga0055540_1000071 3300003792 Bacteria 117607
5 Ga0070676_10020266 3300005328 Bacteria 3710
6 Ga0070683_100097685 3300005329 Bacteria 2763
7 Ga0070690_100009227 3300005330 Bacteria 5709
8 Ga0068869_100035108 3300005334 Bacteria 3552
9 Ga0068869_100112349 3300005334 Bacteria 2074
10 Ga0070666_10041951 3300005335 Bacteria 3059
11 Ga0070682_100143051 3300005337 Bacteria 1633
12 Ga0070682_100209449 3300005337 Bacteria 1381
13 Ga0068868_100245685 3300005338 Bacteria 1505
14 Ga0070660_100081262 3300005339 Bacteria 2544
15 Ga0070691_10009713 3300005341 Bacteria 4390
16 Ga0070668_100064945 3300005347 Bacteria 2830
17 Ga0070668_100135484 3300005347 Bacteria 1980
18 Ga0070669_100014698 3300005353 Bacteria 5573
19 Ga0070675_100236273 3300005354 Bacteria 1596
20 Ga0070675_100288488 3300005354 Bacteria 1444
21 Ga0070675_100355880 3300005354 Bacteria 1299
22 Ga0070671_100012917 3300005355 Bacteria 6730
23 Ga0070671_100072449 3300005355 Bacteria 2877
24 Ga0070674_100029289 3300005356 Bacteria 3624
25 Ga0070674_100280033 3300005356 Bacteria 1321
26 Ga0070674_100580827 3300005356 Bacteria 944
27 Ga0070688_100033363 3300005365 Bacteria 3111
28 Ga0070688_100083368 3300005365 Bacteria 2075
29 Ga0070659_100028276 3300005366 Bacteria 4328
30 Ga0070667_100000324 3300005367 Bacteria 53403
31 Ga0070667_100000487 3300005367 Bacteria 40279
32 Ga0070667_100051434 3300005367 Bacteria 3474
33 Ga0070667_100249837 3300005367 Bacteria 1585
34 Ga0070709_10020029 3300005434 Bacteria 3877
35 Ga0070709_10395981 3300005434 Bacteria 1030
36 Ga0070714_100005497 3300005435 Bacteria 9672
37 Ga0070714_100105457 3300005435 Bacteria 2489
38 Ga0070714_100240534 3300005435 Bacteria 1670
39 Ga0070714_100613305 3300005435 Bacteria 1045
40 Ga0070713_100098824 3300005436 Bacteria 2524
41 Ga0070710_10000927 3300005437 Bacteria 13974
42 Ga0070710_10051683 3300005437 Bacteria 2308
43 Ga0070701_10001711 3300005438 Bacteria 8242
44 Ga0070711_100003543 3300005439 Bacteria 9108
45 Ga0070705_100004167 3300005440 Bacteria 7065
46 Ga0070700_100032254 3300005441 Bacteria 3147
47 Ga0070663_100007666 3300005455 Bacteria 6586
48 Ga0070663_100009243 3300005455 Bacteria 6095
49 Ga0070663_100044819 3300005455 Bacteria 3121
50 Ga0070678_100001013 3300005456 Bacteria 14617
51 Ga0070662_100071228 3300005457 Bacteria 2563
52 Ga0068867_100008434 3300005459 Bacteria 7270
53 Ga0070685_10034804 3300005466 Bacteria 2839
54 Ga0070685_10043257 3300005466 Bacteria 2574
55 Ga0070679_100382584 3300005530 Bacteria 1354
56 Ga0070684_100326862 3300005535 Bacteria 1409
57 Ga0070672_100012044 3300005543 Bacteria 6053
58 Ga0070672_100144039 3300005543 Bacteria 1968
59 Ga0070672_100147164 3300005543 Bacteria 1947
60 Ga0070672_100347558 3300005543 Bacteria 1264
61 Ga0070686_100253374 3300005544 Bacteria 1287
62 Ga0070695_100032619 3300005545 Bacteria 3256
63 Ga0070696_100010973 3300005546 Bacteria 6067
64 Ga0070696_100163589 3300005546 Bacteria 1641
65 Ga0070696_100430733 3300005546 Bacteria 1037
66 Ga0070665_100024159 3300005548 Bacteria 6121
67 Ga0070665_100025634 3300005548 Bacteria 5940
68 Ga0070665_100039882 3300005548 Bacteria 4721
69 Ga0070665_100052834 3300005548 Bacteria 4075
70 Ga0070704_100010458 3300005549 Bacteria 5647
71 Ga0068855_100445033 3300005563 Bacteria 1414
72 Ga0068854_100001661 3300005578 Bacteria 13545
73 Ga0068856_100403371 3300005614 Bacteria 1387
74 Ga0070702_100016568 3300005615 Bacteria 3784
75 Ga0070702_100355001 3300005615 Bacteria 1034
76 Ga0068852_100061404 3300005616 Bacteria 3266
77 Ga0068852_100094130 3300005616 Bacteria 2687
78 Ga0068852_100443990 3300005616 Bacteria 1283
79 Ga0068859_100001593 3300005617 Bacteria 23142
80 Ga0068859_100012513 3300005617 Bacteria 8537
81 Ga0068859_100039617 3300005617 Bacteria 4727
82 Ga0068859_100408678 3300005617 Bacteria 1453
83 Ga0068859_100472641 3300005617 Bacteria 1349
84 Ga0068861_100053061 3300005719 Bacteria 3083
85 Ga0068851_10053411 3300005834 Bacteria 2057
86 Ga0068863_100000143 3300005841 Bacteria 75127
87 Ga0068863_100003638 3300005841 Bacteria 15225
88 Ga0068863_100091564 3300005841 Bacteria 2884
89 Ga0068858_100071964 3300005842 Bacteria 3207
90 Ga0068858_100072593 3300005842 Bacteria 3193
91 Ga0068858_100173277 3300005842 Bacteria 2035
92 Ga0068860_100000079 3300005843 Bacteria 170752
93 Ga0068860_100005332 3300005843 Bacteria 13048
94 Ga0068860_100607901 3300005843 Bacteria 1099
95 Ga0068862_100000093 3300005844 Bacteria 106838
96 Ga0068862_100042656 3300005844 Bacteria 3865
97 Ga0068862_100073395 3300005844 Bacteria 2957
98 Ga0068862_100235685 3300005844 Bacteria 1662
99 Ga0081455_10404205 3300005937 Bacteria 947
100 Ga0081538_10129562 3300005981 Bacteria 1189
101 Ga0081539_10011881 3300005985 Bacteria 6805
102 Ga0075365_10004388 3300006038 Bacteria 7467
103 Ga0075365_10024094 3300006038 Bacteria 3835
104 Ga0075365_10039518 3300006038 Bacteria 3072
105 Ga0075365_10266804 3300006038 Bacteria 1204
106 Ga0075365_10426361 3300006038 Bacteria 936
107 Ga0075363_100001134 3300006048 Bacteria 9723
108 Ga0075363_100005404 3300006048 Bacteria 5677
109 Ga0075363_100014757 3300006048 Bacteria 3827
110 Ga0075363_100021949 3300006048 Bacteria 3222
111 Ga0075363_100034794 3300006048 Bacteria 2631
112 Ga0075363_100049716 3300006048 Bacteria 2233
113 Ga0075363_100081878 3300006048 Bacteria 1766
114 Ga0075363_100190669 3300006048 Bacteria 1169
115 Ga0075364_10004041 3300006051 Bacteria 8423
116 Ga0075364_10005464 3300006051 Bacteria 7387
117 Ga0075364_10006554 3300006051 Bacteria 6848
118 Ga0075364_10024282 3300006051 Bacteria 3847
119 Ga0075364_10032394 3300006051 Bacteria 3360
120 Ga0075364_10235411 3300006051 Bacteria 1244
121 Ga0070715_10097834 3300006163 Bacteria 1363
122 Ga0070716_100297001 3300006173 Bacteria 1122
123 Ga0070712_100009663 3300006175 Bacteria 6080
124 Ga0070712_100015167 3300006175 Bacteria 4956
125 Ga0075362_10028730 3300006177 Bacteria 2391
126 Ga0075362_10040478 3300006177 Bacteria 2052
127 Ga0075367_10010291 3300006178 Bacteria 4909
128 Ga0075367_10082365 3300006178 Bacteria 1948
129 Ga0075367_10141418 3300006178 Bacteria 1491
130 Ga0075369_10000029 3300006186 Bacteria 39213
131 Ga0075369_10048200 3300006186 Bacteria 1838
132 Ga0075369_10058467 3300006186 Bacteria 1679
133 Ga0097621_100008957 3300006237 Bacteria 7239
134 Ga0075370_10010734 3300006353 Bacteria 4802
135 Ga0075370_10024117 3300006353 Bacteria 3357
136 Ga0075370_10025841 3300006353 Bacteria 3249
137 Ga0075428_100007875 3300006844 Bacteria 11813
138 Ga0075428_100086121 3300006844 Bacteria 3427
139 Ga0075430_100018039 3300006846 Bacteria 6006
140 Ga0075429_100033298 3300006880 Bacteria 4477
141 Ga0068865_100031398 3300006881 Bacteria 3542
142 Ga0068865_100148738 3300006881 Bacteria 1774
143 Ga0097620_100001593 3300006931 Bacteria 23142
144 Ga0097620_100012512 3300006931 Bacteria 8537
145 Ga0097620_100039617 3300006931 Bacteria 4727
146 Ga0097620_100408685 3300006931 Bacteria 1453
147 Ga0097620_100472679 3300006931 Bacteria 1349
148 Ga0105245_10006858 3300009098 Bacteria 9988
149 Ga0105245_10043781 3300009098 Bacteria 3994
150 Ga0105245_10130542 3300009098 Bacteria 2356
151 Ga0105245_10365107 3300009098 Bacteria 1434
152 Ga0105245_10674334 3300009098 Bacteria 1065
153 Ga0105247_10000044 3300009101 Bacteria 153728
154 Ga0105247_10002130 3300009101 Bacteria 13679
155 Ga0105247_10034465 3300009101 Bacteria 3083
156 Ga0114129_10100127 3300009147 Bacteria 4010
157 Ga0105243_10002819 3300009148 Bacteria 14433
158 Ga0105243_10011604 3300009148 Bacteria 6666
159 Ga0105241_10017700 3300009174 Bacteria 5239
160 Ga0105242_10002099 3300009176 Bacteria 15700
161 Ga0105248_10000060 3300009177 Bacteria 131634
162 Ga0105237_10001746 3300009545 Bacteria 28078
163 Ga0105237_10027148 3300009545 Bacteria 5847
164 Ga0105237_10194481 3300009545 Bacteria 2028
165 Ga0105238_10068604 3300009551 Bacteria 3547
166 Ga0105249_10000049 3300009553 Bacteria 169899
167 Ga0105249_10006471 3300009553 Bacteria 10189
168 Ga0105249_10031917 3300009553 Bacteria 4764
169 Ga0105249_10249935 3300009553 Bacteria 1758
170 Ga0105249_10408912 3300009553 Bacteria 1389
171 Ga0105249_10526973 3300009553 Bacteria 1229
172 Ga0105239_10003558 3300010375 Bacteria 19045
173 Ga0105239_10136848 3300010375 Bacteria 2727
174 Ga0105239_10137217 3300010375 Bacteria 2723
175 Ga0105239_10339415 3300010375 Bacteria 1695
176 Ga0105246_10015077 3300011119 Bacteria 4871
177 Ga0105246_10206848 3300011119 Bacteria 1529
178 Ga0105246_10252536 3300011119 Bacteria 1400
179 Ga0105246_10311319 3300011119 Bacteria 1276
180 Ga0157371_10198870 3300013102 Bacteria 1436
181 Ga0157374_10103932 3300013296 Bacteria 2727
182 Ga0157378_10006985 3300013297 Bacteria 9850
183 Ga0157378_10287840 3300013297 Bacteria 1586
184 Ga0163162_10058900 3300013306 Bacteria 3871
185 Ga0163162_10061855 3300013306 Bacteria 3782
186 Ga0163162_10341042 3300013306 Bacteria 1631
187 Ga0163162_10539497 3300013306 Bacteria 1295
188 Ga0157372_10021406 3300013307 Bacteria 6985
