F472512
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 292 | 1300 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10573415|Ga0105245_105734152 |
| Length | 265 |
| Sequence | MRGSARRIGRLRGFFCCVQILSRTGALTVLIAGFPAGPWGTNCYVVATGPGAECVVVDPGKDAADGVAEVVREHRLKPVSVLVSHGHIDHMWCVAPVAGTYDATAWIHPRDRHLLSDPMAGMSRETAGMLLGGSYEFAEPDDVAELADLQTLEIAGLRFTVDHTPGHTEGSVTFRTPYAQDDVSELMFSGDLLFAGSIGRTDLPGGDHPTMLRSLRDKVLPLADDIVVLPGHGEQTSIGRERATNPFLLDLVDDSGRADAPTRGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 129 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 130 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 131 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 132 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 135 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 142 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 160 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 163 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 164 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 165 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 166 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 167 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 268 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 269 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 271 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 276 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 277 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 278 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 279 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 280 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 281 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 282 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 283 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 284 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 285 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 286 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 287 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 288 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 289 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 290 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 291 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 292 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.54 |
| Metatranscriptomes | 1.85 |
| Isolates | 2.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 5.54 |
| Nodule | 0.15 |
| Rhizoplane | 9.38 |
| Rhizosphere | 81.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10573415 | 3300009098 | Bacteria | 1152 |
| 2 | LJQas_1000412 | 3300000549 | Bacteria | 7231 |
| 3 | JGI24740J21852_10017099 | 3300001979 | Bacteria | 2603 |
| 4 | JGI24735J21928_10022661 | 3300002067 | Bacteria | 1909 |
| 5 | JGI24735J21928_10028744 | 3300002067 | Bacteria | 1659 |
| 6 | JGI25406J46586_10084803 | 3300003203 | Bacteria | 965 |
| 7 | rootL2_10117377 | 3300003322 | Bacteria | 1187 |
| 8 | Ga0070658_10165353 | 3300005327 | Bacteria | 1857 |
| 9 | Ga0070658_10302533 | 3300005327 | Bacteria | 1364 |
| 10 | Ga0070658_10467988 | 3300005327 | Bacteria | 1087 |
| 11 | Ga0070683_100014266 | 3300005329 | Bacteria | 6945 |
| 12 | Ga0070683_100021520 | 3300005329 | Bacteria | 5755 |
| 13 | Ga0070683_100029029 | 3300005329 | Bacteria | 5005 |
| 14 | Ga0070683_100098007 | 3300005329 | Bacteria | 2758 |
| 15 | Ga0070683_100226006 | 3300005329 | Bacteria | 1779 |
| 16 | Ga0070670_100162956 | 3300005331 | Bacteria | 1933 |
| 17 | Ga0068869_100128075 | 3300005334 | Bacteria | 1949 |
| 18 | Ga0068869_100302461 | 3300005334 | Bacteria | 1292 |
| 19 | Ga0070680_100000461 | 3300005336 | Bacteria | 27731 |
| 20 | Ga0070680_100102926 | 3300005336 | Bacteria | 2372 |
| 21 | Ga0070680_100320293 | 3300005336 | Bacteria | 1316 |
| 22 | Ga0070682_100005770 | 3300005337 | Bacteria | 6908 |
| 23 | Ga0070682_100074894 | 3300005337 | Bacteria | 2175 |
| 24 | Ga0068868_100039847 | 3300005338 | Bacteria | 3653 |
| 25 | Ga0068868_100173268 | 3300005338 | Bacteria | 1787 |
| 26 | Ga0068868_100424554 | 3300005338 | Bacteria | 1152 |
| 27 | Ga0070660_100008169 | 3300005339 | Bacteria | 7315 |
| 28 | Ga0070660_100064295 | 3300005339 | Bacteria | 2854 |
| 29 | Ga0070660_100064904 | 3300005339 | Bacteria | 2841 |
| 30 | Ga0070660_100069805 | 3300005339 | Bacteria | 2741 |
| 31 | Ga0070660_100190787 | 3300005339 | Bacteria | 1660 |
| 32 | Ga0070660_100332300 | 3300005339 | Bacteria | 1250 |
| 33 | Ga0070691_10116749 | 3300005341 | Bacteria | 1340 |
| 34 | Ga0070687_100159063 | 3300005343 | Bacteria | 1334 |
| 35 | Ga0070692_10009398 | 3300005345 | Bacteria | 4408 |
| 36 | Ga0070668_100117634 | 3300005347 | Bacteria | 2121 |
| 37 | Ga0070669_100231582 | 3300005353 | Bacteria | 1464 |
| 38 | Ga0070675_100228645 | 3300005354 | Bacteria | 1622 |
| 39 | Ga0070675_100318766 | 3300005354 | Bacteria | 1373 |
| 40 | Ga0070659_100000127 | 3300005366 | Bacteria | 57549 |
| 41 | Ga0070659_100005038 | 3300005366 | Bacteria | 9470 |
| 42 | Ga0070659_100046347 | 3300005366 | Bacteria | 3408 |
| 43 | Ga0070659_100082916 | 3300005366 | Bacteria | 2562 |
| 44 | Ga0070659_100091089 | 3300005366 | Bacteria | 2444 |
| 45 | Ga0070709_10136426 | 3300005434 | Bacteria | 1681 |
| 46 | Ga0070714_100058075 | 3300005435 | Bacteria | 3313 |
| 47 | Ga0070713_100053292 | 3300005436 | Bacteria | 3352 |
| 48 | Ga0070710_10001862 | 3300005437 | Bacteria | 9940 |
| 49 | Ga0070694_100057184 | 3300005444 | Bacteria | 2651 |
| 50 | Ga0070663_100176541 | 3300005455 | Bacteria | 1654 |
| 51 | Ga0070663_100251008 | 3300005455 | Bacteria | 1400 |
| 52 | Ga0070678_100399370 | 3300005456 | Bacteria | 1194 |
| 53 | Ga0070662_100056979 | 3300005457 | Bacteria | 2838 |
| 54 | Ga0070681_10000013 | 3300005458 | Bacteria | 135004 |
| 55 | Ga0070681_10009958 | 3300005458 | Bacteria | 9371 |
| 56 | Ga0070681_10041695 | 3300005458 | Bacteria | 4601 |
| 57 | Ga0070698_100008451 | 3300005471 | Bacteria | 11122 |
| 58 | Ga0070679_100000006 | 3300005530 | Bacteria | 203959 |
| 59 | Ga0070679_100032172 | 3300005530 | Bacteria | 5186 |
| 60 | Ga0070679_100036108 | 3300005530 | Bacteria | 4904 |
| 61 | Ga0070679_100057022 | 3300005530 | Bacteria | 3892 |
| 62 | Ga0070679_100118692 | 3300005530 | Bacteria | 2630 |
| 63 | Ga0070679_100198363 | 3300005530 | Bacteria | 1974 |
| 64 | Ga0070679_100219262 | 3300005530 | Bacteria | 1864 |
| 65 | Ga0070679_100316244 | 3300005530 | Bacteria | 1511 |
| 66 | Ga0070684_100010611 | 3300005535 | Bacteria | 7305 |
| 67 | Ga0070684_100017579 | 3300005535 | Bacteria | 5875 |
| 68 | Ga0070684_100026802 | 3300005535 | Bacteria | 4858 |
| 69 | Ga0070684_100051353 | 3300005535 | Bacteria | 3582 |
| 70 | Ga0070684_100425670 | 3300005535 | Bacteria | 1226 |
| 71 | Ga0070684_100599635 | 3300005535 | Bacteria | 1024 |
| 72 | Ga0070686_100212732 | 3300005544 | Bacteria | 1393 |
| 73 | Ga0070686_100234364 | 3300005544 | Bacteria | 1333 |
| 74 | Ga0070665_100000863 | 3300005548 | Bacteria | 39318 |
| 75 | Ga0068855_100041832 | 3300005563 | Bacteria | 5430 |
| 76 | Ga0068855_100125890 | 3300005563 | Bacteria | 2930 |
| 77 | Ga0068855_100659518 | 3300005563 | Bacteria | 1123 |
| 78 | Ga0070664_100151469 | 3300005564 | Bacteria | 2048 |
| 79 | Ga0068857_100020341 | 3300005577 | Bacteria | 5837 |
| 80 | Ga0068857_100041933 | 3300005577 | Bacteria | 4058 |
| 81 | Ga0068857_100734613 | 3300005577 | Bacteria | 940 |
| 82 | Ga0068854_100620527 | 3300005578 | Bacteria | 925 |
| 83 | Ga0068856_100139969 | 3300005614 | Bacteria | 2427 |
| 84 | Ga0068856_100167619 | 3300005614 | Bacteria | 2208 |
| 85 | Ga0068852_100043863 | 3300005616 | Bacteria | 3795 |
| 86 | Ga0068864_100052792 | 3300005618 | Bacteria | 3505 |
| 87 | Ga0068864_100910664 | 3300005618 | Bacteria | 869 |
| 88 | Ga0068861_100206038 | 3300005719 | Bacteria | 1654 |
| 89 | Ga0068861_100301802 | 3300005719 | Bacteria | 1387 |
| 90 | Ga0068870_10203364 | 3300005840 | Bacteria | 1202 |
| 91 | Ga0068863_100002158 | 3300005841 | Bacteria | 19512 |
