F472512

General Info

Members Datasets Scaffolds Average Seq Length
650 292 1300 233

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10573415|Ga0105245_105734152
Length 265
Sequence MRGSARRIGRLRGFFCCVQILSRTGALTVLIAGFPAGPWGTNCYVVATGPGAECVVVDPGKDAADGVAEVVREHRLKPVSVLVSHGHIDHMWCVAPVAGTYDATAWIHPRDRHLLSDPMAGMSRETAGMLLGGSYEFAEPDDVAELADLQTLEIAGLRFTVDHTPGHTEGSVTFRTPYAQDDVSELMFSGDLLFAGSIGRTDLPGGDHPTMLRSLRDKVLPLADDIVVLPGHGEQTSIGRERATNPFLLDLVDDSGRADAPTRGL

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
129 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
130 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
267 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
268 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
269 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
270 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
271 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2643221576 Nocardioides sp. Root614 Isolate Unclassified
277 2643221590 Nocardioides sp. Root682 Isolate Unclassified
278 2643221604 Nocardioides sp. Root190 Isolate Unclassified
279 2643221615 Nocardioides sp. Root224 Isolate Unclassified
280 2643221617 Nocardioides sp. Root79 Isolate Unclassified
281 2643221620 Nocardioides sp. Root240 Isolate Unclassified
282 2643221641 Nocardioides sp. Root122 Isolate Unclassified
283 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
284 2738541305 Nocardioides sp. CF167 Isolate Unclassified
285 2739367898 Nocardioides sp. CF479 Isolate Unclassified
286 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
287 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
288 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
289 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
290 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
291 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
292 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.54
Metatranscriptomes 1.85
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 5.54
Nodule 0.15
Rhizoplane 9.38
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10573415 3300009098 Bacteria 1152
2 LJQas_1000412 3300000549 Bacteria 7231
3 JGI24740J21852_10017099 3300001979 Bacteria 2603
4 JGI24735J21928_10022661 3300002067 Bacteria 1909
5 JGI24735J21928_10028744 3300002067 Bacteria 1659
6 JGI25406J46586_10084803 3300003203 Bacteria 965
7 rootL2_10117377 3300003322 Bacteria 1187
8 Ga0070658_10165353 3300005327 Bacteria 1857
9 Ga0070658_10302533 3300005327 Bacteria 1364
10 Ga0070658_10467988 3300005327 Bacteria 1087
11 Ga0070683_100014266 3300005329 Bacteria 6945
12 Ga0070683_100021520 3300005329 Bacteria 5755
13 Ga0070683_100029029 3300005329 Bacteria 5005
14 Ga0070683_100098007 3300005329 Bacteria 2758
15 Ga0070683_100226006 3300005329 Bacteria 1779
16 Ga0070670_100162956 3300005331 Bacteria 1933
17 Ga0068869_100128075 3300005334 Bacteria 1949
18 Ga0068869_100302461 3300005334 Bacteria 1292
19 Ga0070680_100000461 3300005336 Bacteria 27731
20 Ga0070680_100102926 3300005336 Bacteria 2372
21 Ga0070680_100320293 3300005336 Bacteria 1316
22 Ga0070682_100005770 3300005337 Bacteria 6908
23 Ga0070682_100074894 3300005337 Bacteria 2175
24 Ga0068868_100039847 3300005338 Bacteria 3653
25 Ga0068868_100173268 3300005338 Bacteria 1787
26 Ga0068868_100424554 3300005338 Bacteria 1152
27 Ga0070660_100008169 3300005339 Bacteria 7315
28 Ga0070660_100064295 3300005339 Bacteria 2854