189 Ga0157375_10090288 3300013308 Bacteria 3122
190 Ga0163163_10045830 3300014325 Bacteria 4294
191 Ga0163163_10067722 3300014325 Bacteria 3550
192 Ga0163163_10464585 3300014325 Bacteria 1326
193 Ga0163163_10488096 3300014325 Bacteria 1293
194 Ga0157380_10003346 3300014326 Bacteria 10992
195 Ga0157380_10106390 3300014326 Bacteria 2347
196 Ga0157377_10000892 3300014745 Bacteria 12459
197 Ga0157377_10098470 3300014745 Bacteria 1738
198 Ga0157379_10076026 3300014968 Bacteria 3007
199 Ga0157379_10612246 3300014968 Bacteria 1017
200 Ga0163161_10001520 3300017792 Bacteria 17172
201 Ga0213874_10011657 3300021377 Bacteria 2234
202 Ga0213876_10001760 3300021384 Bacteria 13128
203 Ga0213875_10018469 3300021388 Bacteria 3360
204 Ga0213875_10049004 3300021388 Bacteria 1980
205 Ga0209051_1000033 3300025303 Bacteria 380540
206 Ga0209051_1000776 3300025303 Bacteria 33909
207 Ga0209051_1014386 3300025303 Bacteria 3697
208 Ga0207692_10026329 3300025898 Bacteria 2727
209 Ga0207692_10110014 3300025898 Bacteria 1527
210 Ga0207692_10156047 3300025898 Bacteria 1311
211 Ga0207642_10031402 3300025899 Bacteria 2224
212 Ga0207710_10000066 3300025900 Bacteria 153734
213 Ga0207710_10007366 3300025900 Bacteria 4661
214 Ga0207688_10001970 3300025901 Bacteria 11004
215 Ga0207688_10016401 3300025901 Bacteria 4017
216 Ga0207680_10080750 3300025903 Bacteria 2043
217 Ga0207647_10039971 3300025904 Bacteria 2956
218 Ga0207685_10007375 3300025905 Bacteria 3061
219 Ga0207699_10023723 3300025906 Bacteria 3342
220 Ga0207699_10084238 3300025906 Bacteria 1980
221 Ga0207645_10011325 3300025907 Bacteria 6095
222 Ga0207654_10171912 3300025911 Bacteria 1407
223 Ga0207671_10008052 3300025914 Bacteria 9008
224 Ga0207671_10122033 3300025914 Bacteria 1992
225 Ga0207693_10000197 3300025915 Bacteria 54675
226 Ga0207693_10002311 3300025915 Bacteria 16577
227 Ga0207663_10128567 3300025916 Bacteria 1746
228 Ga0207663_10157453 3300025916 Bacteria 1599
229 Ga0207652_10412153 3300025921 Bacteria 1219
230 Ga0207681_10002233 3300025923 Bacteria 12310
231 Ga0207681_10083257 3300025923 Bacteria 2264
232 Ga0207694_10050232 3300025924 Bacteria 3229
233 Ga0207659_10061826 3300025926 Bacteria 2701
234 Ga0207659_10216117 3300025926 Bacteria 1539
235 Ga0207659_10614339 3300025926 Bacteria 927
236 Ga0207687_10063517 3300025927 Bacteria 2615
237 Ga0207687_10068149 3300025927 Bacteria 2534
238 Ga0207687_10235839 3300025927 Bacteria 1447
239 Ga0207700_10017600 3300025928 Bacteria 4777
240 Ga0207700_10175675 3300025928 Bacteria 1790
241 Ga0207664_10082060 3300025929 Bacteria 2625
242 Ga0207664_10144061 3300025929 Bacteria 2019
243 Ga0207644_10019633 3300025931 Bacteria 4588
244 Ga0207690_10239644 3300025932 Bacteria 1396
245 Ga0207690_10347956 3300025932 Bacteria 1171
246 Ga0207706_10002775 3300025933 Bacteria 17025
247 Ga0207709_10012393 3300025935 Bacteria 4699
248 Ga0207709_10414918 3300025935 Bacteria 1033
249 Ga0207670_10050027 3300025936 Bacteria 2798
250 Ga0207670_10291581 3300025936 Bacteria 1275
251 Ga0207669_10004342 3300025937 Bacteria 6228
252 Ga0207669_10170811 3300025937 Bacteria 1547
253 Ga0207669_10203134 3300025937 Bacteria 1440
254 Ga0207669_10599841 3300025937 Bacteria 895
255 Ga0207665_10007522 3300025939 Bacteria 7201
256 Ga0207665_10061230 3300025939 Bacteria 2550
257 Ga0207665_10409517 3300025939 Bacteria 1034
258 Ga0207691_10079226 3300025940 Bacteria 2957
259 Ga0207691_10157649 3300025940 Bacteria 1993
260 Ga0207711_10000058 3300025941 Bacteria 133317
261 Ga0207711_10023946 3300025941 Bacteria 5110
262 Ga0207689_10045502 3300025942 Bacteria 3628
263 Ga0207689_10074866 3300025942 Bacteria 2782
264 Ga0207667_10129394 3300025949 Bacteria 2600
265 Ga0207651_10694486 3300025960 Bacteria 896
266 Ga0207712_10000038 3300025961 Bacteria 192762
267 Ga0207712_10090968 3300025961 Bacteria 2247
268 Ga0207712_10099840 3300025961 Bacteria 2156
269 Ga0207668_10001652 3300025972 Bacteria 13029
270 Ga0207668_10025482 3300025972 Bacteria 3828
271 Ga0207668_10121008 3300025972 Bacteria 1982
272 Ga0207640_10059653 3300025981 Bacteria 2519
273 Ga0207640_10279196 3300025981 Bacteria 1311
274 Ga0207658_10000061 3300025986 Bacteria 119045
275 Ga0207658_10006720 3300025986 Bacteria 7831
276 Ga0207677_10006626 3300026023 Bacteria 6354
277 Ga0207677_10207403 3300026023 Bacteria 1562
278 Ga0207703_10069764 3300026035 Bacteria 2899
279 Ga0207678_10010285 3300026067 Bacteria 8212
280 Ga0207678_10039301 3300026067 Bacteria 4107
281 Ga0207678_10576849 3300026067 Bacteria 985
282 Ga0207708_10003700 3300026075 Bacteria 11290
283 Ga0207708_10017860 3300026075 Bacteria 5338
284 Ga0207702_10359874 3300026078 Bacteria 1394
285 Ga0207702_10501162 3300026078 Bacteria 1184
286 Ga0207641_10000232 3300026088 Bacteria 71885
287 Ga0207641_10006641 3300026088 Bacteria 9711
288 Ga0207641_10127987 3300026088 Bacteria 2276
289 Ga0207648_10004179 3300026089 Bacteria 14923
290 Ga0207648_10037367 3300026089 Bacteria 4277
291 Ga0207675_100003156 3300026118 Bacteria 16170
292 Ga0207675_100037611 3300026118 Bacteria 4514
293 Ga0207675_100070125 3300026118 Bacteria 3276
294 Ga0207675_100256663 3300026118 Bacteria 1693
295 Ga0207683_10003067 3300026121 Bacteria 14603
296 Ga0207683_10151606 3300026121 Bacteria 2092
297 Ga0207698_10032304 3300026142 Bacteria 3791
298 Ga0207698_10078825 3300026142 Bacteria 2647
299 Ga0207698_10393654 3300026142 Bacteria 1322
300 Ga0209813_10049296 3300027866 Bacteria 1310
301 Ga0209813_10080888 3300027866 Bacteria 1074
302 Ga0207428_10327152 3300027907 Bacteria 1131
303 Ga0268266_10009675 3300028379 Bacteria 8474
304 Ga0268266_10018080 3300028379 Bacteria 6008
305 Ga0268265_10000053 3300028380 Bacteria 170215
306 Ga0268264_10000017 3300028381 Bacteria 498037
307 Ga0268264_10027953 3300028381 Bacteria 4611
308 Ga0268264_10462886 3300028381 Bacteria 1230
309 Ga0268264_10515638 3300028381 Bacteria 1168
310 Ga0307511_10000896 3300030521 Bacteria 31348
311 Ga0265327_10000128 3300031251 Bacteria 165601
312 Ga0265327_10000477 3300031251 Bacteria 70613
313 Ga0265327_10002212 3300031251 Bacteria 21240
314 Ga0265327_10006336 3300031251 Bacteria 9495
315 Ga0265327_10102573 3300031251 Bacteria 1378
316 Ga0265327_10115145 3300031251 Bacteria 1280
317 Ga0307408_100125838 3300031548 Bacteria 1993
318 Ga0316576_10112230 3300031727 Bacteria 2044
319 Ga0307413_10007594 3300031824 Bacteria 5051
320 Ga0307410_10016048 3300031852 Bacteria 4455
321 Ga0307410_10016844 3300031852 Bacteria 4370
322 Ga0307410_10492175 3300031852 Bacteria 1008
323 Ga0307406_10054494 3300031901 Bacteria 2553
324 Ga0307406_10072081 3300031901 Bacteria 2266
325 Ga0307409_100003692 3300031995 Bacteria 8393
326 Ga0307409_100201500 3300031995 Bacteria 1781
327 Ga0307416_100023582 3300032002 Bacteria 4469
328 Ga0307416_100215654 3300032002 Bacteria 1836
329 Ga0307414_10159849 3300032004 Bacteria 1788
330 Ga0307415_100007009 3300032126 Bacteria 6129
331 Ga0307510_10118779 3300033180 Bacteria 2356
332 Ga0373932_0093643 3300035112 Bacteria 968
333 Ga0373932_0170567 3300035112 Bacteria 758
334 Ga0316584_0146764 3300036712 Bacteria 1757
335 Ga0395898_0373492 3300037466 Bacteria 1360
336 Ga0436364_0224006 3300037853 Bacteria 27953
337 Ga0436364_0330612 3300037853 Bacteria 5117
338 Ga0436364_1545518 3300037853 Bacteria 5045
339 Ga0395901_0542194 3300038443 Bacteria 1180
340 Ga0436365_0039491 3300039437 Bacteria 3739
341 Ga0436365_0271296 3300039437 Bacteria 39035
342 Ga0436365_0305981 3300039437 Bacteria 1440
343 Ga0436365_0397989 3300039437 Bacteria 12470
344 Ga0436365_0667324 3300039437 Bacteria 2894
345 Ga0436365_1865812 3300039437 Bacteria 4654
346 Ga0436360_0933631 3300039438 Bacteria 913
347 Ga0436360_1088466 3300039438 Bacteria 1487
348 Ga0436361_0877000 3300039447 Bacteria 1917
349 Ga0436363_0064425 3300039450 Bacteria 3443
350 Ga0439466_0006376 3300041411 Bacteria 4487
351 Ga0439465_0003069 3300041413 Bacteria 5465
352 Ga0439465_0004735 3300041413 Bacteria 4390
353 Ga0439465_0005177 3300041413 Bacteria 4184
354 Ga0451791_1164627 3300041451 Bacteria 1144
355 Ga0451833_1108409 3300041491 Bacteria 1151
356 Ga0439431_0015108 3300041997 Bacteria 1795
357 Ga0439442_008348 3300042002 Bacteria 2090
358 Ga0439445_0002867 3300042004 Bacteria 3850
359 Ga0439448_0001702 3300042005 Bacteria 5793
360 Ga0439434_0005195 3300042435 Bacteria 3807
361 Ga0439435_0025868 3300042436 Bacteria 1559
362 Ga0466969_0027920 3300044656 Bacteria 2888
363 Ga0466972_0001604 3300044658 Bacteria 11046
364 Ga0466972_0015260 3300044658 Bacteria 3841
365 Ga0466972_0028614 3300044658 Bacteria 2748
366 Ga0466972_0060937 3300044658 Bacteria 1810
367 Ga0466972_0354514 3300044658 Bacteria 686
368 Ga0466965_0000732 3300044683 Bacteria 12261
369 Ga0466965_0009878 3300044683 Bacteria 4439
370 Ga0466965_0029526 3300044683 Bacteria 2669
371 Ga0466965_0078183 3300044683 Bacteria 1671
372 Ga0466965_0212320 3300044683 Bacteria 1029
373 Ga0466966_0000813 3300044684 Bacteria 19883
374 Ga0466966_0002596 3300044684 Bacteria 11839