| 92 | Ga0068858_100243273 | 3300005842 | Bacteria | 1708 |
| 93 | Ga0068860_100153849 | 3300005843 | Bacteria | 2216 |
| 94 | Ga0081539_10057626 | 3300005985 | Bacteria | 2148 |
| 95 | Ga0081539_10073121 | 3300005985 | Bacteria | 1830 |
| 96 | Ga0075365_10002441 | 3300006038 | Bacteria | 9120 |
| 97 | Ga0075365_10004436 | 3300006038 | Bacteria | 7434 |
| 98 | Ga0075365_10074775 | 3300006038 | Bacteria | 2285 |
| 99 | Ga0075365_10175250 | 3300006038 | Bacteria | 1498 |
| 100 | Ga0075365_10239045 | 3300006038 | Bacteria | 1275 |
| 101 | Ga0075363_100013028 | 3300006048 | Bacteria | 4018 |
| 102 | Ga0075363_100055393 | 3300006048 | Bacteria | 2124 |
| 103 | Ga0075363_100163560 | 3300006048 | Bacteria | 1261 |
| 104 | Ga0075364_10005225 | 3300006051 | Bacteria | 7536 |
| 105 | Ga0075364_10073713 | 3300006051 | Bacteria | 2250 |
| 106 | Ga0075367_10034317 | 3300006178 | Bacteria | 2930 |
| 107 | Ga0075367_10165542 | 3300006178 | Bacteria | 1376 |
| 108 | Ga0075367_10228257 | 3300006178 | Bacteria | 1166 |
| 109 | Ga0075367_10379562 | 3300006178 | Bacteria | 893 |
| 110 | Ga0075369_10025803 | 3300006186 | Bacteria | 2446 |
| 111 | Ga0097621_100692163 | 3300006237 | Bacteria | 938 |
| 112 | Ga0075370_10007612 | 3300006353 | Bacteria | 5524 |
| 113 | Ga0075428_100040450 | 3300006844 | Bacteria | 5128 |
| 114 | Ga0075431_100024377 | 3300006847 | Bacteria | 6198 |
| 115 | Ga0105240_10053118 | 3300009093 | Bacteria | 5089 |
| 116 | Ga0111539_10352329 | 3300009094 | Bacteria | 1713 |
| 117 | Ga0105245_10031866 | 3300009098 | Bacteria | 4668 |
| 118 | Ga0114129_10136326 | 3300009147 | Bacteria | 3368 |
| 119 | Ga0105243_10168209 | 3300009148 | Bacteria | 1896 |
| 120 | Ga0105243_10198052 | 3300009148 | Bacteria | 1760 |
| 121 | Ga0105243_10333262 | 3300009148 | Bacteria | 1387 |
| 122 | Ga0105243_10601174 | 3300009148 | Bacteria | 1059 |
| 123 | Ga0105242_10020637 | 3300009176 | Bacteria | 5168 |
| 124 | Ga0105242_10062802 | 3300009176 | Bacteria | 3058 |
| 125 | Ga0105242_10198154 | 3300009176 | Bacteria | 1782 |
| 126 | Ga0105242_10425258 | 3300009176 | Bacteria | 1246 |
| 127 | Ga0105248_10048253 | 3300009177 | Bacteria | 4776 |
| 128 | Ga0105248_10455762 | 3300009177 | Bacteria | 1441 |
| 129 | Ga0105248_10876674 | 3300009177 | Bacteria | 1013 |
| 130 | Ga0105237_10140489 | 3300009545 | Bacteria | 2409 |
| 131 | Ga0105238_10057186 | 3300009551 | Bacteria | 3911 |
| 132 | Ga0105249_10204512 | 3300009553 | Bacteria | 1934 |
| 133 | Ga0105239_10007799 | 3300010375 | Bacteria | 12246 |
| 134 | Ga0105239_10035882 | 3300010375 | Bacteria | 5444 |
| 135 | Ga0105239_10283359 | 3300010375 | Bacteria | 1866 |
| 136 | Ga0105246_10002293 | 3300011119 | Bacteria | 11539 |
| 137 | Ga0105246_10219789 | 3300011119 | Bacteria | 1488 |
| 138 | Ga0157371_10012474 | 3300013102 | Bacteria | 6493 |
| 139 | Ga0157370_10038213 | 3300013104 | Bacteria | 4644 |
| 140 | Ga0157370_10194917 | 3300013104 | Bacteria | 1880 |
| 141 | Ga0157369_10006587 | 3300013105 | Bacteria | 13428 |
| 142 | Ga0157369_10007928 | 3300013105 | Bacteria | 12210 |
| 143 | Ga0157369_10044516 | 3300013105 | Bacteria | 4830 |
| 144 | Ga0157369_10056150 | 3300013105 | Bacteria | 4249 |
| 145 | Ga0157369_10078869 | 3300013105 | Bacteria | 3527 |
| 146 | Ga0157369_10205818 | 3300013105 | Bacteria | 2064 |
| 147 | Ga0157369_10214595 | 3300013105 | Bacteria | 2016 |
| 148 | Ga0157369_10385976 | 3300013105 | Bacteria | 1453 |
| 149 | Ga0157369_10412109 | 3300013105 | Bacteria | 1401 |
| 150 | Ga0157369_11058315 | 3300013105 | Bacteria | 830 |
| 151 | Ga0157374_10798145 | 3300013296 | Bacteria | 960 |
| 152 | Ga0163162_10017211 | 3300013306 | Bacteria | 7073 |
| 153 | Ga0163162_10143265 | 3300013306 | Bacteria | 2504 |
| 154 | Ga0157372_10001640 | 3300013307 | Bacteria | 24319 |
| 155 | Ga0157372_10836405 | 3300013307 | Bacteria | 1069 |
| 156 | Ga0157372_11101928 | 3300013307 | Bacteria | 919 |
| 157 | Ga0157372_11528749 | 3300013307 | Bacteria | 769 |
| 158 | Ga0157375_10003295 | 3300013308 | Bacteria | 13980 |
| 159 | Ga0157375_10110865 | 3300013308 | Bacteria | 2842 |
| 160 | Ga0157375_10161005 | 3300013308 | Bacteria | 2386 |
| 161 | Ga0157375_10163570 | 3300013308 | Bacteria | 2369 |
| 162 | Ga0157375_10208579 | 3300013308 | Bacteria | 2111 |
| 163 | Ga0157375_11026832 | 3300013308 | Bacteria | 963 |
| 164 | Ga0163163_10204811 | 3300014325 | Bacteria | 2021 |
| 165 | Ga0163163_10273003 | 3300014325 | Bacteria | 1742 |
| 166 | Ga0163163_10274931 | 3300014325 | Bacteria | 1735 |
| 167 | Ga0157380_10273653 | 3300014326 | Bacteria | 1541 |
| 168 | Ga0182008_10014550 | 3300014497 | Bacteria | 4118 |
| 169 | Ga0157379_10078826 | 3300014968 | Bacteria | 2950 |
| 170 | Ga0157379_10224056 | 3300014968 | Bacteria | 1704 |
| 171 | Ga0157379_10254618 | 3300014968 | Bacteria | 1594 |
| 172 | Ga0157379_10409312 | 3300014968 | Bacteria | 1248 |
| 173 | Ga0157376_10143530 | 3300014969 | Bacteria | 2145 |
| 174 | Ga0157376_11184282 | 3300014969 | Bacteria | 792 |
| 175 | Ga0163161_10207168 | 3300017792 | Bacteria | 1513 |
| 176 | Ga0197907_10982223 | 3300020069 | Bacteria | 1122 |
| 177 | Ga0206349_1403162 | 3300020075 | Bacteria | 916 |
| 178 | Ga0206350_10719707 | 3300020080 | Bacteria | 924 |
| 179 | Ga0206354_10434256 | 3300020081 | Bacteria | 3169 |
| 180 | Ga0206353_10055876 | 3300020082 | Bacteria | 2497 |
| 181 | Ga0206353_10409269 | 3300020082 | Bacteria | 1833 |
| 182 | Ga0206353_11590552 | 3300020082 | Bacteria | 3108 |
| 183 | Ga0206353_11911907 | 3300020082 | Bacteria | 1060 |
| 184 | Ga0154015_1708112 | 3300020610 | Bacteria | 1265 |
| 185 | Ga0224712_10013909 | 3300022467 | Bacteria | 2577 |
| 186 | Ga0224712_10015224 | 3300022467 | Bacteria | 2497 |
| 187 | Ga0207692_10005771 | 3300025898 | Bacteria | 4983 |
| 188 | Ga0207688_10007027 | 3300025901 | Bacteria | 6121 |
| 189 | Ga0207647_10031355 | 3300025904 | Bacteria | 3421 |
| 190 | Ga0207647_10048021 | 3300025904 | Bacteria | 2652 |
| 191 | Ga0207647_10049211 | 3300025904 | Bacteria | 2615 |
| 192 | Ga0207647_10071960 | 3300025904 | Bacteria | 2085 |
| 193 | Ga0207699_10255066 | 3300025906 | Bacteria | 1210 |
| 194 | Ga0207643_10162959 | 3300025908 | Bacteria | 1342 |
| 195 | Ga0207705_10012173 | 3300025909 | Bacteria | 6217 |
| 196 | Ga0207705_10018300 | 3300025909 | Bacteria | 5010 |
| 197 | Ga0207705_10107744 | 3300025909 | Bacteria | 2056 |
| 198 | Ga0207707_10000211 | 3300025912 | Bacteria | 62280 |
| 199 | Ga0207707_10007133 | 3300025912 | Bacteria | 9732 |
| 200 | Ga0207707_10008328 | 3300025912 | Bacteria | 8995 |
| 201 | Ga0207695_10105209 | 3300025913 | Bacteria | 2810 |
| 202 | Ga0207660_10000809 | 3300025917 | Bacteria | 20657 |
| 203 | Ga0207660_10187772 | 3300025917 | Bacteria | 1608 |
| 204 | Ga0207662_10192477 | 3300025918 | Bacteria | 1317 |
| 205 | Ga0207657_10007599 | 3300025919 | Bacteria | 11097 |
| 206 | Ga0207657_10031278 | 3300025919 | Bacteria | 4824 |
| 207 | Ga0207657_10068677 | 3300025919 | Bacteria | 3010 |
| 208 | Ga0207657_10146458 | 3300025919 | Bacteria | 1926 |
| 209 | Ga0207657_10160724 | 3300025919 | Bacteria | 1825 |
| 210 | Ga0207657_10180901 | 3300025919 | Bacteria | 1704 |
| 211 | Ga0207657_10248623 | 3300025919 | Bacteria | 1418 |
| 212 | Ga0207657_10302496 | 3300025919 | Bacteria | 1267 |
| 213 | Ga0207657_10363899 | 3300025919 | Bacteria | 1140 |
| 214 | Ga0207652_10000012 | 3300025921 | Bacteria | 235382 |
| 215 | Ga0207652_10040934 | 3300025921 | Bacteria | 3937 |
| 216 | Ga0207652_10075931 | 3300025921 | Bacteria | 2929 |
| 217 | Ga0207652_10125912 | 3300025921 | Bacteria | 2282 |
| 218 | Ga0207652_10148653 | 3300025921 | Bacteria | 2097 |
| 219 | Ga0207652_10225637 | 3300025921 | Bacteria | 1688 |
| 220 | Ga0207652_10595064 | 3300025921 | Bacteria | 992 |
| 221 | Ga0207687_10014323 | 3300025927 | Bacteria | 5188 |
| 222 | Ga0207687_10131458 | 3300025927 | Bacteria | 1887 |
| 223 | Ga0207700_10948041 | 3300025928 | Bacteria | 770 |
| 224 | Ga0207664_10047636 | 3300025929 | Bacteria | 3368 |
| 225 | Ga0207664_10182444 | 3300025929 | Bacteria | 1803 |
| 226 | Ga0207690_10000653 | 3300025932 | Bacteria | 22186 |