29 Ga0070660_100064904 3300005339 Bacteria 2841
30 Ga0070660_100069805 3300005339 Bacteria 2741
31 Ga0070660_100190787 3300005339 Bacteria 1660
32 Ga0070660_100332300 3300005339 Bacteria 1250
33 Ga0070691_10116749 3300005341 Bacteria 1340
34 Ga0070687_100159063 3300005343 Bacteria 1334
35 Ga0070692_10009398 3300005345 Bacteria 4408
36 Ga0070668_100117634 3300005347 Bacteria 2121
37 Ga0070669_100231582 3300005353 Bacteria 1464
38 Ga0070675_100228645 3300005354 Bacteria 1622
39 Ga0070675_100318766 3300005354 Bacteria 1373
40 Ga0070659_100000127 3300005366 Bacteria 57549
41 Ga0070659_100005038 3300005366 Bacteria 9470
42 Ga0070659_100046347 3300005366 Bacteria 3408
43 Ga0070659_100082916 3300005366 Bacteria 2562
44 Ga0070659_100091089 3300005366 Bacteria 2444
45 Ga0070709_10136426 3300005434 Bacteria 1681
46 Ga0070714_100058075 3300005435 Bacteria 3313
47 Ga0070713_100053292 3300005436 Bacteria 3352
48 Ga0070710_10001862 3300005437 Bacteria 9940
49 Ga0070694_100057184 3300005444 Bacteria 2651
50 Ga0070663_100176541 3300005455 Bacteria 1654
51 Ga0070663_100251008 3300005455 Bacteria 1400
52 Ga0070678_100399370 3300005456 Bacteria 1194
53 Ga0070662_100056979 3300005457 Bacteria 2838
54 Ga0070681_10000013 3300005458 Bacteria 135004
55 Ga0070681_10009958 3300005458 Bacteria 9371
56 Ga0070681_10041695 3300005458 Bacteria 4601
57 Ga0070698_100008451 3300005471 Bacteria 11122
58 Ga0070679_100000006 3300005530 Bacteria 203959
59 Ga0070679_100032172 3300005530 Bacteria 5186
60 Ga0070679_100036108 3300005530 Bacteria 4904
61 Ga0070679_100057022 3300005530 Bacteria 3892
62 Ga0070679_100118692 3300005530 Bacteria 2630
63 Ga0070679_100198363 3300005530 Bacteria 1974
64 Ga0070679_100219262 3300005530 Bacteria 1864
65 Ga0070679_100316244 3300005530 Bacteria 1511
66 Ga0070684_100010611 3300005535 Bacteria 7305
67 Ga0070684_100017579 3300005535 Bacteria 5875
68 Ga0070684_100026802 3300005535 Bacteria 4858
69 Ga0070684_100051353 3300005535 Bacteria 3582
70 Ga0070684_100425670 3300005535 Bacteria 1226
71 Ga0070684_100599635 3300005535 Bacteria 1024
72 Ga0070686_100212732 3300005544 Bacteria 1393
73 Ga0070686_100234364 3300005544 Bacteria 1333
74 Ga0070665_100000863 3300005548 Bacteria 39318
75 Ga0068855_100041832 3300005563 Bacteria 5430
76 Ga0068855_100125890 3300005563 Bacteria 2930
77 Ga0068855_100659518 3300005563 Bacteria 1123
78 Ga0070664_100151469 3300005564 Bacteria 2048
79 Ga0068857_100020341 3300005577 Bacteria 5837
80 Ga0068857_100041933 3300005577 Bacteria 4058
81 Ga0068857_100734613 3300005577 Bacteria 940
82 Ga0068854_100620527 3300005578 Bacteria 925
83 Ga0068856_100139969 3300005614 Bacteria 2427
84 Ga0068856_100167619 3300005614 Bacteria 2208
85 Ga0068852_100043863 3300005616 Bacteria 3795
86 Ga0068864_100052792 3300005618 Bacteria 3505
87 Ga0068864_100910664 3300005618 Bacteria 869
88 Ga0068861_100206038 3300005719 Bacteria 1654
89 Ga0068861_100301802 3300005719 Bacteria 1387
90 Ga0068870_10203364 3300005840 Bacteria 1202
91 Ga0068863_100002158 3300005841 Bacteria 19512
92 Ga0068858_100243273 3300005842 Bacteria 1708
93 Ga0068860_100153849 3300005843 Bacteria 2216
94 Ga0081539_10057626 3300005985 Bacteria 2148
95 Ga0081539_10073121 3300005985 Bacteria 1830
96 Ga0075365_10002441 3300006038 Bacteria 9120
97 Ga0075365_10004436 3300006038 Bacteria 7434
98 Ga0075365_10074775 3300006038 Bacteria 2285
99 Ga0075365_10175250 3300006038 Bacteria 1498