375 Ga0466966_0030448 3300044684 Bacteria 3505
376 Ga0466966_0068876 3300044684 Bacteria 2221
377 Ga0466966_0250944 3300044684 Bacteria 1066
378 Ga0466966_0324337 3300044684 Bacteria 925
379 Ga0466961_0013845 3300044693 Bacteria 5169
380 Ga0466961_0016015 3300044693 Bacteria 4813
381 Ga0466961_0022099 3300044693 Bacteria 4093
382 Ga0466961_0169704 3300044693 Bacteria 1357
383 Ga0466961_0176666 3300044693 Bacteria 1326
384 Ga0466963_0025090 3300044694 Bacteria 3799
385 Ga0466963_0254140 3300044694 Bacteria 1233
386 Ga0466964_0132745 3300044706 Bacteria 1136
387 Ga0466971_0003487 3300044719 Bacteria 6718
388 Ga0466971_0029775 3300044719 Bacteria 2442
389 Ga0466968_0007528 3300044735 Bacteria 4144
390 Ga0466968_0008858 3300044735 Bacteria 3862
391 Ga0466968_0062049 3300044735 Bacteria 1613
392 Ga0466970_0004676 3300044765 Bacteria 6759
393 Ga0466970_0030645 3300044765 Bacteria 2837
394 Ga0466970_0034811 3300044765 Bacteria 2667
395 Ga0466970_0086437 3300044765 Bacteria 1699
396 Ga0466957_0001665 3300044842 Bacteria 11671
397 Ga0466957_0097691 3300044842 Bacteria 1847
398 Ga0466960_0000220 3300044901 Bacteria 19822
399 Ga0466960_0001412 3300044901 Bacteria 8731
400 Ga0466959_0020200 3300045049 Bacteria 4904
401 Ga0466959_0037158 3300045049 Bacteria 3598
402 Ga0466959_0090397 3300045049 Bacteria 2199
403 Ga0466959_0307855 3300045049 Bacteria 1084
404 Ga0466958_0002045 3300045836 Bacteria 9966
405 Ga0466958_0013952 3300045836 Bacteria 4581
406 Ga0466958_0024005 3300045836 Bacteria 3585
407 Ga0466958_0047984 3300045836 Bacteria 2579
408 Ga0466958_0064199 3300045836 Bacteria 2239
409 Ga0466967_0001559 3300045976 Bacteria 13444
410 Ga0466967_0014046 3300045976 Bacteria 6219
411 Ga0466967_0038199 3300045976 Bacteria 4116
412 Ga0466967_0109327 3300045976 Bacteria 2538
413 Ga0466967_0564149 3300045976 Bacteria 1121
414 Ga0466967_0599314 3300045976 Bacteria 1087
415 Ga0466967_0798539 3300045976 Bacteria 937
416 Ga0495629_0211148 3300046459 Bacteria 1340
417 Ga0495638_0044175 3300046460 Bacteria 2808
418 Ga0495605_0075416 3300046474 Bacteria 1586
419 Ga0495639_0033636 3300046475 Bacteria 2290
420 Ga0495583_0034916 3300046506 Bacteria 2405
421 Ga0495606_0119408 3300046507 Bacteria 1580
422 Ga0495665_0009892 3300046531 Bacteria 5163
423 Ga0495640_0061351 3300046533 Bacteria 2554
424 Ga0495668_0068491 3300046616 Bacteria 1952
425 Ga0495668_0215480 3300046616 Bacteria 1051
426 Ga0495634_0209697 3300046642 Bacteria 1207
427 Ga0495588_0052994 3300046674 Bacteria 2092
428 Ga0495658_0001869 3300046683 Bacteria 10743
429 Ga0495613_0191486 3300046689 Bacteria 1445
430 Ga0495674_0150867 3300047319 Bacteria 1949
431 Ga0495672_0004722 3300047320 Bacteria 11013
432 Ga0495672_0124149 3300047320 Bacteria 1368
433 Ga0495676_0326086 3300047321 Bacteria 1031
434 Ga0495686_0158115 3300047472 Bacteria 1326
435 Ga0495593_0018433 3300047673 Bacteria 3921
436 Ga0496100_0000029 3300048903 Bacteria 110710
437 Ga0496100_0000798 3300048903 Bacteria 15034
438 Ga0496100_0002877 3300048903 Bacteria 8828
439 Ga0496100_0009461 3300048903 Bacteria 5479
440 Ga0496100_0019765 3300048903 Bacteria 4026
441 Ga0496100_0467895 3300048903 Bacteria 968
442 Ga0496101_0000015 3300048904 Bacteria 252368
443 Ga0496101_0000031 3300048904 Bacteria 195195
444 Ga0496101_0008430 3300048904 Bacteria 6733
445 Ga0496101_0032368 3300048904 Bacteria 3680
446 Ga0496101_0208648 3300048904 Bacteria 1513
447 Ga0496102_0000065 3300048905 Bacteria 161370
448 Ga0496102_0000336 3300048905 Bacteria 57396
449 Ga0496102_0018476 3300048905 Bacteria 6128
450 Ga0496102_0020404 3300048905 Bacteria 5856
451 Ga0496102_0029754 3300048905 Bacteria 4887
452 Ga0496102_0050101 3300048905 Bacteria 3801
453 Ga0496102_0057448 3300048905 Bacteria 3553
454 Ga0496102_0078800 3300048905 Bacteria 3033
455 Ga0496102_0228372 3300048905 Bacteria 1755
456 Ga0496102_0244389 3300048905 Bacteria 1692
457 Ga0496102_0642914 3300048905 Bacteria 984
458 Ga0496103_0000048 3300048906 Bacteria 160911
459 Ga0496103_0000271 3300048906 Bacteria 49217
460 Ga0496103_0001418 3300048906 Bacteria 16076
461 Ga0496103_0018080 3300048906 Bacteria 4226
462 Ga0496103_0048212 3300048906 Bacteria 2632
463 Ga0496103_0094537 3300048906 Bacteria 1888
464 Ga0496103_0148481 3300048906 Bacteria 1501
465 Ga0496104_0027595 3300048907 Bacteria 5256
466 Ga0496104_0198545 3300048907 Bacteria 1918
467 Ga0496105_0283264 3300048908 Bacteria 1336
468 Ga0496106_0000396 3300048909 Bacteria 31087
469 Ga0496106_0006462 3300048909 Bacteria 8682
470 Ga0496106_0098255 3300048909 Bacteria 2268
471 Ga0496106_0683915 3300048909 Bacteria 818
472 Ga0496107_0000649 3300048910 Bacteria 19601
473 Ga0496107_0009198 3300048910 Bacteria 6846
474 Ga0496107_0010437 3300048910 Bacteria 6453
475 Ga0496107_0014326 3300048910 Bacteria 5552
476 Ga0496108_0001208 3300048911 Bacteria 20256
477 Ga0496108_0013765 3300048911 Bacteria 6599
478 Ga0496108_0038239 3300048911 Bacteria 3998
479 Ga0496108_0252065 3300048911 Bacteria 1535
480 Ga0496108_0551448 3300048911 Bacteria 1006
481 Ga0496109_0000022 3300048912 Bacteria 188901
482 Ga0496109_0011896 3300048912 Bacteria 7491
483 Ga0496109_0016720 3300048912 Bacteria 6417
484 Ga0496109_0125113 3300048912 Bacteria 2397
485 Ga0496110_0004126 3300048913 Bacteria 11225
486 Ga0496110_0145954 3300048913 Bacteria 2140
487 Ga0496110_0243188 3300048913 Bacteria 1638
488 Ga0496111_0050073 3300048914 Bacteria 3012
489 Ga0496112_0002704 3300048915 Bacteria 14341
490 Ga0496112_0019097 3300048915 Bacteria 6461
491 Ga0496112_0185734 3300048915 Bacteria 2042
492 Ga0496112_0513419 3300048915 Bacteria 1133
493 Ga0496113_0202789 3300048916 Bacteria 1577
494 Ga0496113_0449706 3300048916 Bacteria 1035
495 Ga0496113_0487351 3300048916 Bacteria 990
496 Ga0496114_0000716 3300048917 Bacteria 24693
497 Ga0496114_0002600 3300048917 Bacteria 13777
498 Ga0496114_0027672 3300048917 Bacteria 4646
499 Ga0496114_0155902 3300048917 Bacteria 1983
500 Ga0496114_0616305 3300048917 Bacteria 956
501 Ga0496115_0004673 3300048918 Bacteria 9923
502 Ga0496115_0018996 3300048918 Bacteria 5285
503 Ga0496115_0061266 3300048918 Bacteria 3034
504 Ga0496115_0266868 3300048918 Bacteria 1407
505 Ga0496116_0000125 3300048919 Bacteria 160885
506 Ga0496116_0003462 3300048919 Bacteria 15566
507 Ga0496117_0000111 3300048920 Bacteria 184570
508 Ga0496117_0001352 3300048920 Bacteria 35887
509 Ga0496117_0008331 3300048920 Bacteria 9863
510 Ga0496117_0060123 3300048920 Bacteria 2621
511 Ga0496118_0000083 3300048921 Bacteria 184570
512 Ga0496118_0002892 3300048921 Bacteria 22351
513 Ga0496118_0025250 3300048921 Bacteria 5101
514 Ga0496119_0004014 3300048922 Bacteria 14877
515 Ga0496119_0007493 3300048922 Bacteria 9809
516 Ga0496119_0010640 3300048922 Bacteria 7711
517 Ga0496120_0001769 3300048923 Bacteria 24335
518 Ga0496120_0012983 3300048923 Bacteria 5635
519 Ga0496120_0021299 3300048923 Bacteria 4099
520 Ga0496120_0061325 3300048923 Bacteria 2100
521 Ga0496121_0000004 3300048924 Bacteria 1139011
522 Ga0496121_0001000 3300048924 Bacteria 50532
523 Ga0496121_0009717 3300048924 Bacteria 11008
524 Ga0496122_0000138 3300048925 Bacteria 169434
525 Ga0496122_0040074 3300048925 Bacteria 3728
526 Ga0496122_0125513 3300048925 Bacteria 1644
527 Ga0496123_0024813 3300048926 Bacteria 4541
528 Ga0496123_0034379 3300048926 Bacteria 3632
529 Ga0496124_0000012 3300048927 Bacteria 512581
530 Ga0496124_0093145 3300048927 Bacteria 2452
531 Ga0496125_0000003 3300048928 Bacteria 1189767
532 Ga0496125_0010602 3300048928 Bacteria 9309
533 Ga0496126_0000001 3300048929 Bacteria 1139011
534 Ga0496126_0000220 3300048929 Bacteria 124547
535 Ga0496126_0004252 3300048929 Bacteria 17240
536 Ga0496126_0026981 3300048929 Bacteria 5496
537 Ga0496126_0061092 3300048929 Bacteria 3386
538 Ga0501032_0010663 3300049569 Bacteria 6616
539 Ga0501032_0221685 3300049569 Bacteria 1231
540 Ga0501033_0007899 3300049570 Bacteria 8240
541 Ga0501033_0391902 3300049570 Bacteria 969
542 Ga0501034_0007790 3300049571 Bacteria 11395
543 Ga0501034_0016717 3300049571 Bacteria 7522
544 Ga0501036_0008446 3300049572 Bacteria 8437
545 Ga0501037_0000219 3300049573 Bacteria 49904
546 Ga0501037_0010691 3300049573 Bacteria 6744
547 Ga0501038_0059297 3300049574 Bacteria 3278
548 Ga0501039_0000675 3300049575 Bacteria 24622
549 Ga0501043_0001226 3300049579 Bacteria 22608
550 Ga0501043_0071941 3300049579 Bacteria 2716
551 Ga0501046_0000302 3300049580 Bacteria 49738
552 Ga0501046_0190763 3300049580 Bacteria 1529
553 Ga0501047_0017099 3300049581 Bacteria 6936
554 Ga0501047_0146835 3300049581 Bacteria 2235
555 Ga0501047_0285267 3300049581 Bacteria 1495
556 Ga0501048_0032945 3300049582 Bacteria 3744
557 Ga0501069_0230739 3300049585 Bacteria 1077
558 Ga0501070_0004586 3300049586 Bacteria 11841
559 Ga0501070_0004633 3300049586 Bacteria 11795
560 Ga0501070_0072994 3300049586 Bacteria 2840
561 Ga0501070_0328633 3300049586 Bacteria 1243
562 Ga0501071_0116742 3300049587 Bacteria 1976
563 Ga0501073_0058018 3300049589 Bacteria 2706