| 227 | Ga0207690_10006668 | 3300025932 | Bacteria | 6842 |
| 228 | Ga0207690_10031049 | 3300025932 | Bacteria | 3415 |
| 229 | Ga0207690_10145590 | 3300025932 | Bacteria | 1751 |
| 230 | Ga0207706_10058568 | 3300025933 | Bacteria | 3393 |
| 231 | Ga0207706_10570627 | 3300025933 | Bacteria | 973 |
| 232 | Ga0207686_10040739 | 3300025934 | Bacteria | 2826 |
| 233 | Ga0207686_10275434 | 3300025934 | Bacteria | 1240 |
| 234 | Ga0207711_10048933 | 3300025941 | Bacteria | 3618 |
| 235 | Ga0207711_10071729 | 3300025941 | Bacteria | 3006 |
| 236 | Ga0207689_10034288 | 3300025942 | Bacteria | 4216 |
| 237 | Ga0207689_10111159 | 3300025942 | Bacteria | 2252 |
| 238 | Ga0207661_10019211 | 3300025944 | Bacteria | 5090 |
| 239 | Ga0207661_10056793 | 3300025944 | Bacteria | 3144 |
| 240 | Ga0207661_10144561 | 3300025944 | Bacteria | 2050 |
| 241 | Ga0207661_10227048 | 3300025944 | Bacteria | 1652 |
| 242 | Ga0207661_10248493 | 3300025944 | Bacteria | 1580 |
| 243 | Ga0207679_10309555 | 3300025945 | Bacteria | 1364 |
| 244 | Ga0207679_10657524 | 3300025945 | Bacteria | 948 |
| 245 | Ga0207667_10249891 | 3300025949 | Bacteria | 1814 |
| 246 | Ga0207651_10113424 | 3300025960 | Bacteria | 2040 |
| 247 | Ga0207640_10305402 | 3300025981 | Bacteria | 1260 |
| 248 | Ga0207658_10492860 | 3300025986 | Bacteria | 1090 |
| 249 | Ga0207658_10646292 | 3300025986 | Bacteria | 953 |
| 250 | Ga0207677_10022061 | 3300026023 | Bacteria | 3905 |
| 251 | Ga0207677_10138192 | 3300026023 | Bacteria | 1861 |
| 252 | Ga0207703_10227862 | 3300026035 | Bacteria | 1669 |
| 253 | Ga0207703_10335262 | 3300026035 | Bacteria | 1389 |
| 254 | Ga0207678_10100243 | 3300026067 | Bacteria | 2474 |
| 255 | Ga0207678_10262459 | 3300026067 | Bacteria | 1480 |
| 256 | Ga0207702_10071142 | 3300026078 | Bacteria | 2994 |
| 257 | Ga0207702_10112056 | 3300026078 | Bacteria | 2428 |
| 258 | Ga0207702_10123488 | 3300026078 | Bacteria | 2321 |
| 259 | Ga0207676_10015857 | 3300026095 | Bacteria | 5448 |
| 260 | Ga0207676_10484458 | 3300026095 | Bacteria | 1172 |
| 261 | Ga0207674_10031204 | 3300026116 | Bacteria | 5600 |
| 262 | Ga0207674_10052078 | 3300026116 | Bacteria | 4175 |
| 263 | Ga0207675_100027909 | 3300026118 | Bacteria | 5258 |
| 264 | Ga0207675_100126097 | 3300026118 | Bacteria | 2425 |
| 265 | Ga0207675_100214984 | 3300026118 | Bacteria | 1850 |
| 266 | Ga0207683_10383286 | 3300026121 | Bacteria | 1292 |
| 267 | Ga0207698_10604979 | 3300026142 | Bacteria | 1081 |
| 268 | Ga0268266_10055142 | 3300028379 | Bacteria | 3416 |
| 269 | Ga0268266_10170571 | 3300028379 | Bacteria | 1975 |
| 270 | Ga0268265_10067790 | 3300028380 | Bacteria | 2764 |
| 271 | Ga0268264_10110489 | 3300028381 | Bacteria | 2407 |
| 272 | Ga0265338_10018246 | 3300028800 | Bacteria | 7517 |
| 273 | Ga0316177_1148011 | 3300030731 | Bacteria | 2118 |
| 274 | Ga0316176_1212495 | 3300030732 | Bacteria | 3475 |
| 275 | Ga0314311_1118353 | 3300030733 | Bacteria | 8706 |
| 276 | Ga0316182_1157798 | 3300030745 | Bacteria | 939 |
| 277 | Ga0265320_10086211 | 3300031240 | Bacteria | 1460 |
| 278 | Ga0265325_10001095 | 3300031241 | Bacteria | 19483 |
| 279 | Ga0265340_10001753 | 3300031247 | Bacteria | 12421 |
| 280 | Ga0265339_10008428 | 3300031249 | Bacteria | 6558 |
| 281 | Ga0265316_10183694 | 3300031344 | Bacteria | 1556 |
| 282 | Ga0265313_10062438 | 3300031595 | Bacteria | 1740 |
| 283 | Ga0307508_10103616 | 3300031616 | Bacteria | 2442 |
| 284 | Ga0265342_10052295 | 3300031712 | Bacteria | 2435 |
| 285 | Ga0307413_10026116 | 3300031824 | Bacteria | 3214 |
| 286 | Ga0307413_10148690 | 3300031824 | Bacteria | 1629 |
| 287 | Ga0307413_10221403 | 3300031824 | Bacteria | 1383 |
| 288 | Ga0307518_10194742 | 3300031838 | Bacteria | 1354 |
| 289 | Ga0307410_10104667 | 3300031852 | Bacteria | 2035 |
| 290 | Ga0307410_10183619 | 3300031852 | Bacteria | 1585 |
| 291 | Ga0307406_10135846 | 3300031901 | Bacteria | 1733 |
| 292 | Ga0307407_10024450 | 3300031903 | Bacteria | 3168 |
| 293 | Ga0307412_10151902 | 3300031911 | Bacteria | 1710 |
| 294 | Ga0307409_100113666 | 3300031995 | Bacteria | 2276 |
| 295 | Ga0307409_100210856 | 3300031995 | Bacteria | 1746 |
| 296 | Ga0307409_100606799 | 3300031995 | Bacteria | 1082 |
| 297 | Ga0307409_100937322 | 3300031995 | Bacteria | 881 |
| 298 | Ga0307416_100042351 | 3300032002 | Bacteria | 3554 |
| 299 | Ga0307416_100230371 | 3300032002 | Bacteria | 1785 |
| 300 | Ga0307414_10380419 | 3300032004 | Bacteria | 1220 |
| 301 | Ga0307414_10563502 | 3300032004 | Bacteria | 1017 |
| 302 | Ga0307414_10986902 | 3300032004 | Bacteria | 775 |
| 303 | Ga0307411_10049485 | 3300032005 | Bacteria | 2731 |
| 304 | Ga0307411_10100639 | 3300032005 | Bacteria | 2043 |
| 305 | Ga0307411_10217552 | 3300032005 | Bacteria | 1480 |
| 306 | Ga0307411_10340332 | 3300032005 | Bacteria | 1219 |
| 307 | Ga0307415_100007954 | 3300032126 | Bacteria | 5841 |
| 308 | Ga0307415_100109083 | 3300032126 | Bacteria | 2049 |
| 309 | Ga0307415_100137591 | 3300032126 | Bacteria | 1860 |
| 310 | Ga0307415_100165523 | 3300032126 | Bacteria | 1719 |
| 311 | Ga0307415_100412449 | 3300032126 | Bacteria | 1156 |
| 312 | Ga0316212_1000449 | 3300033547 | Bacteria | 5012 |
| 313 | Ga0373931_0122330 | 3300035691 | Bacteria | 1489 |
| 314 | Ga0372808_015066 | 3300036459 | Bacteria | 1105 |
| 315 | Ga0373925_0000030 | 3300037068 | Bacteria | 146196 |
| 316 | Ga0395900_0023706 | 3300037418 | Bacteria | 6279 |
| 317 | Ga0395900_0038644 | 3300037418 | Bacteria | 4920 |
| 318 | Ga0395900_0416670 | 3300037418 | Bacteria | 1305 |
| 319 | Ga0395900_0606496 | 3300037418 | Bacteria | 1035 |
| 320 | Ga0395900_0853637 | 3300037418 | Bacteria | 836 |
| 321 | Ga0395898_0039593 | 3300037466 | Bacteria | 4664 |
| 322 | Ga0395898_0049902 | 3300037466 | Bacteria | 4098 |
| 323 | Ga0395898_0084914 | 3300037466 | Bacteria | 3052 |
| 324 | Ga0395898_0198193 | 3300037466 | Bacteria | 1918 |
| 325 | Ga0395901_0023355 | 3300038443 | Bacteria | 6337 |
| 326 | Ga0395901_0074201 | 3300038443 | Bacteria | 3549 |
| 327 | Ga0395901_0157248 | 3300038443 | Bacteria | 2387 |
| 328 | Ga0395901_0329677 | 3300038443 | Bacteria | 1578 |
| 329 | Ga0436365_1282228 | 3300039437 | Bacteria | 59682 |
| 330 | Ga0436365_1377250 | 3300039437 | Bacteria | 2491 |
| 331 | Ga0436362_0153049 | 3300039453 | Bacteria | 1458 |
| 332 | Ga0451802_2137692 | 3300041460 | Bacteria | 1264 |
| 333 | Ga0451853_3693024 | 3300041512 | Bacteria | 1711 |
| 334 | Ga0439431_0010586 | 3300041997 | Bacteria | 2094 |
| 335 | Ga0439445_0013152 | 3300042004 | Bacteria | 2001 |
| 336 | Ga0450907_028689 | 3300042146 | Bacteria | 945 |
| 337 | Ga0439446_0050302 | 3300042156 | Bacteria | 1243 |
| 338 | Ga0439434_0004726 | 3300042435 | Bacteria | 3990 |
| 339 | Ga0466969_0034744 | 3300044656 | Bacteria | 2553 |
| 340 | Ga0466969_0110978 | 3300044656 | Bacteria | 1284 |
| 341 | Ga0466972_0001090 | 3300044658 | Bacteria | 13020 |
| 342 | Ga0466972_0109011 | 3300044658 | Bacteria | 1309 |
| 343 | Ga0466972_0235333 | 3300044658 | Bacteria | 857 |
| 344 | Ga0466965_0001948 | 3300044683 | Bacteria | 8622 |
| 345 | Ga0466965_0006037 | 3300044683 | Bacteria | 5473 |
| 346 | Ga0466965_0007075 | 3300044683 | Bacteria | 5135 |
| 347 | Ga0466965_0010185 | 3300044683 | Bacteria | 4378 |
| 348 | Ga0466965_0022208 | 3300044683 | Bacteria | 3059 |
| 349 | Ga0466965_0062642 | 3300044683 | Bacteria | 1861 |
| 350 | Ga0466966_0057655 | 3300044684 | Bacteria | 2455 |
| 351 | Ga0466966_0083960 | 3300044684 | Bacteria | 1981 |
| 352 | Ga0466966_0224233 | 3300044684 | Bacteria | 1134 |
| 353 | Ga0466966_0246538 | 3300044684 | Bacteria | 1076 |
| 354 | Ga0466966_0266982 | 3300044684 | Bacteria | 1030 |
| 355 | Ga0466961_0007255 | 3300044693 | Bacteria | 7053 |
| 356 | Ga0466961_0022688 | 3300044693 | Bacteria | 4037 |
| 357 | Ga0466961_0060836 | 3300044693 | Bacteria | 2401 |
| 358 | Ga0466961_0070852 | 3300044693 | Bacteria | 2213 |
| 359 | Ga0466961_0070901 | 3300044693 | Bacteria | 2212 |
| 360 | Ga0466963_0047474 | 3300044694 | Bacteria | 2834 |