100 Ga0075365_10239045 3300006038 Bacteria 1275
101 Ga0075363_100013028 3300006048 Bacteria 4018
102 Ga0075363_100055393 3300006048 Bacteria 2124
103 Ga0075363_100163560 3300006048 Bacteria 1261
104 Ga0075364_10005225 3300006051 Bacteria 7536
105 Ga0075364_10073713 3300006051 Bacteria 2250
106 Ga0075367_10034317 3300006178 Bacteria 2930
107 Ga0075367_10165542 3300006178 Bacteria 1376
108 Ga0075367_10228257 3300006178 Bacteria 1166
109 Ga0075367_10379562 3300006178 Bacteria 893
110 Ga0075369_10025803 3300006186 Bacteria 2446
111 Ga0097621_100692163 3300006237 Bacteria 938
112 Ga0075370_10007612 3300006353 Bacteria 5524
113 Ga0075428_100040450 3300006844 Bacteria 5128
114 Ga0075431_100024377 3300006847 Bacteria 6198
115 Ga0105240_10053118 3300009093 Bacteria 5089
116 Ga0111539_10352329 3300009094 Bacteria 1713
117 Ga0105245_10031866 3300009098 Bacteria 4668
118 Ga0114129_10136326 3300009147 Bacteria 3368
119 Ga0105243_10168209 3300009148 Bacteria 1896
120 Ga0105243_10198052 3300009148 Bacteria 1760
121 Ga0105243_10333262 3300009148 Bacteria 1387
122 Ga0105243_10601174 3300009148 Bacteria 1059
123 Ga0105242_10020637 3300009176 Bacteria 5168
124 Ga0105242_10062802 3300009176 Bacteria 3058
125 Ga0105242_10198154 3300009176 Bacteria 1782
126 Ga0105242_10425258 3300009176 Bacteria 1246
127 Ga0105248_10048253 3300009177 Bacteria 4776
128 Ga0105248_10455762 3300009177 Bacteria 1441
129 Ga0105248_10876674 3300009177 Bacteria 1013
130 Ga0105237_10140489 3300009545 Bacteria 2409
131 Ga0105238_10057186 3300009551 Bacteria 3911
132 Ga0105249_10204512 3300009553 Bacteria 1934
133 Ga0105239_10007799 3300010375 Bacteria 12246
134 Ga0105239_10035882 3300010375 Bacteria 5444
135 Ga0105239_10283359 3300010375 Bacteria 1866
136 Ga0105246_10002293 3300011119 Bacteria 11539
137 Ga0105246_10219789 3300011119 Bacteria 1488
138 Ga0157371_10012474 3300013102 Bacteria 6493
139 Ga0157370_10038213 3300013104 Bacteria 4644
140 Ga0157370_10194917 3300013104 Bacteria 1880
141 Ga0157369_10006587 3300013105 Bacteria 13428
142 Ga0157369_10007928 3300013105 Bacteria 12210
143 Ga0157369_10044516 3300013105 Bacteria 4830
144 Ga0157369_10056150 3300013105 Bacteria 4249
145 Ga0157369_10078869 3300013105 Bacteria 3527
146 Ga0157369_10205818 3300013105 Bacteria 2064
147 Ga0157369_10214595 3300013105 Bacteria 2016
148 Ga0157369_10385976 3300013105 Bacteria 1453
149 Ga0157369_10412109 3300013105 Bacteria 1401
150 Ga0157369_11058315 3300013105 Bacteria 830
151 Ga0157374_10798145 3300013296 Bacteria 960
152 Ga0163162_10017211 3300013306 Bacteria 7073
153 Ga0163162_10143265 3300013306 Bacteria 2504
154 Ga0157372_10001640 3300013307 Bacteria 24319
155 Ga0157372_10836405 3300013307 Bacteria 1069
156 Ga0157372_11101928 3300013307 Bacteria 919
157 Ga0157372_11528749 3300013307 Bacteria 769
158 Ga0157375_10003295 3300013308 Bacteria 13980
159 Ga0157375_10110865 3300013308 Bacteria 2842
160 Ga0157375_10161005 3300013308 Bacteria 2386
161 Ga0157375_10163570 3300013308 Bacteria 2369
162 Ga0157375_10208579 3300013308 Bacteria 2111
163 Ga0157375_11026832 3300013308 Bacteria 963
164 Ga0163163_10204811 3300014325 Bacteria 2021
165 Ga0163163_10273003 3300014325 Bacteria 1742
166 Ga0163163_10274931 3300014325 Bacteria 1735
167 Ga0157380_10273653 3300014326 Bacteria 1541
168 Ga0182008_10014550 3300014497 Bacteria 4118
169 Ga0157379_10078826 3300014968 Bacteria 2950
170 Ga0157379_10224056 3300014968 Bacteria 1704