564 Ga0501073_0419434 3300049589 Bacteria 925
565 Ga0501035_0000665 3300049822 Bacteria 37870
566 Ga0501035_0000742 3300049822 Bacteria 35160
567 Ga0501044_0000313 3300049823 Bacteria 61310
568 Ga0501044_0001249 3300049823 Bacteria 30175
569 Ga0501044_0076396 3300049823 Bacteria 3399
570 Ga0501044_0305946 3300049823 Bacteria 1517
571 Ga0501045_0524870 3300049824 Bacteria 879
572 nmdc:mga03683_62412_c1 3300050489 Bacteria 1578
573 nmdc:mga03n38_181039_c1 3300050490 Bacteria 1080
574 nmdc:mga03n38_202072_c1 3300050490 Bacteria 1029
575 nmdc:mga03n38_3117_c1 3300050490 Bacteria 5271
576 nmdc:mga03n38_48465_c1 3300050490 Bacteria 1885
577 nmdc:mga03n38_514_c1 3300050490 Bacteria 9769
578 nmdc:mga03n38_77644_c1 3300050490 Bacteria 1552
579 nmdc:mga03n38_85572_c1 3300050490 Bacteria 1491
580 nmdc:mga00v17_13060_c1 3300050491 Bacteria 4602
581 nmdc:mga00v17_137800_c1 3300050491 Bacteria 1563
582 nmdc:mga00v17_168840_c1 3300050491 Bacteria 1410
583 nmdc:mga00v17_231009_c1 3300050491 Bacteria 1198
584 nmdc:mga00v17_33164_c1 3300050491 Bacteria 3058
585 nmdc:mga00v17_365685_c1 3300050491 Bacteria 938
586 nmdc:mga00v17_440650_c1 3300050491 Bacteria 846
587 nmdc:mga00v17_5765_c1 3300050491 Bacteria 6545
588 nmdc:mga00v17_681_c1 3300050491 Bacteria 18678
589 nmdc:mga0yw44_106161_c1 3300050492 Bacteria 1794
590 nmdc:mga0yw44_234951_c1 3300050492 Bacteria 1217
591 nmdc:mga0yw44_29716_c1 3300050492 Bacteria 3158
592 nmdc:mga0yw44_40108_c1 3300050492 Bacteria 2780
593 nmdc:mga0yw44_4095_c1 3300050492 Bacteria 6611
594 nmdc:mga0yw44_47764_c1 3300050492 Bacteria 2578
595 nmdc:mga0k408_262536_c1 3300050493 Bacteria 1031
596 nmdc:mga06z11_119734_c1 3300050494 Bacteria 1467
597 nmdc:mga06z11_126358_c1 3300050494 Bacteria 1431
598 nmdc:mga06z11_13513_c1 3300050494 Bacteria 3588
599 nmdc:mga06z11_41642_c1 3300050494 Bacteria 2299
600 nmdc:mga04h51_18774_c1 3300050495 Bacteria 2041
601 nmdc:mga07m45_117410_c1 3300050496 Bacteria 1535
602 nmdc:mga07m45_15921_c1 3300050496 Bacteria 4021
603 nmdc:mga07m45_2877_c1 3300050496 Bacteria 8156
604 nmdc:mga07m45_300213_c1 3300050496 Bacteria 934
605 nmdc:mga07m45_30412_c1 3300050496 Bacteria 2599
606 nmdc:mga05p37_292603_c1 3300050507 Bacteria 1938
607 nmdc:mga09592_267900_c1 3300050508 Bacteria 1481
608 nmdc:mga0qj67_4393_c1 3300050509 Bacteria 10208
609 nmdc:mga06r32_27527_c1 3300050510 Bacteria 5312
610 nmdc:mga08y16_180117_c1 3300050511 Bacteria 2194
611 nmdc:mga0sz30_1058_c1 3300050516 Bacteria 9925
612 nmdc:mga0sz30_112759_c1 3300050516 Bacteria 1192
613 nmdc:mga0sz30_3045_c1 3300050516 Bacteria 6001
614 Ga0500635_0158296 3300053080 Bacteria 868
615 Ga0495619_0212347 3300053085 Bacteria 1340
616 Ga0495619_0297746 3300053085 Bacteria 1118
617 Ga0500643_010917 3300053087 Bacteria 3350
618 Ga0500643_022740 3300053087 Bacteria 2013
619 Ga0500556_0075347 3300053104 Bacteria 1267
620 Ga0500562_005526 3300053108 Bacteria 3174
621 Ga0500642_0098975 3300053130 Bacteria 1355
622 Ga0500559_0027977 3300053136 Bacteria 2407
623 Ga0500616_0017253 3300053153 Bacteria 4099
624 Ga0500645_000056 3300053730 Bacteria 92126
625 Ga0501084_0000082 3300054114 Bacteria 69523
626 Ga0466962_0035067 3300061719 Bacteria 2402

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0354514 Ga0466972_0354514_19_675 218
2 3300044684 Ga0466966_0324337 Ga0466966_0324337_12_815 226
3 3300050490 nmdc:mga03n38_202072_c1 nmdc:mga03n38_202072_c1_22_720 231
4 3300035112 Ga0373932_0170567 Ga0373932_0170567_40_738 232
5 3300048917 Ga0496114_0616305 Ga0496114_0616305_38_736 232
6 3300030521 Ga0307511_10000896 Ga0307511_1000089629 245
7 3300033180 Ga0307510_10118779 Ga0307510_101187793 248
8 3300044693 Ga0466961_0013845 Ga0466961_0013845_2299_3045 248
9 3300042005 Ga0439448_0001702 Ga0439448_0001702_2888_3643 251
10 3300048905 Ga0496102_0228372 Ga0496102_0228372_943_1710 251
11 3300054114 Ga0501084_0000082 Ga0501084_0000082_44831_45595 253
12 iso_pu_bacteria 2773857762 2774392518 254
13 iso_pu_bacteria 2811994878 2812351538 254
14 3300005937 Ga0081455_10404205 Ga0081455_104042052 255
15 3300006038 Ga0075365_10426361 Ga0075365_104263612 255
16 3300044684 Ga0466966_0068876 Ga0466966_0068876_1432_2211 255
17 3300050491 nmdc:mga00v17_440650_c1 nmdc:mga00v17_440650_c1_46_822 255
18 iso_pu_bacteria 2744054611 2744953598 255
19 3300005354 Ga0070675_100288488 Ga0070675_1002884881 256
20 3300025926 Ga0207659_10216117 Ga0207659_102161172 256
21 3300044656 Ga0466969_0027920 Ga0466969_0027920_1901_2686 257
22 3300045049 Ga0466959_0090397 Ga0466959_0090397_1363_2148 257
23 3300041413 Ga0439465_0004735 Ga0439465_0004735_865_1641 258
24 3300041997 Ga0439431_0015108 Ga0439431_0015108_777_1553 258
25 3300042004 Ga0439445_0002867 Ga0439445_0002867_931_1707 258
26 iso_pu_bacteria 2751185725 2753035772 258
27 iso_pu_bacteria 2751185792 2753326203 258
28 3300031251 Ga0265327_10102573 Ga0265327_101025732 259
29 3300031727 Ga0316576_10112230 Ga0316576_101122302 259
30 iso_pu_bacteria 2643221692 2644517708 259
31 3300005356 Ga0070674_100580827 Ga0070674_1005808271 260
32 3300005563 Ga0068855_100445033 Ga0068855_1004450332 260
33 3300039438 Ga0436360_1088466 Ga0436360_1088466_529_1326 260
34 3300044693 Ga0466961_0022099 Ga0466961_0022099_1001_1804 260
35 3300044765 Ga0466970_0030645 Ga0466970_0030645_681_1484 260
36 3300045976 Ga0466967_0038199 Ga0466967_0038199_3013_3816 260
37 3300046531 Ga0495665_0009892 Ga0495665_0009892_996_1781 260
38 3300046674 Ga0495588_0052994 Ga0495588_0052994_1234_2019 260
39 3300048904 Ga0496101_0208648 Ga0496101_0208648_498_1280 260
40 3300048909 Ga0496106_0683915 Ga0496106_0683915_18_800 260
41 3300048916 Ga0496113_0487351 Ga0496113_0487351_18_800 260
42 3300049823 Ga0501044_0305946 Ga0501044_0305946_367_1149 260
43 iso_pu_bacteria 2551306166 2552105433 260
44 3300009098 Ga0105245_10043781 Ga0105245_100437813 261
45 3300025911 Ga0207654_10171912 Ga0207654_101719122 261
46 3300025927 Ga0207687_10063517 Ga0207687_100635172 261
47 3300026142 Ga0207698_10078825 Ga0207698_100788253 261
48 3300031251 Ga0265327_10000477 Ga0265327_1000047763 261
49 3300031251 Ga0265327_10115145 Ga0265327_101151452 261
50 3300049569 Ga0501032_0221685 Ga0501032_0221685_292_1077 261
51 3300049824 Ga0501045_0524870 Ga0501045_0524870_84_869 261
52 3300013102 Ga0157371_10198870 Ga0157371_101988701 262
53 3300048918 Ga0496115_0061266 Ga0496115_0061266_401_1189 262
54 3300053085 Ga0495619_0297746 Ga0495619_0297746_241_1056 262
55 iso_pu_bacteria 2565956761 2566992740 262
56 iso_pu_bacteria 2738541308 2738886801 262
57 iso_pu_bacteria 2904535858 2904540256 262
58 iso_pu_bacteria 2922554459 2922556286 262
59 3300005354 Ga0070675_100355880 Ga0070675_1003558801 264
60 3300005543 Ga0070672_100012044 Ga0070672_1000120443 264
61 3300009545 Ga0105237_10194481 Ga0105237_101944812 264
62 3300011119 Ga0105246_10206848 Ga0105246_102068481 264
63 3300025914 Ga0207671_10122033 Ga0207671_101220332 264
64 3300025926 Ga0207659_10614339 Ga0207659_106143391 264
65 3300025936 Ga0207670_10291581 Ga0207670_102915812 264
66 3300006048 Ga0075363_100081878 Ga0075363_1000818782 266
67 3300006178 Ga0075367_10141418 Ga0075367_101414182 266
68 3300006844 Ga0075428_100086121 Ga0075428_1000861212 266
69 3300006880 Ga0075429_100033298 Ga0075429_1000332983 266
70 3300047321 Ga0495676_0326086 Ga0495676_0326086_99_911 266
71 3300048911 Ga0496108_0252065 Ga0496108_0252065_402_1208 266
72 3300048911 Ga0496108_0551448 Ga0496108_0551448_16_828 266
73 3300048928 Ga0496125_0010602 Ga0496125_0010602_6348_7154 266
74 3300050490 nmdc:mga03n38_181039_c1 nmdc:mga03n38_181039_c1_142_948 266
75 3300050491 nmdc:mga00v17_365685_c1 nmdc:mga00v17_365685_c1_121_927 266
76 3300050494 nmdc:mga06z11_126358_c1 nmdc:mga06z11_126358_c1_322_1128 266
77 3300050496 nmdc:mga07m45_117410_c1 nmdc:mga07m45_117410_c1_604_1410 266
78 3300050496 nmdc:mga07m45_30412_c1 nmdc:mga07m45_30412_c1_1388_2194 266
79 3300050508 nmdc:mga09592_267900_c1 nmdc:mga09592_267900_c1_466_1278 266
80 iso_pu_bacteria 2738543011 2739238840 266
81 iso_pu_bacteria 2889300758 2889301115 266
82 iso_pu_bacteria 2939743619 2939744633 266
83 3300005985 Ga0081539_10011881 Ga0081539_100118815 267
84 3300005546 Ga0070696_100163589 Ga0070696_1001635892 268
85 3300031901 Ga0307406_10054494 Ga0307406_100544943 268
86 3300048905 Ga0496102_0642914 Ga0496102_0642914_90_929 268
87 3300021388 Ga0213875_10049004 Ga0213875_100490042 269
88 3300037853 Ga0436364_0224006 Ga0436364_0224006_23718_24527 269
89 3300048916 Ga0496113_0449706 Ga0496113_0449706_159_968 269
90 3300009148 Ga0105243_10002819 Ga0105243_1000281913 270
91 iso_pu_bacteria 2738541274 2738706391 270
92 iso_pu_bacteria 2738543028 2739328882 270
93 iso_pu_bacteria 2902799365 2902804165 270
94 iso_pu_bacteria 2902810491 2902814480 270
95 iso_pu_bacteria 2902837492 2902839197 270
96 iso_pu_bacteria 2929212328 2929217933 270
97 iso_pu_bacteria 2939582691 2939585159 270
98 3300005434 Ga0070709_10395981 Ga0070709_103959812 271