| 361 | Ga0466963_0053457 | 3300044694 | Bacteria | 2681 |
| 362 | Ga0466963_0140765 | 3300044694 | Bacteria | 1671 |
| 363 | Ga0466963_0221847 | 3300044694 | Bacteria | 1324 |
| 364 | Ga0466963_0460483 | 3300044694 | Bacteria | 897 |
| 365 | Ga0466963_0532438 | 3300044694 | Bacteria | 829 |
| 366 | Ga0466964_0021785 | 3300044706 | Bacteria | 2480 |
| 367 | Ga0466971_0006494 | 3300044719 | Bacteria | 5082 |
| 368 | Ga0466968_0019035 | 3300044735 | Bacteria | 2759 |
| 369 | Ga0466970_0011156 | 3300044765 | Bacteria | 4575 |
| 370 | Ga0466970_0035893 | 3300044765 | Bacteria | 2625 |
| 371 | Ga0466970_0078679 | 3300044765 | Bacteria | 1779 |
| 372 | Ga0466970_0103946 | 3300044765 | Bacteria | 1548 |
| 373 | Ga0466957_0004275 | 3300044842 | Bacteria | 7919 |
| 374 | Ga0466957_0065013 | 3300044842 | Bacteria | 2245 |
| 375 | Ga0466957_0067415 | 3300044842 | Bacteria | 2208 |
| 376 | Ga0466957_0089302 | 3300044842 | Bacteria | 1929 |
| 377 | Ga0466957_0210338 | 3300044842 | Bacteria | 1280 |
| 378 | Ga0466960_0002897 | 3300044901 | Bacteria | 6520 |
| 379 | Ga0466960_0005813 | 3300044901 | Bacteria | 4914 |
| 380 | Ga0466960_0012418 | 3300044901 | Bacteria | 3593 |
| 381 | Ga0466960_0016652 | 3300044901 | Bacteria | 3193 |
| 382 | Ga0466960_0017323 | 3300044901 | Bacteria | 3140 |
| 383 | Ga0466960_0023613 | 3300044901 | Bacteria | 2763 |
| 384 | Ga0466960_0065720 | 3300044901 | Bacteria | 1792 |
| 385 | Ga0466960_0118172 | 3300044901 | Bacteria | 1386 |
| 386 | Ga0466960_0224900 | 3300044901 | Bacteria | 1034 |
| 387 | Ga0466960_0361220 | 3300044901 | Bacteria | 830 |
| 388 | Ga0466959_0140810 | 3300045049 | Bacteria | 1705 |
| 389 | Ga0466959_0163462 | 3300045049 | Bacteria | 1564 |
| 390 | Ga0466959_0480328 | 3300045049 | Bacteria | 841 |
| 391 | Ga0466958_0004993 | 3300045836 | Bacteria | 7084 |
| 392 | Ga0466958_0035040 | 3300045836 | Bacteria | 2997 |
| 393 | Ga0466967_0031067 | 3300045976 | Bacteria | 4492 |
| 394 | Ga0466967_0041221 | 3300045976 | Bacteria | 3979 |
| 395 | Ga0466967_0066369 | 3300045976 | Bacteria | 3215 |
| 396 | Ga0466967_0074937 | 3300045976 | Bacteria | 3041 |
| 397 | Ga0466967_0074952 | 3300045976 | Bacteria | 3040 |
| 398 | Ga0466967_0178184 | 3300045976 | Bacteria | 2003 |
| 399 | Ga0466967_0213508 | 3300045976 | Bacteria | 1831 |
| 400 | Ga0466967_0255334 | 3300045976 | Bacteria | 1676 |
| 401 | Ga0466967_0440460 | 3300045976 | Bacteria | 1272 |
| 402 | Ga0466967_0758135 | 3300045976 | Bacteria | 963 |
| 403 | Ga0495592_0052888 | 3300046454 | Bacteria | 3013 |
| 404 | Ga0495603_0021712 | 3300046455 | Bacteria | 3888 |
| 405 | Ga0495629_0287235 | 3300046459 | Bacteria | 1128 |
| 406 | Ga0495653_0043162 | 3300046463 | Bacteria | 3507 |
| 407 | Ga0495662_0000289 | 3300046476 | Bacteria | 21710 |
| 408 | Ga0495608_0001114 | 3300046511 | Bacteria | 19045 |
| 409 | Ga0495628_0033616 | 3300046516 | Bacteria | 4130 |
| 410 | Ga0495666_0000329 | 3300046526 | Bacteria | 20753 |
| 411 | Ga0495665_0000377 | 3300046531 | Bacteria | 22495 |
| 412 | Ga0495586_0012765 | 3300046535 | Bacteria | 4453 |
| 413 | Ga0495587_0002610 | 3300046536 | Bacteria | 12038 |
| 414 | Ga0495645_0027334 | 3300046543 | Bacteria | 4144 |
| 415 | Ga0495634_0153693 | 3300046642 | Bacteria | 1453 |
| 416 | Ga0495657_0015302 | 3300046675 | Bacteria | 5616 |
| 417 | Ga0495599_0033790 | 3300046678 | Bacteria | 3214 |
| 418 | Ga0495623_0029552 | 3300046679 | Bacteria | 3526 |
| 419 | Ga0495658_0080854 | 3300046683 | Bacteria | 1907 |
| 420 | Ga0495613_0000744 | 3300046689 | Bacteria | 25543 |
| 421 | Ga0495581_0001219 | 3300047315 | Bacteria | 14166 |
| 422 | Ga0495604_0000347 | 3300047317 | Bacteria | 41557 |
| 423 | Ga0495604_0255610 | 3300047317 | Bacteria | 1193 |
| 424 | Ga0495674_0035910 | 3300047319 | Bacteria | 4467 |
| 425 | Ga0495676_0124607 | 3300047321 | Bacteria | 1869 |
| 426 | Ga0495593_0015036 | 3300047673 | Bacteria | 4396 |
| 427 | Ga0495602_0072967 | 3300048088 | Bacteria | 2923 |
| 428 | Ga0496100_0080431 | 3300048903 | Bacteria | 2199 |
| 429 | Ga0496100_0114292 | 3300048903 | Bacteria | 1880 |
| 430 | Ga0496100_0128069 | 3300048903 | Bacteria | 1784 |
| 431 | Ga0496100_0174488 | 3300048903 | Bacteria | 1551 |
| 432 | Ga0496100_0209586 | 3300048903 | Bacteria | 1425 |
| 433 | Ga0496101_0103349 | 3300048904 | Bacteria | 2135 |
| 434 | Ga0496101_0180743 | 3300048904 | Bacteria | 1624 |
| 435 | Ga0496102_0006295 | 3300048905 | Bacteria | 10117 |
| 436 | Ga0496102_0014458 | 3300048905 | Bacteria | 6858 |
| 437 | Ga0496102_0184218 | 3300048905 | Bacteria | 1967 |
| 438 | Ga0496103_0032232 | 3300048906 | Bacteria | 3197 |
| 439 | Ga0496103_0068673 | 3300048906 | Bacteria | 2215 |
| 440 | Ga0496103_0144126 | 3300048906 | Bacteria | 1524 |
| 441 | Ga0496104_0001924 | 3300048907 | Bacteria | 17991 |
| 442 | Ga0496104_0134786 | 3300048907 | Bacteria | 2372 |
| 443 | Ga0496105_0007521 | 3300048908 | Bacteria | 8439 |
| 444 | Ga0496105_0060728 | 3300048908 | Bacteria | 3119 |
| 445 | Ga0496106_0020238 | 3300048909 | Bacteria | 4937 |
| 446 | Ga0496106_0034968 | 3300048909 | Bacteria | 3755 |
| 447 | Ga0496106_0492239 | 3300048909 | Bacteria | 985 |
| 448 | Ga0496107_0112877 | 3300048910 | Bacteria | 1998 |
| 449 | Ga0496107_0188630 | 3300048910 | Bacteria | 1531 |
| 450 | Ga0496107_0217182 | 3300048910 | Bacteria | 1422 |
| 451 | Ga0496108_0000227 | 3300048911 | Bacteria | 50319 |
| 452 | Ga0496108_0032464 | 3300048911 | Bacteria | 4337 |
| 453 | Ga0496108_0088531 | 3300048911 | Bacteria | 2631 |
| 454 | Ga0496108_0089619 | 3300048911 | Bacteria | 2614 |
| 455 | Ga0496108_0101999 | 3300048911 | Bacteria | 2448 |
| 456 | Ga0496108_0266843 | 3300048911 | Bacteria | 1490 |
| 457 | Ga0496109_0023477 | 3300048912 | Bacteria | 5476 |
| 458 | Ga0496109_0027527 | 3300048912 | Bacteria | 5077 |
| 459 | Ga0496109_0049181 | 3300048912 | Bacteria | 3837 |
| 460 | Ga0496109_0065819 | 3300048912 | Bacteria | 3318 |
| 461 | Ga0496109_0139099 | 3300048912 | Bacteria | 2270 |
| 462 | Ga0496109_0209018 | 3300048912 | Bacteria | 1835 |
| 463 | Ga0496109_0741684 | 3300048912 | Bacteria | 920 |
| 464 | Ga0496109_0848077 | 3300048912 | Bacteria | 851 |
| 465 | Ga0496110_0003710 | 3300048913 | Bacteria | 11756 |
| 466 | Ga0496110_0041823 | 3300048913 | Bacteria | 4000 |
| 467 | Ga0496110_0341964 | 3300048913 | Bacteria | 1363 |
| 468 | Ga0496110_0445227 | 3300048913 | Bacteria | 1181 |
| 469 | Ga0496111_0004923 | 3300048914 | Bacteria | 8480 |
| 470 | Ga0496111_0037687 | 3300048914 | Bacteria | 3461 |
| 471 | Ga0496111_0115693 | 3300048914 | Bacteria | 1977 |
| 472 | Ga0496111_0270310 | 3300048914 | Bacteria | 1261 |
| 473 | Ga0496111_0698947 | 3300048914 | Bacteria | 738 |
| 474 | Ga0496112_0029124 | 3300048915 | Bacteria | 5337 |
| 475 | Ga0496112_0120727 | 3300048915 | Bacteria | 2591 |
| 476 | Ga0496113_0003599 | 3300048916 | Bacteria | 9308 |
| 477 | Ga0496113_0089055 | 3300048916 | Bacteria | 2375 |
| 478 | Ga0496113_0126117 | 3300048916 | Bacteria | 2005 |
| 479 | Ga0496113_0214002 | 3300048916 | Bacteria | 1535 |
| 480 | Ga0496113_0430143 | 3300048916 | Bacteria | 1060 |
| 481 | Ga0496114_0076537 | 3300048917 | Bacteria | 2819 |
| 482 | Ga0496114_0139297 | 3300048917 | Bacteria | 2099 |
| 483 | Ga0496114_0245435 | 3300048917 | Bacteria | 1575 |
| 484 | Ga0496114_0703587 | 3300048917 | Bacteria | 886 |
| 485 | Ga0496115_0010119 | 3300048918 | Bacteria | 7035 |
| 486 | Ga0496115_0030337 | 3300048918 | Bacteria | 4253 |
| 487 | Ga0496115_0121961 | 3300048918 | Bacteria | 2145 |
| 488 | Ga0496126_0744792 | 3300048929 | Bacteria | 757 |
| 489 | Ga0501031_0001642 | 3300049568 | Bacteria | 14030 |
| 490 | Ga0501031_0003141 | 3300049568 | Bacteria | 10590 |
| 491 | Ga0501031_0162363 | 3300049568 | Bacteria | 1460 |
| 492 | Ga0501031_0267563 | 3300049568 | Bacteria | 1110 |
| 493 | Ga0501031_0322285 | 3300049568 | Bacteria | 1001 |
| 494 | Ga0501032_0012114 | 3300049569 | Bacteria | 6173 |
| 495 | Ga0501032_0014543 | 3300049569 | Bacteria | 5573 |
| 496 | Ga0501032_0070429 | 3300049569 | Bacteria | 2332 |
| 497 | Ga0501032_0267342 | 3300049569 | Bacteria | 1108 |