171 Ga0157379_10254618 3300014968 Bacteria 1594
172 Ga0157379_10409312 3300014968 Bacteria 1248
173 Ga0157376_10143530 3300014969 Bacteria 2145
174 Ga0157376_11184282 3300014969 Bacteria 792
175 Ga0163161_10207168 3300017792 Bacteria 1513
176 Ga0197907_10982223 3300020069 Bacteria 1122
177 Ga0206349_1403162 3300020075 Bacteria 916
178 Ga0206350_10719707 3300020080 Bacteria 924
179 Ga0206354_10434256 3300020081 Bacteria 3169
180 Ga0206353_10055876 3300020082 Bacteria 2497
181 Ga0206353_10409269 3300020082 Bacteria 1833
182 Ga0206353_11590552 3300020082 Bacteria 3108
183 Ga0206353_11911907 3300020082 Bacteria 1060
184 Ga0154015_1708112 3300020610 Bacteria 1265
185 Ga0224712_10013909 3300022467 Bacteria 2577
186 Ga0224712_10015224 3300022467 Bacteria 2497
187 Ga0207692_10005771 3300025898 Bacteria 4983
188 Ga0207688_10007027 3300025901 Bacteria 6121
189 Ga0207647_10031355 3300025904 Bacteria 3421
190 Ga0207647_10048021 3300025904 Bacteria 2652
191 Ga0207647_10049211 3300025904 Bacteria 2615
192 Ga0207647_10071960 3300025904 Bacteria 2085
193 Ga0207699_10255066 3300025906 Bacteria 1210
194 Ga0207643_10162959 3300025908 Bacteria 1342
195 Ga0207705_10012173 3300025909 Bacteria 6217
196 Ga0207705_10018300 3300025909 Bacteria 5010
197 Ga0207705_10107744 3300025909 Bacteria 2056
198 Ga0207707_10000211 3300025912 Bacteria 62280
199 Ga0207707_10007133 3300025912 Bacteria 9732
200 Ga0207707_10008328 3300025912 Bacteria 8995
201 Ga0207695_10105209 3300025913 Bacteria 2810
202 Ga0207660_10000809 3300025917 Bacteria 20657
203 Ga0207660_10187772 3300025917 Bacteria 1608
204 Ga0207662_10192477 3300025918 Bacteria 1317
205 Ga0207657_10007599 3300025919 Bacteria 11097
206 Ga0207657_10031278 3300025919 Bacteria 4824
207 Ga0207657_10068677 3300025919 Bacteria 3010
208 Ga0207657_10146458 3300025919 Bacteria 1926
209 Ga0207657_10160724 3300025919 Bacteria 1825
210 Ga0207657_10180901 3300025919 Bacteria 1704
211 Ga0207657_10248623 3300025919 Bacteria 1418
212 Ga0207657_10302496 3300025919 Bacteria 1267
213 Ga0207657_10363899 3300025919 Bacteria 1140
214 Ga0207652_10000012 3300025921 Bacteria 235382
215 Ga0207652_10040934 3300025921 Bacteria 3937
216 Ga0207652_10075931 3300025921 Bacteria 2929
217 Ga0207652_10125912 3300025921 Bacteria 2282
218 Ga0207652_10148653 3300025921 Bacteria 2097
219 Ga0207652_10225637 3300025921 Bacteria 1688
220 Ga0207652_10595064 3300025921 Bacteria 992
221 Ga0207687_10014323 3300025927 Bacteria 5188
222 Ga0207687_10131458 3300025927 Bacteria 1887
223 Ga0207700_10948041 3300025928 Bacteria 770
224 Ga0207664_10047636 3300025929 Bacteria 3368
225 Ga0207664_10182444 3300025929 Bacteria 1803
226 Ga0207690_10000653 3300025932 Bacteria 22186
227 Ga0207690_10006668 3300025932 Bacteria 6842
228 Ga0207690_10031049 3300025932 Bacteria 3415
229 Ga0207690_10145590 3300025932 Bacteria 1751
230 Ga0207706_10058568 3300025933 Bacteria 3393
231 Ga0207706_10570627 3300025933 Bacteria 973
232 Ga0207686_10040739 3300025934 Bacteria 2826
233 Ga0207686_10275434 3300025934 Bacteria 1240
234 Ga0207711_10048933 3300025941 Bacteria 3618
235 Ga0207711_10071729 3300025941 Bacteria 3006
236 Ga0207689_10034288 3300025942 Bacteria 4216
237 Ga0207689_10111159 3300025942 Bacteria 2252
238 Ga0207661_10019211 3300025944 Bacteria 5090
239 Ga0207661_10056793 3300025944 Bacteria 3144
240 Ga0207661_10144561 3300025944 Bacteria 2050
241 Ga0207661_10227048 3300025944 Bacteria 1652