99 3300005981 Ga0081538_10129562 Ga0081538_101295622 271
100 3300025928 Ga0207700_10175675 Ga0207700_101756752 271
101 3300025939 Ga0207665_10409517 Ga0207665_104095171 271
102 3300036712 Ga0316584_0146764 Ga0316584_0146764_223_1041 271
103 3300037853 Ga0436364_0330612 Ga0436364_0330612_3438_4256 271
104 3300039437 Ga0436365_0305981 Ga0436365_0305981_130_948 271
105 3300039437 Ga0436365_1865812 Ga0436365_1865812_957_1775 271
106 3300044683 Ga0466965_0212320 Ga0466965_0212320_186_1004 271
107 3300044684 Ga0466966_0000813 Ga0466966_0000813_3725_4543 271
108 3300044693 Ga0466961_0176666 Ga0466961_0176666_483_1301 271
109 3300044694 Ga0466963_0025090 Ga0466963_0025090_2615_3433 271
110 3300044735 Ga0466968_0008858 Ga0466968_0008858_3003_3821 271
111 3300045836 Ga0466958_0002045 Ga0466958_0002045_189_1007 271
112 iso_pu_bacteria 2643221715 2644636436 271
113 iso_pu_bacteria 2738541264 2738667382 271
114 iso_pu_bacteria 2738541356 2739146225 271
115 iso_pu_bacteria 2842134933 2842140355 271
116 3300021377 Ga0213874_10011657 Ga0213874_100116572 272
117 3300039437 Ga0436365_0397989 Ga0436365_0397989_5955_6773 272
118 3300039450 Ga0436363_0064425 Ga0436363_0064425_1607_2428 272
119 3300039447 Ga0436361_0877000 Ga0436361_0877000_41_862 273
120 3300048905 Ga0496102_0018476 Ga0496102_0018476_1501_2322 273
121 3300048906 Ga0496103_0148481 Ga0496103_0148481_129_950 273
122 3300048920 Ga0496117_0060123 Ga0496117_0060123_928_1749 273
123 3300048921 Ga0496118_0002892 Ga0496118_0002892_15849_16670 273
124 3300005329 Ga0070683_100097685 Ga0070683_1000976852 274
125 3300005334 Ga0068869_100035108 Ga0068869_1000351082 274
126 3300005347 Ga0070668_100135484 Ga0070668_1001354842 274
127 3300005353 Ga0070669_100014698 Ga0070669_1000146982 274
128 3300005354 Ga0070675_100236273 Ga0070675_1002362732 274
129 3300005356 Ga0070674_100280033 Ga0070674_1002800332 274
130 3300005365 Ga0070688_100033363 Ga0070688_1000333632 274
131 3300005367 Ga0070667_100000487 Ga0070667_1000004874 274
132 3300005435 Ga0070714_100613305 Ga0070714_1006133052 274
133 3300005455 Ga0070663_100044819 Ga0070663_1000448192 274
134 3300005466 Ga0070685_10034804 Ga0070685_100348043 274
135 3300005530 Ga0070679_100382584 Ga0070679_1003825842 274
136 3300005535 Ga0070684_100326862 Ga0070684_1003268622 274
137 3300005543 Ga0070672_100147164 Ga0070672_1001471642 274
138 3300005546 Ga0070696_100430733 Ga0070696_1004307331 274
139 3300005548 Ga0070665_100025634 Ga0070665_1000256346 274
140 3300005548 Ga0070665_100052834 Ga0070665_1000528342 274
141 3300005616 Ga0068852_100061404 Ga0068852_1000614042 274
142 3300005616 Ga0068852_100443990 Ga0068852_1004439902 274
143 3300005617 Ga0068859_100001593 Ga0068859_1000015937 274
144 3300005617 Ga0068859_100039617 Ga0068859_1000396172 274
145 3300005719 Ga0068861_100053061 Ga0068861_1000530613 274
146 3300005834 Ga0068851_10053411 Ga0068851_100534112 274
147 3300005841 Ga0068863_100000143 Ga0068863_10000014341 274
148 3300005842 Ga0068858_100071964 Ga0068858_1000719643 274
149 3300005842 Ga0068858_100173277 Ga0068858_1001732772 274
150 3300005843 Ga0068860_100000079 Ga0068860_100000079107 274
151 3300005844 Ga0068862_100000093 Ga0068862_10000009343 274
152 3300005844 Ga0068862_100042656 Ga0068862_1000426563 274
153 3300006038 Ga0075365_10024094 Ga0075365_100240943 274
154 3300006038 Ga0075365_10039518 Ga0075365_100395182 274
155 3300006038 Ga0075365_10266804 Ga0075365_102668042 274
156 3300006048 Ga0075363_100005404 Ga0075363_1000054043 274
157 3300006048 Ga0075363_100021949 Ga0075363_1000219492 274
158 3300006048 Ga0075363_100049716 Ga0075363_1000497162 274
159 3300006048 Ga0075363_100190669 Ga0075363_1001906691 274
160 3300006051 Ga0075364_10004041 Ga0075364_100040419 274
161 3300006051 Ga0075364_10032394 Ga0075364_100323942 274
162 3300006051 Ga0075364_10235411 Ga0075364_102354112 274
163 3300006163 Ga0070715_10097834 Ga0070715_100978342 274
164 3300006173 Ga0070716_100297001 Ga0070716_1002970012 274
165 3300006175 Ga0070712_100015167 Ga0070712_1000151674 274
166 3300006177 Ga0075362_10028730 Ga0075362_100287302 274
167 3300006178 Ga0075367_10010291 Ga0075367_100102912 274
168 3300006178 Ga0075367_10082365 Ga0075367_100823652 274
169 3300006186 Ga0075369_10058467 Ga0075369_100584672 274
170 3300006353 Ga0075370_10010734 Ga0075370_100107344 274
171 3300006353 Ga0075370_10024117 Ga0075370_100241172 274
172 3300006353 Ga0075370_10025841 Ga0075370_100258414 274
173 3300006844 Ga0075428_100007875 Ga0075428_1000078755 274
174 3300006846 Ga0075430_100018039 Ga0075430_1000180394 274
175 3300006881 Ga0068865_100148738 Ga0068865_1001487381 274
176 3300006931 Ga0097620_100001593 Ga0097620_10000159319 274
177 3300006931 Ga0097620_100039617 Ga0097620_1000396174 274
178 3300009098 Ga0105245_10130542 Ga0105245_101305422 274
179 3300009101 Ga0105247_10000044 Ga0105247_1000004423 274
180 3300009101 Ga0105247_10034465 Ga0105247_100344653 274
181 3300009147 Ga0114129_10100127 Ga0114129_101001274 274
182 3300009177 Ga0105248_10000060 Ga0105248_10000060104 274
183 3300009545 Ga0105237_10001746 Ga0105237_1000174633 274
184 3300009551 Ga0105238_10068604 Ga0105238_100686044 274
185 3300009553 Ga0105249_10000049 Ga0105249_10000049106 274
186 3300009553 Ga0105249_10249935 Ga0105249_102499352 274
187 3300009553 Ga0105249_10408912 Ga0105249_104089121 274
188 3300010375 Ga0105239_10003558 Ga0105239_1000355813 274
189 3300010375 Ga0105239_10137217 Ga0105239_101372173 274
190 3300010375 Ga0105239_10339415 Ga0105239_103394152 274
191 3300011119 Ga0105246_10015077 Ga0105246_100150775 274
192 3300013296 Ga0157374_10103932 Ga0157374_101039322 274
193 3300013297 Ga0157378_10287840 Ga0157378_102878402 274
194 3300013306 Ga0163162_10058900 Ga0163162_100589003 274
195 3300013306 Ga0163162_10341042 Ga0163162_103410421 274
196 3300013306 Ga0163162_10539497 Ga0163162_105394972 274
197 3300014325 Ga0163163_10067722 Ga0163163_100677224 274
198 3300014326 Ga0157380_10106390 Ga0157380_101063902 274
199 3300014745 Ga0157377_10000892 Ga0157377_100008927 274
200 3300014968 Ga0157379_10612246 Ga0157379_106122461 274
201 3300021384 Ga0213876_10001760 Ga0213876_100017604 274
202 3300021388 Ga0213875_10018469 Ga0213875_100184692 274
203 3300025303 Ga0209051_1000776 Ga0209051_100077625 274
204 3300025898 Ga0207692_10156047 Ga0207692_101560472 274
205 3300025899 Ga0207642_10031402 Ga0207642_100314021 274
206 3300025900 Ga0207710_10000066 Ga0207710_10000066107 274
207 3300025901 Ga0207688_10016401 Ga0207688_100164014 274
208 3300025905 Ga0207685_10007375 Ga0207685_100073752 274
209 3300025906 Ga0207699_10084238 Ga0207699_100842382 274
210 3300025914 Ga0207671_10008052 Ga0207671_100080528 274
211 3300025915 Ga0207693_10002311 Ga0207693_100023115 274
212 3300025916 Ga0207663_10157453 Ga0207663_101574532 274
213 3300025921 Ga0207652_10412153 Ga0207652_104121532 274
214 3300025923 Ga0207681_10002233 Ga0207681_100022334 274
215 3300025924 Ga0207694_10050232 Ga0207694_100502324 274
216 3300025926 Ga0207659_10061826 Ga0207659_100618262 274
217 3300025927 Ga0207687_10068149 Ga0207687_100681492 274
218 3300025932 Ga0207690_10239644 Ga0207690_102396442 274
219 3300025935 Ga0207709_10414918 Ga0207709_104149182 274
220 3300025937 Ga0207669_10170811 Ga0207669_101708112 274
221 3300025937 Ga0207669_10203134 Ga0207669_102031342 274
222 3300025937 Ga0207669_10599841 Ga0207669_105998411 274
223 3300025939 Ga0207665_10061230 Ga0207665_100612302 274
224 3300025940 Ga0207691_10157649 Ga0207691_101576492 274
225 3300025941 Ga0207711_10000058 Ga0207711_1000005817 274
226 3300025942 Ga0207689_10074866 Ga0207689_100748662 274
227 3300025961 Ga0207712_10000038 Ga0207712_10000038120 274
228 3300025961 Ga0207712_10090968 Ga0207712_100909682 274
229 3300025961 Ga0207712_10099840 Ga0207712_100998402 274
230 3300025972 Ga0207668_10121008 Ga0207668_101210082 274
231 3300025981 Ga0207640_10279196 Ga0207640_102791961 274
232 3300025986 Ga0207658_10000061 Ga0207658_10000061106 274
233 3300026035 Ga0207703_10069764 Ga0207703_100697642 274
234 3300026067 Ga0207678_10039301 Ga0207678_100393012 274
235 3300026067 Ga0207678_10576849 Ga0207678_105768491 274
236 3300026075 Ga0207708_10017860 Ga0207708_100178604 274
237 3300026078 Ga0207702_10501162 Ga0207702_105011622 274
238 3300026088 Ga0207641_10000232 Ga0207641_1000023242 274
239 3300026089 Ga0207648_10037367 Ga0207648_100373674 274
240 3300026118 Ga0207675_100037611 Ga0207675_1000376114 274
241 3300026118 Ga0207675_100070125 Ga0207675_1000701253 274
242 3300026118 Ga0207675_100256663 Ga0207675_1002566631 274
243 3300026121 Ga0207683_10151606 Ga0207683_101516062 274
244 3300026142 Ga0207698_10032304 Ga0207698_100323045 274
245 3300026142 Ga0207698_10393654 Ga0207698_103936542 274
246 3300027866 Ga0209813_10080888 Ga0209813_100808882 274
247 3300027907 Ga0207428_10327152 Ga0207428_103271522 274
248 3300028379 Ga0268266_10018080 Ga0268266_100180802 274
249 3300028380 Ga0268265_10000053 Ga0268265_1000005343 274