| 498 | Ga0501033_0003639 | 3300049570 | Bacteria | 12567 |
| 499 | Ga0501033_0154189 | 3300049570 | Bacteria | 1656 |
| 500 | Ga0501034_0026751 | 3300049571 | Bacteria | 5870 |
| 501 | Ga0501034_0107003 | 3300049571 | Bacteria | 2789 |
| 502 | Ga0501036_0000932 | 3300049572 | Bacteria | 21959 |
| 503 | Ga0501036_0004317 | 3300049572 | Bacteria | 11475 |
| 504 | Ga0501036_0060606 | 3300049572 | Bacteria | 3206 |
| 505 | Ga0501036_0302194 | 3300049572 | Bacteria | 1338 |
| 506 | Ga0501036_0720140 | 3300049572 | Bacteria | 824 |
| 507 | Ga0501037_0002300 | 3300049573 | Bacteria | 13788 |
| 508 | Ga0501037_0030277 | 3300049573 | Bacteria | 4000 |
| 509 | Ga0501037_0030829 | 3300049573 | Bacteria | 3961 |
| 510 | Ga0501038_0004110 | 3300049574 | Bacteria | 13537 |
| 511 | Ga0501038_0011972 | 3300049574 | Bacteria | 7919 |
| 512 | Ga0501038_0012988 | 3300049574 | Bacteria | 7597 |
| 513 | Ga0501038_0344028 | 3300049574 | Bacteria | 1163 |
| 514 | Ga0501039_0007533 | 3300049575 | Bacteria | 8317 |
| 515 | Ga0501039_0029897 | 3300049575 | Bacteria | 4198 |
| 516 | Ga0501039_0037859 | 3300049575 | Bacteria | 3725 |
| 517 | Ga0501040_0024598 | 3300049576 | Bacteria | 4042 |
| 518 | Ga0501041_0099911 | 3300049577 | Bacteria | 1795 |
| 519 | Ga0501041_0103081 | 3300049577 | Bacteria | 1767 |
| 520 | Ga0501042_0001323 | 3300049578 | Bacteria | 14449 |
| 521 | Ga0501042_0002629 | 3300049578 | Bacteria | 11040 |
| 522 | Ga0501042_0041575 | 3300049578 | Bacteria | 3270 |
| 523 | Ga0501042_0051222 | 3300049578 | Bacteria | 2945 |
| 524 | Ga0501042_0201195 | 3300049578 | Bacteria | 1436 |
| 525 | Ga0501043_0062181 | 3300049579 | Bacteria | 2932 |
| 526 | Ga0501043_0200180 | 3300049579 | Bacteria | 1550 |
| 527 | Ga0501046_0005262 | 3300049580 | Bacteria | 11571 |
| 528 | Ga0501046_0061187 | 3300049580 | Bacteria | 2945 |
| 529 | Ga0501046_0288367 | 3300049580 | Bacteria | 1201 |
| 530 | Ga0501046_0301713 | 3300049580 | Bacteria | 1169 |
| 531 | Ga0501048_0008995 | 3300049582 | Bacteria | 7518 |
| 532 | Ga0501048_0033168 | 3300049582 | Bacteria | 3731 |
| 533 | Ga0501048_0073524 | 3300049582 | Bacteria | 2413 |
| 534 | Ga0501048_0191883 | 3300049582 | Bacteria | 1448 |
| 535 | Ga0501048_0228835 | 3300049582 | Bacteria | 1319 |
| 536 | Ga0501067_0001156 | 3300049583 | Bacteria | 14320 |
| 537 | Ga0501067_0003684 | 3300049583 | Bacteria | 8445 |
| 538 | Ga0501067_0008552 | 3300049583 | Bacteria | 5678 |
| 539 | Ga0501067_0018247 | 3300049583 | Bacteria | 3886 |
| 540 | Ga0501067_0075370 | 3300049583 | Bacteria | 1869 |
| 541 | Ga0501068_0008355 | 3300049584 | Bacteria | 5757 |
| 542 | Ga0501068_0097491 | 3300049584 | Bacteria | 1819 |
| 543 | Ga0501068_0280738 | 3300049584 | Bacteria | 1064 |
| 544 | Ga0501069_0130397 | 3300049585 | Bacteria | 1439 |
| 545 | Ga0501069_0132989 | 3300049585 | Bacteria | 1425 |
| 546 | Ga0501069_0138845 | 3300049585 | Bacteria | 1394 |
| 547 | Ga0501069_0173059 | 3300049585 | Bacteria | 1246 |
| 548 | Ga0501069_0278516 | 3300049585 | Bacteria | 978 |
| 549 | Ga0501070_0000763 | 3300049586 | Bacteria | 29376 |
| 550 | Ga0501070_0004751 | 3300049586 | Bacteria | 11624 |
| 551 | Ga0501070_0005416 | 3300049586 | Bacteria | 10892 |
| 552 | Ga0501070_0005419 | 3300049586 | Bacteria | 10889 |
| 553 | Ga0501070_0017696 | 3300049586 | Bacteria | 5984 |
| 554 | Ga0501070_0076120 | 3300049586 | Bacteria | 2778 |
| 555 | Ga0501070_0208302 | 3300049586 | Bacteria | 1605 |
| 556 | Ga0501070_0353258 | 3300049586 | Bacteria | 1193 |
| 557 | Ga0501070_0484709 | 3300049586 | Bacteria | 994 |
| 558 | Ga0501071_0007691 | 3300049587 | Bacteria | 7100 |
| 559 | Ga0501071_0020391 | 3300049587 | Bacteria | 4605 |
| 560 | Ga0501071_0156666 | 3300049587 | Bacteria | 1701 |
| 561 | Ga0501071_0557428 | 3300049587 | Bacteria | 880 |
| 562 | Ga0501072_0128682 | 3300049588 | Bacteria | 2018 |
| 563 | Ga0501072_0229210 | 3300049588 | Bacteria | 1480 |
| 564 | Ga0501073_0005322 | 3300049589 | Bacteria | 9649 |
| 565 | Ga0501073_0009274 | 3300049589 | Bacteria | 7260 |
| 566 | Ga0501073_0134031 | 3300049589 | Bacteria | 1717 |
| 567 | Ga0501074_0002479 | 3300049590 | Bacteria | 12871 |
| 568 | Ga0501074_0003018 | 3300049590 | Bacteria | 11855 |
| 569 | Ga0501074_0026779 | 3300049590 | Bacteria | 4181 |
| 570 | Ga0501074_0101011 | 3300049590 | Bacteria | 2064 |
| 571 | Ga0501075_0028331 | 3300049591 | Bacteria | 4134 |
| 572 | Ga0501075_0097105 | 3300049591 | Bacteria | 2236 |
| 573 | Ga0501076_0064642 | 3300049592 | Bacteria | 2916 |
| 574 | Ga0501077_0014762 | 3300049593 | Bacteria | 4908 |
| 575 | Ga0501077_0034432 | 3300049593 | Bacteria | 3224 |
| 576 | Ga0501079_0005516 | 3300049741 | Bacteria | 9431 |
| 577 | Ga0501079_0043657 | 3300049741 | Bacteria | 3461 |
| 578 | Ga0501079_0229428 | 3300049741 | Bacteria | 1450 |
| 579 | Ga0501079_0298162 | 3300049741 | Bacteria | 1261 |
| 580 | Ga0501080_0010354 | 3300049742 | Bacteria | 8529 |
| 581 | Ga0501080_0010624 | 3300049742 | Bacteria | 8429 |
| 582 | Ga0501080_0050874 | 3300049742 | Bacteria | 3855 |
| 583 | Ga0501080_0076216 | 3300049742 | Bacteria | 3119 |
| 584 | Ga0501080_0094623 | 3300049742 | Bacteria | 2774 |
| 585 | Ga0501080_0199249 | 3300049742 | Bacteria | 1838 |
| 586 | Ga0501080_0244558 | 3300049742 | Bacteria | 1637 |
| 587 | Ga0501083_0018059 | 3300049744 | Bacteria | 4917 |
| 588 | Ga0501035_0001668 | 3300049822 | Bacteria | 22446 |
| 589 | Ga0501035_0063042 | 3300049822 | Bacteria | 3297 |
| 590 | Ga0501035_0096207 | 3300049822 | Bacteria | 2602 |
| 591 | Ga0501035_0160154 | 3300049822 | Bacteria | 1949 |
| 592 | Ga0501035_0541003 | 3300049822 | Bacteria | 955 |
| 593 | Ga0501044_0002171 | 3300049823 | Bacteria | 22494 |
| 594 | Ga0501044_0009429 | 3300049823 | Bacteria | 10631 |
| 595 | Ga0501044_0155604 | 3300049823 | Bacteria | 2265 |
| 596 | Ga0501044_0473395 | 3300049823 | Bacteria | 1156 |
| 597 | Ga0501045_0092732 | 3300049824 | Bacteria | 2234 |
| 598 | nmdc:mga03683_23682_c1 | 3300050489 | Bacteria | 2395 |
| 599 | nmdc:mga03n38_12897_c1 | 3300050490 | Bacteria | 3161 |
| 600 | nmdc:mga00v17_31733_c1 | 3300050491 | Bacteria | 3118 |
| 601 | nmdc:mga0yw44_127858_c1 | 3300050492 | Bacteria | 1642 |
| 602 | nmdc:mga0yw44_139386_c1 | 3300050492 | Bacteria | 1575 |
| 603 | nmdc:mga0yw44_1894_c1 | 3300050492 | Bacteria | 8620 |
| 604 | nmdc:mga0yw44_23850_c1 | 3300050492 | Bacteria | 3453 |
| 605 | nmdc:mga0yw44_61778_c1 | 3300050492 | Bacteria | 2300 |
| 606 | nmdc:mga0yw44_71738_c1 | 3300050492 | Bacteria | 2151 |
| 607 | nmdc:mga06z11_269058_c1 | 3300050494 | Bacteria | 1007 |
| 608 | nmdc:mga06z11_337056_c1 | 3300050494 | Bacteria | 901 |
| 609 | nmdc:mga06z11_7898_c1 | 3300050494 | Bacteria | 4406 |
| 610 | nmdc:mga07m45_8437_c2 | 3300050496 | Bacteria | 3519 |
| 611 | nmdc:mga05p37_709569_c1 | 3300050507 | Bacteria | 1116 |
| 612 | nmdc:mga05p37_87169_c1 | 3300050507 | Bacteria | 3848 |
| 613 | nmdc:mga09592_16977_c1 | 3300050508 | Bacteria | 5956 |
| 614 | nmdc:mga0sz30_16826_c1 | 3300050516 | Bacteria | 2602 |
| 615 | Ga0495601_0046982 | 3300053077 | Bacteria | 2717 |
| 616 | Ga0495595_0187985 | 3300053084 | Bacteria | 1026 |
| 617 | Ga0495619_0057853 | 3300053085 | Bacteria | 2573 |
| 618 | Ga0495619_0109213 | 3300053085 | Bacteria | 1889 |
| 619 | Ga0500644_0000129 | 3300053088 | Bacteria | 46233 |
| 620 | Ga0500646_0000186 | 3300053090 | Bacteria | 18701 |
| 621 | Ga0500583_0003883 | 3300053092 | Bacteria | 4789 |
| 622 | Ga0500556_0000724 | 3300053104 | Bacteria | 19897 |
| 623 | Ga0500593_000276 | 3300053117 | Bacteria | 20922 |
| 624 | Ga0500573_0015555 | 3300053140 | Bacteria | 4315 |
| 625 | Ga0501084_0033760 | 3300054114 | Bacteria | 4280 |
| 626 | Ga0501084_0501073 | 3300054114 | Bacteria | 1026 |
| 627 | Ga0501082_0080821 | 3300060353 | Bacteria | 2805 |
| 628 | Ga0501082_0212468 | 3300060353 | Bacteria | 1683 |
| 629 | Ga0501082_0302485 | 3300060353 | Bacteria | 1393 |
| 630 | Ga0466962_0052203 | 3300061719 | Bacteria | 1954 |
| 631 | Ga0466962_0255826 | 3300061719 | Bacteria | 861 |
| 632 | Ga0530510_0029040 | 3300061734 | Bacteria | 3968 |
| 633 | Ga0530510_0375196 | 3300061734 | Bacteria | 1070 |
| 634 | 2643891637 | 2643221576 | Bacteria | 5214352 |
| 635 | 2643960685 | 2643221590 | Bacteria | 5214697 |
| 636 | 2644035800 | 2643221604 | Bacteria | 5014917 |
| 637 | 2644093898 | 2643221615 | Bacteria | 5487866 |
| 638 | 2644102305 | 2643221617 | Bacteria | 5139111 |
| 639 | 2644115529 | 2643221620 | Bacteria | 5134593 |
| 640 | 2644229287 | 2643221641 | Bacteria | 4490190 |
| 641 | 2644323742 | 2643221657 | Bacteria | 5490246 |
| 642 | 2738868089 | 2738541305 | Bacteria | 4910150 |
| 643 | 2740169506 | 2739367898 | Bacteria | 4367674 |
| 644 | 2812333181 | 2811994874 | Bacteria | 5367947 |
| 645 | 2855386911 | 2855386786 | Bacteria | 4752232 |
| 646 | 2857484664 | 2857481737 | Bacteria | 4761446 |
| 647 | 2915364553 | 2915358134 | Bacteria | 6050864 |
| 648 | 2984580305 | 2984576629 | Bacteria | 4248407 |
| 649 | 2990259155 | 2990256926 | Bacteria | 4252839 |
| 650 | 8054612818 | 8054609563 | Bacteria | 5170090 |
| 651 | Ga0105245_10573415 | |||
| 652 | LJQas_1000412 | |||
| 653 | JGI24740J21852_10017099 | |||
| 654 | JGI24735J21928_10022661 | |||
| 655 | JGI24735J21928_10028744 | |||
| 656 | JGI25406J46586_10084803 | |||
| 657 | rootL2_10117377 | |||
| 658 | Ga0070658_10165353 | |||
| 659 | Ga0070658_10302533 | |||
| 660 | Ga0070658_10467988 | |||
| 661 | Ga0070683_100014266 | |||
| 662 | Ga0070683_100021520 | |||
| 663 | Ga0070683_100029029 | |||
| 664 | Ga0070683_100098007 | |||
| 665 | Ga0070683_100226006 | |||
| 666 | Ga0070670_100162956 | |||
| 667 | Ga0068869_100128075 | |||
| 668 | Ga0068869_100302461 | |||
| 669 | Ga0070680_100000461 | |||
| 670 | Ga0070680_100102926 | |||
| 671 | Ga0070680_100320293 | |||
| 672 | Ga0070682_100005770 | |||
| 673 | Ga0070682_100074894 | |||
| 674 | Ga0068868_100039847 | |||
| 675 | Ga0068868_100173268 | |||
| 676 | Ga0068868_100424554 | |||
| 677 | Ga0070660_100008169 | |||
| 678 | Ga0070660_100064295 | |||
| 679 | Ga0070660_100064904 | |||
| 680 | Ga0070660_100069805 | |||
| 681 | Ga0070660_100190787 | |||
| 682 | Ga0070660_100332300 | |||
| 683 | Ga0070691_10116749 | |||
| 684 | Ga0070687_100159063 | |||
| 685 | Ga0070692_10009398 | |||
| 686 | Ga0070668_100117634 | |||
| 687 | Ga0070669_100231582 | |||
| 688 | Ga0070675_100228645 | |||
| 689 | Ga0070675_100318766 | |||
| 690 | Ga0070659_100000127 | |||
| 691 | Ga0070659_100005038 | |||
| 692 | Ga0070659_100046347 | |||
| 693 | Ga0070659_100082916 | |||
| 694 | Ga0070659_100091089 | |||
| 695 | Ga0070709_10136426 | |||
| 696 | Ga0070714_100058075 | |||
| 697 | Ga0070713_100053292 | |||
| 698 | Ga0070710_10001862 | |||
| 699 | Ga0070694_100057184 | |||
| 700 | Ga0070663_100176541 | |||
| 701 | Ga0070663_100251008 | |||
| 702 | Ga0070678_100399370 | |||
| 703 | Ga0070662_100056979 | |||
| 704 | Ga0070681_10000013 | |||
| 705 | Ga0070681_10009958 | |||
| 706 | Ga0070681_10041695 | |||
| 707 | Ga0070698_100008451 | |||
| 708 | Ga0070679_100000006 | |||
| 709 | Ga0070679_100032172 | |||
| 710 | Ga0070679_100036108 | |||
| 711 | Ga0070679_100057022 | |||
| 712 | Ga0070679_100118692 | |||
| 713 | Ga0070679_100198363 | |||
| 714 | Ga0070679_100219262 | |||
| 715 | Ga0070679_100316244 | |||
| 716 | Ga0070684_100010611 | |||
| 717 | Ga0070684_100017579 | |||
| 718 | Ga0070684_100026802 | |||
| 719 | Ga0070684_100051353 | |||
| 720 | Ga0070684_100425670 | |||
| 721 | Ga0070684_100599635 | |||
| 722 | Ga0070686_100212732 | |||
| 723 | Ga0070686_100234364 | |||
| 724 | Ga0070665_100000863 | |||
| 725 | Ga0068855_100041832 | |||
| 726 | Ga0068855_100125890 | |||
| 727 | Ga0068855_100659518 | |||
| 728 | Ga0070664_100151469 | |||
| 729 | Ga0068857_100020341 | |||
| 730 | Ga0068857_100041933 | |||
| 731 | Ga0068857_100734613 | |||
| 732 | Ga0068854_100620527 | |||
| 733 | Ga0068856_100139969 | |||
| 734 | Ga0068856_100167619 | |||
| 735 | Ga0068852_100043863 | |||
| 736 | Ga0068864_100052792 | |||
| 737 | Ga0068864_100910664 | |||
| 738 | Ga0068861_100206038 | |||
| 739 | Ga0068861_100301802 | |||
| 740 | Ga0068870_10203364 | |||
| 741 | Ga0068863_100002158 | |||
| 742 | Ga0068858_100243273 | |||
| 743 | Ga0068860_100153849 | |||
| 744 | Ga0081539_10057626 | |||
| 745 | Ga0081539_10073121 | |||
| 746 | Ga0075365_10002441 | |||
| 747 | Ga0075365_10004436 | |||
| 748 | Ga0075365_10074775 | |||
| 749 | Ga0075365_10175250 | |||
| 750 | Ga0075365_10239045 | |||
| 751 | Ga0075363_100013028 | |||
| 752 | Ga0075363_100055393 | |||
| 753 | Ga0075363_100163560 | |||
| 754 | Ga0075364_10005225 | |||
| 755 | Ga0075364_10073713 | |||
| 756 | Ga0075367_10034317 | |||
| 757 | Ga0075367_10165542 | |||
| 758 | Ga0075367_10228257 | |||
| 759 | Ga0075367_10379562 | |||
| 760 | Ga0075369_10025803 | |||
| 761 | Ga0097621_100692163 | |||
| 762 | Ga0075370_10007612 | |||
| 763 | Ga0075428_100040450 | |||
| 764 | Ga0075431_100024377 | |||
| 765 | Ga0105240_10053118 | |||
| 766 | Ga0111539_10352329 | |||
| 767 | Ga0105245_10031866 | |||
| 768 | Ga0114129_10136326 | |||
| 769 | Ga0105243_10168209 | |||
| 770 | Ga0105243_10198052 | |||
| 771 | Ga0105243_10333262 | |||
| 772 | Ga0105243_10601174 | |||
| 773 | Ga0105242_10020637 | |||
| 774 | Ga0105242_10062802 | |||
| 775 | Ga0105242_10198154 | |||
| 776 | Ga0105242_10425258 | |||
| 777 | Ga0105248_10048253 | |||
| 778 | Ga0105248_10455762 | |||
| 779 | Ga0105248_10876674 | |||
| 780 | Ga0105237_10140489 | |||
| 781 | Ga0105238_10057186 | |||
| 782 | Ga0105249_10204512 | |||
| 783 | Ga0105239_10007799 | |||
| 784 | Ga0105239_10035882 | |||
| 785 | Ga0105239_10283359 | |||
| 786 | Ga0105246_10002293 | |||
| 787 | Ga0105246_10219789 | |||
| 788 | Ga0157371_10012474 | |||
| 789 | Ga0157370_10038213 | |||
| 790 | Ga0157370_10194917 | |||
| 791 | Ga0157369_10006587 | |||
| 792 | Ga0157369_10007928 | |||
| 793 | Ga0157369_10044516 | |||
| 794 | Ga0157369_10056150 | |||
| 795 | Ga0157369_10078869 | |||
| 796 | Ga0157369_10205818 | |||
| 797 | Ga0157369_10214595 | |||
| 798 | Ga0157369_10385976 | |||
| 799 | Ga0157369_10412109 | |||
| 800 | Ga0157369_11058315 | |||
| 801 | Ga0157374_10798145 | |||
| 802 | Ga0163162_10017211 | |||
| 803 | Ga0163162_10143265 | |||
| 804 | Ga0157372_10001640 | |||
| 805 | Ga0157372_10836405 | |||
| 806 | Ga0157372_11101928 | |||
| 807 | Ga0157372_11528749 | |||
| 808 | Ga0157375_10003295 | |||
| 809 | Ga0157375_10110865 | |||
| 810 | Ga0157375_10161005 | |||
| 811 | Ga0157375_10163570 | |||
| 812 | Ga0157375_10208579 | |||
| 813 | Ga0157375_11026832 | |||
| 814 | Ga0163163_10204811 | |||
| 815 | Ga0163163_10273003 | |||
| 816 | Ga0163163_10274931 | |||
| 817 | Ga0157380_10273653 | |||
| 818 | Ga0182008_10014550 | |||
| 819 | Ga0157379_10078826 | |||
| 820 | Ga0157379_10224056 | |||
| 821 | Ga0157379_10254618 | |||
| 822 | Ga0157379_10409312 | |||
| 823 | Ga0157376_10143530 | |||
| 824 | Ga0157376_11184282 | |||
| 825 | Ga0163161_10207168 | |||
| 826 | Ga0197907_10982223 | |||
| 827 | Ga0206349_1403162 | |||
| 828 | Ga0206350_10719707 | |||
| 829 | Ga0206354_10434256 | |||
| 830 | Ga0206353_10055876 | |||
| 831 | Ga0206353_10409269 | |||
| 832 | Ga0206353_11590552 | |||
| 833 | Ga0206353_11911907 | |||
| 834 | Ga0154015_1708112 | |||
| 835 | Ga0224712_10013909 | |||
| 836 | Ga0224712_10015224 | |||
| 837 | Ga0207692_10005771 | |||
| 838 | Ga0207688_10007027 | |||
| 839 | Ga0207647_10031355 | |||
| 840 | Ga0207647_10048021 | |||
| 841 | Ga0207647_10049211 | |||
| 842 | Ga0207647_10071960 | |||
| 843 | Ga0207699_10255066 | |||
| 844 | Ga0207643_10162959 | |||
| 845 | Ga0207705_10012173 | |||
| 846 | Ga0207705_10018300 | |||
| 847 | Ga0207705_10107744 | |||
| 848 | Ga0207707_10000211 | |||
| 849 | Ga0207707_10007133 | |||
| 850 | Ga0207707_10008328 | |||
| 851 | Ga0207695_10105209 | |||
| 852 | Ga0207660_10000809 | |||
| 853 | Ga0207660_10187772 | |||
| 854 | Ga0207662_10192477 | |||
| 855 | Ga0207657_10007599 | |||
| 856 | Ga0207657_10031278 | |||
| 857 | Ga0207657_10068677 | |||
| 858 | Ga0207657_10146458 | |||
| 859 | Ga0207657_10160724 | |||
| 860 | Ga0207657_10180901 | |||