250 3300028381 Ga0268264_10000017 Ga0268264_10000017105 274
251 3300028381 Ga0268264_10462886 Ga0268264_104628861 274
252 3300031251 Ga0265327_10000128 Ga0265327_1000012895 274
253 3300031251 Ga0265327_10006336 Ga0265327_100063364 274
254 3300031548 Ga0307408_100125838 Ga0307408_1001258382 274
255 3300031824 Ga0307413_10007594 Ga0307413_100075942 274
256 3300031852 Ga0307410_10016048 Ga0307410_100160484 274
257 3300031852 Ga0307410_10016844 Ga0307410_100168444 274
258 3300031852 Ga0307410_10492175 Ga0307410_104921752 274
259 3300031901 Ga0307406_10072081 Ga0307406_100720812 274
260 3300031995 Ga0307409_100003692 Ga0307409_1000036928 274
261 3300031995 Ga0307409_100201500 Ga0307409_1002015002 274
262 3300032002 Ga0307416_100023582 Ga0307416_1000235823 274
263 3300032002 Ga0307416_100215654 Ga0307416_1002156542 274
264 3300032004 Ga0307414_10159849 Ga0307414_101598492 274
265 3300032126 Ga0307415_100007009 Ga0307415_1000070092 274
266 3300035112 Ga0373932_0093643 Ga0373932_0093643_15_839 274
267 3300037853 Ga0436364_1545518 Ga0436364_1545518_894_1718 274
268 3300039437 Ga0436365_0271296 Ga0436365_0271296_3367_4191 274
269 3300039437 Ga0436365_0667324 Ga0436365_0667324_249_1076 274
270 3300041413 Ga0439465_0003069 Ga0439465_0003069_3150_3974 274
271 3300044683 Ga0466965_0078183 Ga0466965_0078183_146_970 274
272 3300044684 Ga0466966_0002596 Ga0466966_0002596_2127_2951 274
273 3300044684 Ga0466966_0250944 Ga0466966_0250944_33_857 274
274 3300044693 Ga0466961_0169704 Ga0466961_0169704_275_1099 274
275 3300044694 Ga0466963_0254140 Ga0466963_0254140_165_989 274
276 3300044765 Ga0466970_0034811 Ga0466970_0034811_1497_2321 274
277 3300045049 Ga0466959_0037158 Ga0466959_0037158_468_1292 274
278 3300045836 Ga0466958_0064199 Ga0466958_0064199_1259_2083 274
279 3300045976 Ga0466967_0109327 Ga0466967_0109327_244_1068 274
280 3300045976 Ga0466967_0599314 Ga0466967_0599314_134_958 274
281 3300045976 Ga0466967_0798539 Ga0466967_0798539_64_888 274
282 3300047320 Ga0495672_0124149 Ga0495672_0124149_200_1024 274
283 3300048903 Ga0496100_0002877 Ga0496100_0002877_3194_4021 274
284 3300048903 Ga0496100_0009461 Ga0496100_0009461_377_1204 274
285 3300048903 Ga0496100_0467895 Ga0496100_0467895_95_919 274
286 3300048904 Ga0496101_0000031 Ga0496101_0000031_13338_14165 274
287 3300048904 Ga0496101_0032368 Ga0496101_0032368_182_1009 274
288 3300048905 Ga0496102_0000065 Ga0496102_0000065_59927_60754 274
289 3300048905 Ga0496102_0000336 Ga0496102_0000336_55637_56464 274
290 3300048905 Ga0496102_0050101 Ga0496102_0050101_12_836 274
291 3300048905 Ga0496102_0078800 Ga0496102_0078800_1860_2687 274
292 3300048905 Ga0496102_0244389 Ga0496102_0244389_280_1104 274
293 3300048906 Ga0496103_0000048 Ga0496103_0000048_59468_60295 274
294 3300048906 Ga0496103_0000271 Ga0496103_0000271_3921_4748 274
295 3300048906 Ga0496103_0048212 Ga0496103_0048212_546_1370 274
296 3300048907 Ga0496104_0198545 Ga0496104_0198545_391_1215 274
297 3300048908 Ga0496105_0283264 Ga0496105_0283264_36_863 274
298 3300048909 Ga0496106_0098255 Ga0496106_0098255_64_891 274
299 3300048910 Ga0496107_0010437 Ga0496107_0010437_5372_6199 274
300 3300048911 Ga0496108_0001208 Ga0496108_0001208_6365_7189 274
301 3300048912 Ga0496109_0016720 Ga0496109_0016720_853_1677 274
302 3300048913 Ga0496110_0145954 Ga0496110_0145954_193_1017 274
303 3300048915 Ga0496112_0019097 Ga0496112_0019097_5158_5982 274
304 3300048916 Ga0496113_0202789 Ga0496113_0202789_79_903 274
305 3300048917 Ga0496114_0155902 Ga0496114_0155902_852_1676 274
306 3300048918 Ga0496115_0266868 Ga0496115_0266868_273_1097 274
307 3300048919 Ga0496116_0000125 Ga0496116_0000125_100617_101444 274
308 3300048920 Ga0496117_0000111 Ga0496117_0000111_100617_101444 274
309 3300048920 Ga0496117_0001352 Ga0496117_0001352_26804_27631 274
310 3300048921 Ga0496118_0000083 Ga0496118_0000083_100617_101444 274
311 3300048922 Ga0496119_0004014 Ga0496119_0004014_10461_11288 274
312 3300048922 Ga0496119_0010640 Ga0496119_0010640_510_1337 274
313 3300048923 Ga0496120_0001769 Ga0496120_0001769_9650_10477 274
314 3300048923 Ga0496120_0012983 Ga0496120_0012983_696_1523 274
315 3300048924 Ga0496121_0001000 Ga0496121_0001000_40904_41731 274
316 3300048924 Ga0496121_0009717 Ga0496121_0009717_8740_9567 274
317 3300048927 Ga0496124_0093145 Ga0496124_0093145_755_1582 274
318 3300048929 Ga0496126_0000220 Ga0496126_0000220_17383_18210 274
319 3300048929 Ga0496126_0004252 Ga0496126_0004252_4479_5303 274
320 3300048929 Ga0496126_0026981 Ga0496126_0026981_30_857 274
321 3300048929 Ga0496126_0061092 Ga0496126_0061092_2195_3019 274
322 3300049581 Ga0501047_0285267 Ga0501047_0285267_85_912 274
323 3300049586 Ga0501070_0072994 Ga0501070_0072994_1578_2405 274
324 3300049586 Ga0501070_0328633 Ga0501070_0328633_21_845 274
325 3300050490 nmdc:mga03n38_3117_c1 nmdc:mga03n38_3117_c1_2319_3143 274
326 3300050491 nmdc:mga00v17_137800_c1 nmdc:mga00v17_137800_c1_207_1034 274
327 3300050491 nmdc:mga00v17_231009_c1 nmdc:mga00v17_231009_c1_269_1093 274
328 3300050491 nmdc:mga00v17_33164_c1 nmdc:mga00v17_33164_c1_408_1235 274
329 3300050491 nmdc:mga00v17_5765_c1 nmdc:mga00v17_5765_c1_5612_6436 274
330 3300050492 nmdc:mga0yw44_106161_c1 nmdc:mga0yw44_106161_c1_184_1008 274
331 3300050492 nmdc:mga0yw44_234951_c1 nmdc:mga0yw44_234951_c1_280_1107 274
332 3300050492 nmdc:mga0yw44_29716_c1 nmdc:mga0yw44_29716_c1_384_1211 274
333 3300050492 nmdc:mga0yw44_4095_c1 nmdc:mga0yw44_4095_c1_2377_3201 274
334 3300050494 nmdc:mga06z11_119734_c1 nmdc:mga06z11_119734_c1_317_1144 274
335 3300050496 nmdc:mga07m45_15921_c1 nmdc:mga07m45_15921_c1_2159_2986 274
336 3300050507 nmdc:mga05p37_292603_c1 nmdc:mga05p37_292603_c1_764_1588 274
337 3300050509 nmdc:mga0qj67_4393_c1 nmdc:mga0qj67_4393_c1_8873_9697 274
338 3300050510 nmdc:mga06r32_27527_c1 nmdc:mga06r32_27527_c1_2321_3145 274
339 3300050511 nmdc:mga08y16_180117_c1 nmdc:mga08y16_180117_c1_656_1483 274
340 3300050516 nmdc:mga0sz30_112759_c1 nmdc:mga0sz30_112759_c1_291_1115 274
341 3300053080 Ga0500635_0158296 Ga0500635_0158296_32_856 274
342 3300053104 Ga0500556_0075347 Ga0500556_0075347_383_1210 274
343 3300053108 Ga0500562_005526 Ga0500562_005526_333_1160 274
344 3300053130 Ga0500642_0098975 Ga0500642_0098975_138_962 274
345 3300053136 Ga0500559_0027977 Ga0500559_0027977_827_1651 274
346 3300053730 Ga0500645_000056 Ga0500645_000056_11327_12151 274
347 3300002077 JGI24744J21845_10001723 JGI24744J21845_100017233 275
348 3300002459 JGI24751J29686_10003832 JGI24751J29686_100038322 275
349 3300003320 rootH2_10026628 rootH2_100266282 275
350 3300003792 Ga0055540_1000071 Ga0055540_1000071101 275
351 3300005328 Ga0070676_10020266 Ga0070676_100202662 275
352 3300005330 Ga0070690_100009227 Ga0070690_1000092273 275
353 3300005334 Ga0068869_100112349 Ga0068869_1001123492 275
354 3300005335 Ga0070666_10041951 Ga0070666_100419514 275
355 3300005337 Ga0070682_100143051 Ga0070682_1001430512 275
356 3300005337 Ga0070682_100209449 Ga0070682_1002094492 275
357 3300005338 Ga0068868_100245685 Ga0068868_1002456852 275
358 3300005339 Ga0070660_100081262 Ga0070660_1000812622 275
359 3300005341 Ga0070691_10009713 Ga0070691_100097132 275
360 3300005347 Ga0070668_100064945 Ga0070668_1000649452 275
361 3300005355 Ga0070671_100012917 Ga0070671_1000129175 275
362 3300005355 Ga0070671_100072449 Ga0070671_1000724492 275
363 3300005356 Ga0070674_100029289 Ga0070674_1000292894 275
364 3300005365 Ga0070688_100083368 Ga0070688_1000833682 275
365 3300005366 Ga0070659_100028276 Ga0070659_1000282765 275
366 3300005367 Ga0070667_100000324 Ga0070667_1000003245 275
367 3300005367 Ga0070667_100051434 Ga0070667_1000514342 275
368 3300005367 Ga0070667_100249837 Ga0070667_1002498372 275
369 3300005434 Ga0070709_10020029 Ga0070709_100200295 275
370 3300005435 Ga0070714_100005497 Ga0070714_1000054972 275
371 3300005435 Ga0070714_100105457 Ga0070714_1001054573 275
372 3300005435 Ga0070714_100240534 Ga0070714_1002405342 275
373 3300005436 Ga0070713_100098824 Ga0070713_1000988242 275
374 3300005437 Ga0070710_10000927 Ga0070710_1000092712 275
375 3300005437 Ga0070710_10051683 Ga0070710_100516832 275
376 3300005438 Ga0070701_10001711 Ga0070701_100017116 275
377 3300005439 Ga0070711_100003543 Ga0070711_1000035436 275
378 3300005440 Ga0070705_100004167 Ga0070705_1000041678 275
379 3300005441 Ga0070700_100032254 Ga0070700_1000322544 275
380 3300005455 Ga0070663_100007666 Ga0070663_1000076664 275
381 3300005455 Ga0070663_100009243 Ga0070663_1000092436 275
382 3300005456 Ga0070678_100001013 Ga0070678_10000101312 275
383 3300005457 Ga0070662_100071228 Ga0070662_1000712282 275
384 3300005459 Ga0068867_100008434 Ga0068867_1000084346 275
385 3300005466 Ga0070685_10043257 Ga0070685_100432572 275
386 3300005543 Ga0070672_100144039 Ga0070672_1001440392 275
387 3300005543 Ga0070672_100347558 Ga0070672_1003475582 275
388 3300005544 Ga0070686_100253374 Ga0070686_1002533742 275
389 3300005545 Ga0070695_100032619 Ga0070695_1000326195 275
390 3300005546 Ga0070696_100010973 Ga0070696_1000109735 275