| 861 | Ga0207657_10248623 | |||
| 862 | Ga0207657_10302496 | |||
| 863 | Ga0207657_10363899 | |||
| 864 | Ga0207652_10000012 | |||
| 865 | Ga0207652_10040934 | |||
| 866 | Ga0207652_10075931 | |||
| 867 | Ga0207652_10125912 | |||
| 868 | Ga0207652_10148653 | |||
| 869 | Ga0207652_10225637 | |||
| 870 | Ga0207652_10595064 | |||
| 871 | Ga0207687_10014323 | |||
| 872 | Ga0207687_10131458 | |||
| 873 | Ga0207700_10948041 | |||
| 874 | Ga0207664_10047636 | |||
| 875 | Ga0207664_10182444 | |||
| 876 | Ga0207690_10000653 | |||
| 877 | Ga0207690_10006668 | |||
| 878 | Ga0207690_10031049 | |||
| 879 | Ga0207690_10145590 | |||
| 880 | Ga0207706_10058568 | |||
| 881 | Ga0207706_10570627 | |||
| 882 | Ga0207686_10040739 | |||
| 883 | Ga0207686_10275434 | |||
| 884 | Ga0207711_10048933 | |||
| 885 | Ga0207711_10071729 | |||
| 886 | Ga0207689_10034288 | |||
| 887 | Ga0207689_10111159 | |||
| 888 | Ga0207661_10019211 | |||
| 889 | Ga0207661_10056793 | |||
| 890 | Ga0207661_10144561 | |||
| 891 | Ga0207661_10227048 | |||
| 892 | Ga0207661_10248493 | |||
| 893 | Ga0207679_10309555 | |||
| 894 | Ga0207679_10657524 | |||
| 895 | Ga0207667_10249891 | |||
| 896 | Ga0207651_10113424 | |||
| 897 | Ga0207640_10305402 | |||
| 898 | Ga0207658_10492860 | |||
| 899 | Ga0207658_10646292 | |||
| 900 | Ga0207677_10022061 | |||
| 901 | Ga0207677_10138192 | |||
| 902 | Ga0207703_10227862 | |||
| 903 | Ga0207703_10335262 | |||
| 904 | Ga0207678_10100243 | |||
| 905 | Ga0207678_10262459 | |||
| 906 | Ga0207702_10071142 | |||
| 907 | Ga0207702_10112056 | |||
| 908 | Ga0207702_10123488 | |||
| 909 | Ga0207676_10015857 | |||
| 910 | Ga0207676_10484458 | |||
| 911 | Ga0207674_10031204 | |||
| 912 | Ga0207674_10052078 | |||
| 913 | Ga0207675_100027909 | |||
| 914 | Ga0207675_100126097 | |||
| 915 | Ga0207675_100214984 | |||
| 916 | Ga0207683_10383286 | |||
| 917 | Ga0207698_10604979 | |||
| 918 | Ga0268266_10055142 | |||
| 919 | Ga0268266_10170571 | |||
| 920 | Ga0268265_10067790 | |||
| 921 | Ga0268264_10110489 | |||
| 922 | Ga0265338_10018246 | |||
| 923 | Ga0316177_1148011 | |||
| 924 | Ga0316176_1212495 | |||
| 925 | Ga0314311_1118353 | |||
| 926 | Ga0316182_1157798 | |||
| 927 | Ga0265320_10086211 | |||
| 928 | Ga0265325_10001095 | |||
| 929 | Ga0265340_10001753 | |||
| 930 | Ga0265339_10008428 | |||
| 931 | Ga0265316_10183694 | |||
| 932 | Ga0265313_10062438 | |||
| 933 | Ga0307508_10103616 | |||
| 934 | Ga0265342_10052295 | |||
| 935 | Ga0307413_10026116 | |||
| 936 | Ga0307413_10148690 | |||
| 937 | Ga0307413_10221403 | |||
| 938 | Ga0307518_10194742 | |||
| 939 | Ga0307410_10104667 | |||
| 940 | Ga0307410_10183619 | |||
| 941 | Ga0307406_10135846 | |||
| 942 | Ga0307407_10024450 | |||
| 943 | Ga0307412_10151902 | |||
| 944 | Ga0307409_100113666 | |||
| 945 | Ga0307409_100210856 | |||
| 946 | Ga0307409_100606799 | |||
| 947 | Ga0307409_100937322 | |||
| 948 | Ga0307416_100042351 | |||
| 949 | Ga0307416_100230371 | |||
| 950 | Ga0307414_10380419 | |||
| 951 | Ga0307414_10563502 | |||
| 952 | Ga0307414_10986902 | |||
| 953 | Ga0307411_10049485 | |||
| 954 | Ga0307411_10100639 | |||
| 955 | Ga0307411_10217552 | |||
| 956 | Ga0307411_10340332 | |||
| 957 | Ga0307415_100007954 | |||
| 958 | Ga0307415_100109083 | |||
| 959 | Ga0307415_100137591 | |||
| 960 | Ga0307415_100165523 | |||
| 961 | Ga0307415_100412449 | |||
| 962 | Ga0316212_1000449 | |||
| 963 | Ga0373931_0122330 | |||
| 964 | Ga0372808_015066 | |||
| 965 | Ga0373925_0000030 | |||
| 966 | Ga0395900_0023706 | |||
| 967 | Ga0395900_0038644 | |||
| 968 | Ga0395900_0416670 | |||
| 969 | Ga0395900_0606496 | |||
| 970 | Ga0395900_0853637 | |||
| 971 | Ga0395898_0039593 | |||
| 972 | Ga0395898_0049902 | |||
| 973 | Ga0395898_0084914 | |||
| 974 | Ga0395898_0198193 | |||
| 975 | Ga0395901_0023355 | |||
| 976 | Ga0395901_0074201 | |||
| 977 | Ga0395901_0157248 | |||
| 978 | Ga0395901_0329677 | |||
| 979 | Ga0436365_1282228 | |||
| 980 | Ga0436365_1377250 | |||
| 981 | Ga0436362_0153049 | |||
| 982 | Ga0451802_2137692 | |||
| 983 | Ga0451853_3693024 | |||
| 984 | Ga0439431_0010586 | |||
| 985 | Ga0439445_0013152 | |||
| 986 | Ga0450907_028689 | |||
| 987 | Ga0439446_0050302 | |||
| 988 | Ga0439434_0004726 | |||
| 989 | Ga0466969_0034744 | |||
| 990 | Ga0466969_0110978 | |||
| 991 | Ga0466972_0001090 | |||
| 992 | Ga0466972_0109011 | |||
| 993 | Ga0466972_0235333 | |||
| 994 | Ga0466965_0001948 | |||
| 995 | Ga0466965_0006037 | |||
| 996 | Ga0466965_0007075 | |||
| 997 | Ga0466965_0010185 | |||
| 998 | Ga0466965_0022208 | |||
| 999 | Ga0466965_0062642 | |||
| 1000 | Ga0466966_0057655 | |||
| 1001 | Ga0466966_0083960 | |||
| 1002 | Ga0466966_0224233 | |||
| 1003 | Ga0466966_0246538 | |||
| 1004 | Ga0466966_0266982 | |||
| 1005 | Ga0466961_0007255 | |||
| 1006 | Ga0466961_0022688 | |||
| 1007 | Ga0466961_0060836 | |||
| 1008 | Ga0466961_0070852 | |||
| 1009 | Ga0466961_0070901 | |||
| 1010 | Ga0466963_0047474 | |||
| 1011 | Ga0466963_0053457 | |||
| 1012 | Ga0466963_0140765 | |||
| 1013 | Ga0466963_0221847 | |||
| 1014 | Ga0466963_0460483 | |||
| 1015 | Ga0466963_0532438 | |||
| 1016 | Ga0466964_0021785 | |||
| 1017 | Ga0466971_0006494 | |||
| 1018 | Ga0466968_0019035 | |||
| 1019 | Ga0466970_0011156 | |||
| 1020 | Ga0466970_0035893 | |||
| 1021 | Ga0466970_0078679 | |||
| 1022 | Ga0466970_0103946 | |||
| 1023 | Ga0466957_0004275 | |||
| 1024 | Ga0466957_0065013 | |||
| 1025 | Ga0466957_0067415 | |||
| 1026 | Ga0466957_0089302 | |||
| 1027 | Ga0466957_0210338 | |||
| 1028 | Ga0466960_0002897 | |||
| 1029 | Ga0466960_0005813 | |||
| 1030 | Ga0466960_0012418 | |||
| 1031 | Ga0466960_0016652 | |||
| 1032 | Ga0466960_0017323 | |||
| 1033 | Ga0466960_0023613 | |||
| 1034 | Ga0466960_0065720 | |||
| 1035 | Ga0466960_0118172 | |||
| 1036 | Ga0466960_0224900 | |||
| 1037 | Ga0466960_0361220 | |||
| 1038 | Ga0466959_0140810 | |||
| 1039 | Ga0466959_0163462 | |||
| 1040 | Ga0466959_0480328 | |||
| 1041 | Ga0466958_0004993 | |||
| 1042 | Ga0466958_0035040 | |||
| 1043 | Ga0466967_0031067 | |||
| 1044 | Ga0466967_0041221 | |||
| 1045 | Ga0466967_0066369 | |||
| 1046 | Ga0466967_0074937 | |||
| 1047 | Ga0466967_0074952 | |||
| 1048 | Ga0466967_0178184 | |||
| 1049 | Ga0466967_0213508 | |||
| 1050 | Ga0466967_0255334 | |||
| 1051 | Ga0466967_0440460 | |||
| 1052 | Ga0466967_0758135 | |||
| 1053 | Ga0495592_0052888 | |||
| 1054 | Ga0495603_0021712 | |||
| 1055 | Ga0495629_0287235 | |||
| 1056 | Ga0495653_0043162 | |||
| 1057 | Ga0495662_0000289 | |||
| 1058 | Ga0495608_0001114 | |||
| 1059 | Ga0495628_0033616 | |||
| 1060 | Ga0495666_0000329 | |||
| 1061 | Ga0495665_0000377 | |||
| 1062 | Ga0495586_0012765 | |||
| 1063 | Ga0495587_0002610 | |||
| 1064 | Ga0495645_0027334 | |||
| 1065 | Ga0495634_0153693 | |||
| 1066 | Ga0495657_0015302 | |||
| 1067 | Ga0495599_0033790 | |||
| 1068 | Ga0495623_0029552 | |||
| 1069 | Ga0495658_0080854 | |||
| 1070 | Ga0495613_0000744 | |||
| 1071 | Ga0495581_0001219 | |||
| 1072 | Ga0495604_0000347 | |||
| 1073 | Ga0495604_0255610 | |||
| 1074 | Ga0495674_0035910 | |||
| 1075 | Ga0495676_0124607 | |||
| 1076 | Ga0495593_0015036 | |||
| 1077 | Ga0495602_0072967 | |||
| 1078 | Ga0496100_0080431 | |||
| 1079 | Ga0496100_0114292 | |||
| 1080 | Ga0496100_0128069 | |||
| 1081 | Ga0496100_0174488 | |||
| 1082 | Ga0496100_0209586 | |||
| 1083 | Ga0496101_0103349 | |||
| 1084 | Ga0496101_0180743 | |||
| 1085 | Ga0496102_0006295 | |||
| 1086 | Ga0496102_0014458 | |||
| 1087 | Ga0496102_0184218 | |||
| 1088 | Ga0496103_0032232 | |||
| 1089 | Ga0496103_0068673 | |||
| 1090 | Ga0496103_0144126 | |||
| 1091 | Ga0496104_0001924 | |||
| 1092 | Ga0496104_0134786 | |||
| 1093 | Ga0496105_0007521 | |||
| 1094 | Ga0496105_0060728 | |||
| 1095 | Ga0496106_0020238 | |||
| 1096 | Ga0496106_0034968 | |||
| 1097 | Ga0496106_0492239 | |||
| 1098 | Ga0496107_0112877 | |||
| 1099 | Ga0496107_0188630 | |||
| 1100 | Ga0496107_0217182 | |||
| 1101 | Ga0496108_0000227 | |||
| 1102 | Ga0496108_0032464 | |||
| 1103 | Ga0496108_0088531 | |||
| 1104 | Ga0496108_0089619 | |||