391 3300005548 Ga0070665_100024159 Ga0070665_1000241594 275
392 3300005548 Ga0070665_100039882 Ga0070665_1000398824 275
393 3300005549 Ga0070704_100010458 Ga0070704_1000104584 275
394 3300005578 Ga0068854_100001661 Ga0068854_1000016616 275
395 3300005614 Ga0068856_100403371 Ga0068856_1004033712 275
396 3300005615 Ga0070702_100016568 Ga0070702_1000165685 275
397 3300005615 Ga0070702_100355001 Ga0070702_1003550011 275
398 3300005616 Ga0068852_100094130 Ga0068852_1000941302 275
399 3300005617 Ga0068859_100012513 Ga0068859_1000125138 275
400 3300005617 Ga0068859_100408678 Ga0068859_1004086782 275
401 3300005617 Ga0068859_100472641 Ga0068859_1004726412 275
402 3300005841 Ga0068863_100003638 Ga0068863_1000036385 275
403 3300005841 Ga0068863_100091564 Ga0068863_1000915642 275
404 3300005842 Ga0068858_100072593 Ga0068858_1000725932 275
405 3300005843 Ga0068860_100005332 Ga0068860_10000533211 275
406 3300005843 Ga0068860_100607901 Ga0068860_1006079012 275
407 3300005844 Ga0068862_100073395 Ga0068862_1000733953 275
408 3300005844 Ga0068862_100235685 Ga0068862_1002356852 275
409 3300006038 Ga0075365_10004388 Ga0075365_100043882 275
410 3300006048 Ga0075363_100001134 Ga0075363_1000011344 275
411 3300006048 Ga0075363_100014757 Ga0075363_1000147572 275
412 3300006048 Ga0075363_100034794 Ga0075363_1000347942 275
413 3300006051 Ga0075364_10005464 Ga0075364_100054642 275
414 3300006051 Ga0075364_10006554 Ga0075364_100065548 275
415 3300006051 Ga0075364_10024282 Ga0075364_100242822 275
416 3300006175 Ga0070712_100009663 Ga0070712_1000096634 275
417 3300006177 Ga0075362_10040478 Ga0075362_100404782 275
418 3300006186 Ga0075369_10000029 Ga0075369_1000002910 275
419 3300006186 Ga0075369_10048200 Ga0075369_100482002 275
420 3300006237 Ga0097621_100008957 Ga0097621_1000089578 275
421 3300006881 Ga0068865_100031398 Ga0068865_1000313983 275
422 3300006931 Ga0097620_100012512 Ga0097620_1000125128 275
423 3300006931 Ga0097620_100408685 Ga0097620_1004086852 275
424 3300006931 Ga0097620_100472679 Ga0097620_1004726792 275
425 3300009098 Ga0105245_10006858 Ga0105245_100068586 275
426 3300009098 Ga0105245_10365107 Ga0105245_103651072 275
427 3300009098 Ga0105245_10674334 Ga0105245_106743341 275
428 3300009101 Ga0105247_10002130 Ga0105247_100021306 275
429 3300009148 Ga0105243_10011604 Ga0105243_100116044 275
430 3300009174 Ga0105241_10017700 Ga0105241_100177005 275
431 3300009176 Ga0105242_10002099 Ga0105242_100020994 275
432 3300009545 Ga0105237_10027148 Ga0105237_100271487 275
433 3300009553 Ga0105249_10006471 Ga0105249_1000647110 275
434 3300009553 Ga0105249_10031917 Ga0105249_100319172 275
435 3300009553 Ga0105249_10526973 Ga0105249_105269732 275
436 3300010375 Ga0105239_10136848 Ga0105239_101368484 275
437 3300011119 Ga0105246_10252536 Ga0105246_102525362 275
438 3300011119 Ga0105246_10311319 Ga0105246_103113192 275
439 3300013297 Ga0157378_10006985 Ga0157378_100069852 275
440 3300013306 Ga0163162_10061855 Ga0163162_100618552 275
441 3300013307 Ga0157372_10021406 Ga0157372_100214064 275
442 3300013308 Ga0157375_10090288 Ga0157375_100902883 275
443 3300014325 Ga0163163_10045830 Ga0163163_100458303 275
444 3300014325 Ga0163163_10464585 Ga0163163_104645852 275
445 3300014325 Ga0163163_10488096 Ga0163163_104880961 275
446 3300014326 Ga0157380_10003346 Ga0157380_1000334610 275
447 3300014745 Ga0157377_10098470 Ga0157377_100984702 275
448 3300014968 Ga0157379_10076026 Ga0157379_100760262 275
449 3300017792 Ga0163161_10001520 Ga0163161_1000152016 275
450 3300025303 Ga0209051_1000033 Ga0209051_1000033334 275
451 3300025303 Ga0209051_1014386 Ga0209051_10143861 275
452 3300025898 Ga0207692_10026329 Ga0207692_100263293 275
453 3300025898 Ga0207692_10110014 Ga0207692_101100142 275
454 3300025900 Ga0207710_10007366 Ga0207710_100073662 275
455 3300025901 Ga0207688_10001970 Ga0207688_100019702 275
456 3300025903 Ga0207680_10080750 Ga0207680_100807502 275
457 3300025904 Ga0207647_10039971 Ga0207647_100399712 275
458 3300025906 Ga0207699_10023723 Ga0207699_100237232 275
459 3300025907 Ga0207645_10011325 Ga0207645_100113254 275
460 3300025915 Ga0207693_10000197 Ga0207693_100001975 275
461 3300025916 Ga0207663_10128567 Ga0207663_101285672 275
462 3300025923 Ga0207681_10083257 Ga0207681_100832573 275
463 3300025927 Ga0207687_10235839 Ga0207687_102358392 275
464 3300025928 Ga0207700_10017600 Ga0207700_100176002 275
465 3300025929 Ga0207664_10082060 Ga0207664_100820602 275
466 3300025929 Ga0207664_10144061 Ga0207664_101440612 275
467 3300025931 Ga0207644_10019633 Ga0207644_100196332 275
468 3300025932 Ga0207690_10347956 Ga0207690_103479562 275
469 3300025933 Ga0207706_10002775 Ga0207706_100027756 275
470 3300025935 Ga0207709_10012393 Ga0207709_100123934 275
471 3300025936 Ga0207670_10050027 Ga0207670_100500272 275
472 3300025937 Ga0207669_10004342 Ga0207669_100043426 275
473 3300025939 Ga0207665_10007522 Ga0207665_100075226 275
474 3300025940 Ga0207691_10079226 Ga0207691_100792262 275
475 3300025941 Ga0207711_10023946 Ga0207711_100239464 275
476 3300025942 Ga0207689_10045502 Ga0207689_100455023 275
477 3300025949 Ga0207667_10129394 Ga0207667_101293942 275
478 3300025960 Ga0207651_10694486 Ga0207651_106944861 275
479 3300025972 Ga0207668_10001652 Ga0207668_100016524 275
480 3300025972 Ga0207668_10025482 Ga0207668_100254822 275
481 3300025981 Ga0207640_10059653 Ga0207640_100596532 275
482 3300025986 Ga0207658_10006720 Ga0207658_100067207 275
483 3300026023 Ga0207677_10006626 Ga0207677_100066264 275
484 3300026023 Ga0207677_10207403 Ga0207677_102074032 275
485 3300026067 Ga0207678_10010285 Ga0207678_100102854 275
486 3300026075 Ga0207708_10003700 Ga0207708_100037005 275
487 3300026078 Ga0207702_10359874 Ga0207702_103598742 275
488 3300026088 Ga0207641_10006641 Ga0207641_100066416 275
489 3300026088 Ga0207641_10127987 Ga0207641_101279872 275
490 3300026089 Ga0207648_10004179 Ga0207648_100041794 275
491 3300026118 Ga0207675_100003156 Ga0207675_1000031566 275
492 3300026121 Ga0207683_10003067 Ga0207683_1000306712 275
493 3300027866 Ga0209813_10049296 Ga0209813_100492962 275
494 3300028379 Ga0268266_10009675 Ga0268266_100096755 275
495 3300028381 Ga0268264_10027953 Ga0268264_100279533 275
496 3300028381 Ga0268264_10515638 Ga0268264_105156381 275
497 3300031251 Ga0265327_10002212 Ga0265327_1000221221 275
498 3300037466 Ga0395898_0373492 Ga0395898_0373492_133_960 275
499 3300038443 Ga0395901_0542194 Ga0395901_0542194_208_1035 275
500 3300039437 Ga0436365_0039491 Ga0436365_0039491_2117_2944 275
501 3300039438 Ga0436360_0933631 Ga0436360_0933631_42_869 275
502 3300041411 Ga0439466_0006376 Ga0439466_0006376_2729_3556 275
503 3300041413 Ga0439465_0005177 Ga0439465_0005177_2935_3762 275
504 3300041451 Ga0451791_1164627 Ga0451791_1164627_128_991 275
505 3300041491 Ga0451833_1108409 Ga0451833_1108409_217_1071 275
506 3300042002 Ga0439442_008348 Ga0439442_008348_261_1088 275
507 3300042435 Ga0439434_0005195 Ga0439434_0005195_630_1457 275
508 3300042436 Ga0439435_0025868 Ga0439435_0025868_707_1534 275
509 3300044658 Ga0466972_0001604 Ga0466972_0001604_8984_9838 275
510 3300044658 Ga0466972_0015260 Ga0466972_0015260_2685_3512 275
511 3300044658 Ga0466972_0028614 Ga0466972_0028614_1001_1828 275
512 3300044658 Ga0466972_0060937 Ga0466972_0060937_318_1145 275
513 3300044683 Ga0466965_0000732 Ga0466965_0000732_6820_7647 275
514 3300044683 Ga0466965_0009878 Ga0466965_0009878_1262_2089 275
515 3300044683 Ga0466965_0029526 Ga0466965_0029526_1252_2079 275
516 3300044684 Ga0466966_0030448 Ga0466966_0030448_16_843 275
517 3300044693 Ga0466961_0016015 Ga0466961_0016015_335_1162 275
518 3300044706 Ga0466964_0132745 Ga0466964_0132745_252_1079 275
519 3300044719 Ga0466971_0003487 Ga0466971_0003487_3073_3900 275
520 3300044719 Ga0466971_0029775 Ga0466971_0029775_588_1415 275
521 3300044735 Ga0466968_0007528 Ga0466968_0007528_482_1336 275
522 3300044735 Ga0466968_0062049 Ga0466968_0062049_643_1470 275
523 3300044765 Ga0466970_0004676 Ga0466970_0004676_2356_3183 275
524 3300044765 Ga0466970_0086437 Ga0466970_0086437_41_895 275
525 3300044842 Ga0466957_0001665 Ga0466957_0001665_1209_2063 275
526 3300044842 Ga0466957_0097691 Ga0466957_0097691_143_970 275
527 3300044901 Ga0466960_0000220 Ga0466960_0000220_8646_9473 275
528 3300044901 Ga0466960_0001412 Ga0466960_0001412_5420_6247 275
529 3300045049 Ga0466959_0020200 Ga0466959_0020200_421_1248 275
530 3300045049 Ga0466959_0307855 Ga0466959_0307855_238_1065 275
531 3300045836 Ga0466958_0013952 Ga0466958_0013952_888_1715 275
532 3300045836 Ga0466958_0024005 Ga0466958_0024005_19_846 275
533 3300045836 Ga0466958_0047984 Ga0466958_0047984_897_1751 275
534 3300045976 Ga0466967_0001559 Ga0466967_0001559_609_1463 275
535 3300045976 Ga0466967_0014046 Ga0466967_0014046_4691_5518 275
536 3300045976 Ga0466967_0564149 Ga0466967_0564149_269_1096 275
537 3300046459 Ga0495629_0211148 Ga0495629_0211148_286_1116 275
538 3300046460 Ga0495638_0044175 Ga0495638_0044175_162_992 275
539 3300046474 Ga0495605_0075416 Ga0495605_0075416_22_852 275
540 3300046475 Ga0495639_0033636 Ga0495639_0033636_1253_2083 275
541 3300046506 Ga0495583_0034916 Ga0495583_0034916_1137_1964 275
542 3300046507 Ga0495606_0119408 Ga0495606_0119408_726_1553 275
543 3300046533 Ga0495640_0061351 Ga0495640_0061351_553_1383 275
544 3300046616 Ga0495668_0068491 Ga0495668_0068491_65_892 275
545 3300046616 Ga0495668_0215480 Ga0495668_0215480_128_955 275
546 3300046642 Ga0495634_0209697 Ga0495634_0209697_296_1126 275
547 3300046683 Ga0495658_0001869 Ga0495658_0001869_8160_8990 275
548 3300046689 Ga0495613_0191486 Ga0495613_0191486_237_1067 275
549 3300047319 Ga0495674_0150867 Ga0495674_0150867_480_1310 275
550 3300047320 Ga0495672_0004722 Ga0495672_0004722_683_1510 275
551 3300047472 Ga0495686_0158115 Ga0495686_0158115_433_1293 275
552 3300047673 Ga0495593_0018433 Ga0495593_0018433_792_1622 275
553 3300048903 Ga0496100_0000029 Ga0496100_0000029_82581_83447 275
554 3300048903 Ga0496100_0000798 Ga0496100_0000798_479_1342 275
555 3300048903 Ga0496100_0019765 Ga0496100_0019765_1689_2516 275
556 3300048904 Ga0496101_0000015 Ga0496101_0000015_51251_52117 275
557 3300048904 Ga0496101_0008430 Ga0496101_0008430_107_970 275
558 3300048905 Ga0496102_0020404 Ga0496102_0020404_1650_2477 275
559 3300048905 Ga0496102_0029754 Ga0496102_0029754_1344_2210 275
560 3300048905 Ga0496102_0057448 Ga0496102_0057448_1040_1870 275
561 3300048906 Ga0496103_0001418 Ga0496103_0001418_1939_2805 275
562 3300048906 Ga0496103_0018080 Ga0496103_0018080_3181_4008 275
563 3300048906 Ga0496103_0094537 Ga0496103_0094537_653_1480 275
564 3300048907 Ga0496104_0027595 Ga0496104_0027595_2783_3610 275
565 3300048909 Ga0496106_0000396 Ga0496106_0000396_22815_23681 275
566 3300048909 Ga0496106_0006462 Ga0496106_0006462_4713_5576 275
567 3300048910 Ga0496107_0000649 Ga0496107_0000649_13286_14149 275
568 3300048910 Ga0496107_0009198 Ga0496107_0009198_3884_4711 275
569 3300048910 Ga0496107_0014326 Ga0496107_0014326_2542_3408 275
570 3300048911 Ga0496108_0013765 Ga0496108_0013765_2530_3357 275
571 3300048911 Ga0496108_0038239 Ga0496108_0038239_2571_3437 275
572 3300048912 Ga0496109_0000022 Ga0496109_0000022_3396_4262 275
573 3300048912 Ga0496109_0011896 Ga0496109_0011896_2024_2851 275
574 3300048912 Ga0496109_0125113 Ga0496109_0125113_203_1066 275
575 3300048913 Ga0496110_0004126 Ga0496110_0004126_6302_7168 275
576 3300048913 Ga0496110_0243188 Ga0496110_0243188_747_1574 275
577 3300048914 Ga0496111_0050073 Ga0496111_0050073_1901_2728 275
578 3300048915 Ga0496112_0002704 Ga0496112_0002704_2276_3103 275
579 3300048915 Ga0496112_0185734 Ga0496112_0185734_727_1554 275
580 3300048915 Ga0496112_0513419 Ga0496112_0513419_220_1047 275
581 3300048917 Ga0496114_0000716 Ga0496114_0000716_14854_15720 275
582 3300048917 Ga0496114_0002600 Ga0496114_0002600_7447_8310 275
583 3300048917 Ga0496114_0027672 Ga0496114_0027672_2752_3579 275
584 3300048918 Ga0496115_0004673 Ga0496115_0004673_3030_3893 275
585 3300048918 Ga0496115_0018996 Ga0496115_0018996_3888_4754 275
586 3300048919 Ga0496116_0003462 Ga0496116_0003462_3865_4731 275
587 3300048920 Ga0496117_0008331 Ga0496117_0008331_5933_6799 275
588 3300048921 Ga0496118_0025250 Ga0496118_0025250_3065_3931 275
589 3300048922 Ga0496119_0007493 Ga0496119_0007493_4472_5338 275
590 3300048923 Ga0496120_0021299 Ga0496120_0021299_205_1071 275
591 3300048923 Ga0496120_0061325 Ga0496120_0061325_977_1840 275
592 3300048924 Ga0496121_0000004 Ga0496121_0000004_586381_587247 275
593 3300048925 Ga0496122_0000138 Ga0496122_0000138_88364_89230 275
594 3300048925 Ga0496122_0040074 Ga0496122_0040074_2157_3020 275
595 3300048925 Ga0496122_0125513 Ga0496122_0125513_110_970 275
596 3300048926 Ga0496123_0024813 Ga0496123_0024813_2174_3037 275
597 3300048926 Ga0496123_0034379 Ga0496123_0034379_2223_3089 275
598 3300048927 Ga0496124_0000012 Ga0496124_0000012_311174_312040 275
599 3300048928 Ga0496125_0000003 Ga0496125_0000003_602521_603387 275
600 3300048929 Ga0496126_0000001 Ga0496126_0000001_586381_587247 275
601 3300049569 Ga0501032_0010663 Ga0501032_0010663_2648_3475 275
602 3300049570 Ga0501033_0007899 Ga0501033_0007899_5680_6507 275
603 3300049570 Ga0501033_0391902 Ga0501033_0391902_50_877 275
604 3300049571 Ga0501034_0007790 Ga0501034_0007790_2034_2861 275
605 3300049571 Ga0501034_0016717 Ga0501034_0016717_5610_6437 275
606 3300049572 Ga0501036_0008446 Ga0501036_0008446_504_1331 275
607 3300049573 Ga0501037_0000219 Ga0501037_0000219_22818_23645 275
608 3300049573 Ga0501037_0010691 Ga0501037_0010691_4907_5734 275
609 3300049574 Ga0501038_0059297 Ga0501038_0059297_2224_3051 275
610 3300049575 Ga0501039_0000675 Ga0501039_0000675_19821_20648 275
611 3300049579 Ga0501043_0001226 Ga0501043_0001226_4288_5115 275
612 3300049579 Ga0501043_0071941 Ga0501043_0071941_1031_1858 275
613 3300049580 Ga0501046_0000302 Ga0501046_0000302_38338_39165 275
614 3300049580 Ga0501046_0190763 Ga0501046_0190763_298_1125 275
615 3300049581 Ga0501047_0017099 Ga0501047_0017099_4490_5317 275
616 3300049581 Ga0501047_0146835 Ga0501047_0146835_979_1806 275
617 3300049582 Ga0501048_0032945 Ga0501048_0032945_1965_2792 275
618 3300049585 Ga0501069_0230739 Ga0501069_0230739_103_930 275
619 3300049586 Ga0501070_0004586 Ga0501070_0004586_7738_8565 275
620 3300049586 Ga0501070_0004633 Ga0501070_0004633_6062_6889 275
621 3300049587 Ga0501071_0116742 Ga0501071_0116742_683_1510 275
622 3300049589 Ga0501073_0058018 Ga0501073_0058018_1740_2567 275
623 3300049589 Ga0501073_0419434 Ga0501073_0419434_64_891 275
624 3300049822 Ga0501035_0000665 Ga0501035_0000665_10790_11617 275
625 3300049822 Ga0501035_0000742 Ga0501035_0000742_32340_33167 275
626 3300049823 Ga0501044_0000313 Ga0501044_0000313_49354_50181 275
627 3300049823 Ga0501044_0001249 Ga0501044_0001249_24859_25686 275
628 3300049823 Ga0501044_0076396 Ga0501044_0076396_1982_2809 275
629 3300050489 nmdc:mga03683_62412_c1 nmdc:mga03683_62412_c1_363_1220 275
630 3300050490 nmdc:mga03n38_48465_c1 nmdc:mga03n38_48465_c1_852_1679 275
631 3300050490 nmdc:mga03n38_514_c1 nmdc:mga03n38_514_c1_2567_3424 275
632 3300050490 nmdc:mga03n38_77644_c1 nmdc:mga03n38_77644_c1_72_899 275
633 3300050490 nmdc:mga03n38_85572_c1 nmdc:mga03n38_85572_c1_437_1264 275
634 3300050491 nmdc:mga00v17_13060_c1 nmdc:mga00v17_13060_c1_603_1430 275
635 3300050491 nmdc:mga00v17_168840_c1 nmdc:mga00v17_168840_c1_296_1123 275
636 3300050491 nmdc:mga00v17_681_c1 nmdc:mga00v17_681_c1_16487_17317 275
637 3300050492 nmdc:mga0yw44_40108_c1 nmdc:mga0yw44_40108_c1_965_1822 275
638 3300050492 nmdc:mga0yw44_47764_c1 nmdc:mga0yw44_47764_c1_1543_2373 275
639 3300050493 nmdc:mga0k408_262536_c1 nmdc:mga0k408_262536_c1_44_901 275
640 3300050494 nmdc:mga06z11_13513_c1 nmdc:mga06z11_13513_c1_2597_3454 275
641 3300050494 nmdc:mga06z11_41642_c1 nmdc:mga06z11_41642_c1_1419_2246 275
642 3300050495 nmdc:mga04h51_18774_c1 nmdc:mga04h51_18774_c1_318_1175 275
643 3300050496 nmdc:mga07m45_2877_c1 nmdc:mga07m45_2877_c1_4633_5490 275
644 3300050496 nmdc:mga07m45_300213_c1 nmdc:mga07m45_300213_c1_12_839 275
645 3300050516 nmdc:mga0sz30_1058_c1 nmdc:mga0sz30_1058_c1_1555_2385 275
646 3300050516 nmdc:mga0sz30_3045_c1 nmdc:mga0sz30_3045_c1_3505_4332 275
647 3300053085 Ga0495619_0212347 Ga0495619_0212347_478_1308 275
648 3300053087 Ga0500643_010917 Ga0500643_010917_2358_3185 275
649 3300053087 Ga0500643_022740 Ga0500643_022740_360_1220 275
650 3300053153 Ga0500616_0017253 Ga0500616_0017253_701_1531 275
651 3300061719 Ga0466962_0035067 Ga0466962_0035067_354_1181 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

11

205

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

246

0.9

PF08659

KR

KR domain

12

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2et6-assembly1.cif.gz_A (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 0.9702 11 191
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9619 11 255
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.961 10 254
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9529 11 252
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9523 10 254
ID Description Score Start End Superfamily
af_I6WZD9_7_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9958 7 258 3.40.50.720
af_I6WZD9_7_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9841 7 258 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 11 191 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.961 10 254 3.40.50.720
2et6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9603 11 193 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G3UY48-F1-model_v4 deleted 0.9888 37 256
AF-I4ELG6-F1-model_v4 Putative Oxidoreductase 0.9798 11 192 GO:0016020
GO:0016491
AF-A0A6G3UY48-F1-model_v4 deleted 0.9756 37 256
AF-A0A1F4BCM0-F1-model_v4 3-oxoacyl-ACP reductase 0.9727 11 194 GO:0016491
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.972 11 189 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.06 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map