| 1105 | Ga0496108_0101999 | |||
| 1106 | Ga0496108_0266843 | |||
| 1107 | Ga0496109_0023477 | |||
| 1108 | Ga0496109_0027527 | |||
| 1109 | Ga0496109_0049181 | |||
| 1110 | Ga0496109_0065819 | |||
| 1111 | Ga0496109_0139099 | |||
| 1112 | Ga0496109_0209018 | |||
| 1113 | Ga0496109_0741684 | |||
| 1114 | Ga0496109_0848077 | |||
| 1115 | Ga0496110_0003710 | |||
| 1116 | Ga0496110_0041823 | |||
| 1117 | Ga0496110_0341964 | |||
| 1118 | Ga0496110_0445227 | |||
| 1119 | Ga0496111_0004923 | |||
| 1120 | Ga0496111_0037687 | |||
| 1121 | Ga0496111_0115693 | |||
| 1122 | Ga0496111_0270310 | |||
| 1123 | Ga0496111_0698947 | |||
| 1124 | Ga0496112_0029124 | |||
| 1125 | Ga0496112_0120727 | |||
| 1126 | Ga0496113_0003599 | |||
| 1127 | Ga0496113_0089055 | |||
| 1128 | Ga0496113_0126117 | |||
| 1129 | Ga0496113_0214002 | |||
| 1130 | Ga0496113_0430143 | |||
| 1131 | Ga0496114_0076537 | |||
| 1132 | Ga0496114_0139297 | |||
| 1133 | Ga0496114_0245435 | |||
| 1134 | Ga0496114_0703587 | |||
| 1135 | Ga0496115_0010119 | |||
| 1136 | Ga0496115_0030337 | |||
| 1137 | Ga0496115_0121961 | |||
| 1138 | Ga0496126_0744792 | |||
| 1139 | Ga0501031_0001642 | |||
| 1140 | Ga0501031_0003141 | |||
| 1141 | Ga0501031_0162363 | |||
| 1142 | Ga0501031_0267563 | |||
| 1143 | Ga0501031_0322285 | |||
| 1144 | Ga0501032_0012114 | |||
| 1145 | Ga0501032_0014543 | |||
| 1146 | Ga0501032_0070429 | |||
| 1147 | Ga0501032_0267342 | |||
| 1148 | Ga0501033_0003639 | |||
| 1149 | Ga0501033_0154189 | |||
| 1150 | Ga0501034_0026751 | |||
| 1151 | Ga0501034_0107003 | |||
| 1152 | Ga0501036_0000932 | |||
| 1153 | Ga0501036_0004317 | |||
| 1154 | Ga0501036_0060606 | |||
| 1155 | Ga0501036_0302194 | |||
| 1156 | Ga0501036_0720140 | |||
| 1157 | Ga0501037_0002300 | |||
| 1158 | Ga0501037_0030277 | |||
| 1159 | Ga0501037_0030829 | |||
| 1160 | Ga0501038_0004110 | |||
| 1161 | Ga0501038_0011972 | |||
| 1162 | Ga0501038_0012988 | |||
| 1163 | Ga0501038_0344028 | |||
| 1164 | Ga0501039_0007533 | |||
| 1165 | Ga0501039_0029897 | |||
| 1166 | Ga0501039_0037859 | |||
| 1167 | Ga0501040_0024598 | |||
| 1168 | Ga0501041_0099911 | |||
| 1169 | Ga0501041_0103081 | |||
| 1170 | Ga0501042_0001323 | |||
| 1171 | Ga0501042_0002629 | |||
| 1172 | Ga0501042_0041575 | |||
| 1173 | Ga0501042_0051222 | |||
| 1174 | Ga0501042_0201195 | |||
| 1175 | Ga0501043_0062181 | |||
| 1176 | Ga0501043_0200180 | |||
| 1177 | Ga0501046_0005262 | |||
| 1178 | Ga0501046_0061187 | |||
| 1179 | Ga0501046_0288367 | |||
| 1180 | Ga0501046_0301713 | |||
| 1181 | Ga0501048_0008995 | |||
| 1182 | Ga0501048_0033168 | |||
| 1183 | Ga0501048_0073524 | |||
| 1184 | Ga0501048_0191883 | |||
| 1185 | Ga0501048_0228835 | |||
| 1186 | Ga0501067_0001156 | |||
| 1187 | Ga0501067_0003684 | |||
| 1188 | Ga0501067_0008552 | |||
| 1189 | Ga0501067_0018247 | |||
| 1190 | Ga0501067_0075370 | |||
| 1191 | Ga0501068_0008355 | |||
| 1192 | Ga0501068_0097491 | |||
| 1193 | Ga0501068_0280738 | |||
| 1194 | Ga0501069_0130397 | |||
| 1195 | Ga0501069_0132989 | |||
| 1196 | Ga0501069_0138845 | |||
| 1197 | Ga0501069_0173059 | |||
| 1198 | Ga0501069_0278516 | |||
| 1199 | Ga0501070_0000763 | |||
| 1200 | Ga0501070_0004751 | |||
| 1201 | Ga0501070_0005416 | |||
| 1202 | Ga0501070_0005419 | |||
| 1203 | Ga0501070_0017696 | |||
| 1204 | Ga0501070_0076120 | |||
| 1205 | Ga0501070_0208302 | |||
| 1206 | Ga0501070_0353258 | |||
| 1207 | Ga0501070_0484709 | |||
| 1208 | Ga0501071_0007691 | |||
| 1209 | Ga0501071_0020391 | |||
| 1210 | Ga0501071_0156666 | |||
| 1211 | Ga0501071_0557428 | |||
| 1212 | Ga0501072_0128682 | |||
| 1213 | Ga0501072_0229210 | |||
| 1214 | Ga0501073_0005322 | |||
| 1215 | Ga0501073_0009274 | |||
| 1216 | Ga0501073_0134031 | |||
| 1217 | Ga0501074_0002479 | |||
| 1218 | Ga0501074_0003018 | |||
| 1219 | Ga0501074_0026779 | |||
| 1220 | Ga0501074_0101011 | |||
| 1221 | Ga0501075_0028331 | |||
| 1222 | Ga0501075_0097105 | |||
| 1223 | Ga0501076_0064642 | |||
| 1224 | Ga0501077_0014762 | |||
| 1225 | Ga0501077_0034432 | |||
| 1226 | Ga0501079_0005516 | |||
| 1227 | Ga0501079_0043657 | |||
| 1228 | Ga0501079_0229428 | |||
| 1229 | Ga0501079_0298162 | |||
| 1230 | Ga0501080_0010354 | |||
| 1231 | Ga0501080_0010624 | |||
| 1232 | Ga0501080_0050874 | |||
| 1233 | Ga0501080_0076216 | |||
| 1234 | Ga0501080_0094623 | |||
| 1235 | Ga0501080_0199249 | |||
| 1236 | Ga0501080_0244558 | |||
| 1237 | Ga0501083_0018059 | |||
| 1238 | Ga0501035_0001668 | |||
| 1239 | Ga0501035_0063042 | |||
| 1240 | Ga0501035_0096207 | |||
| 1241 | Ga0501035_0160154 | |||
| 1242 | Ga0501035_0541003 | |||
| 1243 | Ga0501044_0002171 | |||
| 1244 | Ga0501044_0009429 | |||
| 1245 | Ga0501044_0155604 | |||
| 1246 | Ga0501044_0473395 | |||
| 1247 | Ga0501045_0092732 | |||
| 1248 | nmdc:mga03683_23682_c1 | |||
| 1249 | nmdc:mga03n38_12897_c1 | |||
| 1250 | nmdc:mga00v17_31733_c1 | |||
| 1251 | nmdc:mga0yw44_127858_c1 | |||
| 1252 | nmdc:mga0yw44_139386_c1 | |||
| 1253 | nmdc:mga0yw44_1894_c1 | |||
| 1254 | nmdc:mga0yw44_23850_c1 | |||
| 1255 | nmdc:mga0yw44_61778_c1 | |||
| 1256 | nmdc:mga0yw44_71738_c1 | |||
| 1257 | nmdc:mga06z11_269058_c1 | |||
| 1258 | nmdc:mga06z11_337056_c1 | |||
| 1259 | nmdc:mga06z11_7898_c1 | |||
| 1260 | nmdc:mga07m45_8437_c2 | |||
| 1261 | nmdc:mga05p37_709569_c1 | |||
| 1262 | nmdc:mga05p37_87169_c1 | |||
| 1263 | nmdc:mga09592_16977_c1 | |||
| 1264 | nmdc:mga0sz30_16826_c1 | |||
| 1265 | Ga0495601_0046982 | |||
| 1266 | Ga0495595_0187985 | |||
| 1267 | Ga0495619_0057853 | |||
| 1268 | Ga0495619_0109213 | |||
| 1269 | Ga0500644_0000129 | |||
| 1270 | Ga0500646_0000186 | |||
| 1271 | Ga0500583_0003883 | |||
| 1272 | Ga0500556_0000724 | |||
| 1273 | Ga0500593_000276 | |||
| 1274 | Ga0500573_0015555 | |||
| 1275 | Ga0501084_0033760 | |||
| 1276 | Ga0501084_0501073 | |||
| 1277 | Ga0501082_0080821 | |||
| 1278 | Ga0501082_0212468 | |||
| 1279 | Ga0501082_0302485 | |||
| 1280 | Ga0466962_0052203 | |||
| 1281 | Ga0466962_0255826 | |||
| 1282 | Ga0530510_0029040 | |||
| 1283 | Ga0530510_0375196 | |||
| 1284 | 2643891637 | |||
| 1285 | 2643960685 | |||
| 1286 | 2644035800 | |||
| 1287 | 2644093898 | |||
| 1288 | 2644102305 | |||
| 1289 | 2644115529 | |||
| 1290 | 2644229287 | |||
| 1291 | 2644323742 | |||
| 1292 | 2738868089 | |||
| 1293 | 2740169506 | |||
| 1294 | 2812333181 | |||
| 1295 | 2855386911 | |||
| 1296 | 2857484664 | |||
| 1297 | 2915364553 | |||
| 1298 | 2984580305 | |||
| 1299 | 2990259155 | |||
| 1300 | 8054612818 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xf4-assembly1.cif.gz_A-2 | crystal structure of salmonella enterica serovar typhimurium ycbl | 0.9007 | 16 | 212 |
| 7ev5-assembly1.cif.gz_A | crystal structure of bleg-1 b3 metallo-beta-lactamase | 0.8699 | 14 | 210 |
| 2zzi-assembly1.cif.gz_A | crystal structure of ttha1623 in a di-iron-bound form | 0.856 | 4 | 210 |
| 6s0i-assembly1.cif.gz_A | crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site | 0.8504 | 14 | 194 |
| 7l0b-assembly3.cif.gz_C | crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme | 0.8014 | 4 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMW3_3_221_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9427 | 3 | 210 | 3.60.15.10 |
| 2xf4A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9007 | 16 | 212 | 3.60.15.10 |
| af_Q4D0L0_259_399_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8994 | 118 | 215 | 3.60.15.10 |
| af_P9WMW3_3_221_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8802 | 3 | 210 | 3.60.15.10 |
| 2zwrB00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8724 | 5 | 213 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9J9S7-F1-model_v4 | MBL fold metallo-hydrolase | 0.9686 | 109 | 213 |
GO:0016787
|
| AF-A0A6V8K2Y8-F1-model_v4 | Hydrolase | 0.9515 | 11 | 218 |
GO:0016787
|
| AF-A0A4Q7JCC8-F1-model_v4 | MBL fold metallo-hydrolase | 0.9435 | 5 | 213 |
GO:0016787
|
| AF-A0A2U3P0L5-F1-model_v4 | Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II | 0.9429 | 12 | 213 |
GO:0016787
|
| AF-A0A3C1FG22-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9411 | 121 | 211 |
GO:0016787
|