242 Ga0207661_10248493 3300025944 Bacteria 1580
243 Ga0207679_10309555 3300025945 Bacteria 1364
244 Ga0207679_10657524 3300025945 Bacteria 948
245 Ga0207667_10249891 3300025949 Bacteria 1814
246 Ga0207651_10113424 3300025960 Bacteria 2040
247 Ga0207640_10305402 3300025981 Bacteria 1260
248 Ga0207658_10492860 3300025986 Bacteria 1090
249 Ga0207658_10646292 3300025986 Bacteria 953
250 Ga0207677_10022061 3300026023 Bacteria 3905
251 Ga0207677_10138192 3300026023 Bacteria 1861
252 Ga0207703_10227862 3300026035 Bacteria 1669
253 Ga0207703_10335262 3300026035 Bacteria 1389
254 Ga0207678_10100243 3300026067 Bacteria 2474
255 Ga0207678_10262459 3300026067 Bacteria 1480
256 Ga0207702_10071142 3300026078 Bacteria 2994
257 Ga0207702_10112056 3300026078 Bacteria 2428
258 Ga0207702_10123488 3300026078 Bacteria 2321
259 Ga0207676_10015857 3300026095 Bacteria 5448
260 Ga0207676_10484458 3300026095 Bacteria 1172
261 Ga0207674_10031204 3300026116 Bacteria 5600
262 Ga0207674_10052078 3300026116 Bacteria 4175
263 Ga0207675_100027909 3300026118 Bacteria 5258
264 Ga0207675_100126097 3300026118 Bacteria 2425
265 Ga0207675_100214984 3300026118 Bacteria 1850
266 Ga0207683_10383286 3300026121 Bacteria 1292
267 Ga0207698_10604979 3300026142 Bacteria 1081
268 Ga0268266_10055142 3300028379 Bacteria 3416
269 Ga0268266_10170571 3300028379 Bacteria 1975
270 Ga0268265_10067790 3300028380 Bacteria 2764
271 Ga0268264_10110489 3300028381 Bacteria 2407
272 Ga0265338_10018246 3300028800 Bacteria 7517
273 Ga0316177_1148011 3300030731 Bacteria 2118
274 Ga0316176_1212495 3300030732 Bacteria 3475
275 Ga0314311_1118353 3300030733 Bacteria 8706
276 Ga0316182_1157798 3300030745 Bacteria 939
277 Ga0265320_10086211 3300031240 Bacteria 1460
278 Ga0265325_10001095 3300031241 Bacteria 19483
279 Ga0265340_10001753 3300031247 Bacteria 12421
280 Ga0265339_10008428 3300031249 Bacteria 6558
281 Ga0265316_10183694 3300031344 Bacteria 1556
282 Ga0265313_10062438 3300031595 Bacteria 1740
283 Ga0307508_10103616 3300031616 Bacteria 2442
284 Ga0265342_10052295 3300031712 Bacteria 2435
285 Ga0307413_10026116 3300031824 Bacteria 3214
286 Ga0307413_10148690 3300031824 Bacteria 1629
287 Ga0307413_10221403 3300031824 Bacteria 1383
288 Ga0307518_10194742 3300031838 Bacteria 1354
289 Ga0307410_10104667 3300031852 Bacteria 2035
290 Ga0307410_10183619 3300031852 Bacteria 1585
291 Ga0307406_10135846 3300031901 Bacteria 1733
292 Ga0307407_10024450 3300031903 Bacteria 3168
293 Ga0307412_10151902 3300031911 Bacteria 1710
294 Ga0307409_100113666 3300031995 Bacteria 2276
295 Ga0307409_100210856 3300031995 Bacteria 1746
296 Ga0307409_100606799 3300031995 Bacteria 1082
297 Ga0307409_100937322 3300031995 Bacteria 881
298 Ga0307416_100042351 3300032002 Bacteria 3554
299 Ga0307416_100230371 3300032002 Bacteria 1785
300 Ga0307414_10380419 3300032004 Bacteria 1220
301 Ga0307414_10563502 3300032004 Bacteria 1017
302 Ga0307414_10986902 3300032004 Bacteria 775
303 Ga0307411_10049485 3300032005 Bacteria 2731
304 Ga0307411_10100639 3300032005 Bacteria 2043
305 Ga0307411_10217552 3300032005 Bacteria 1480
306 Ga0307411_10340332 3300032005 Bacteria 1219
307 Ga0307415_100007954 3300032126 Bacteria 5841
308 Ga0307415_100109083 3300032126 Bacteria 2049
309 Ga0307415_100137591 3300032126 Bacteria 1860
310 Ga0307415_100165523 3300032126 Bacteria 1719
311 Ga0307415_100412449 3300032126 Bacteria 1156
312 Ga0316212_1000449 3300033547 Bacteria 5012
313 Ga0373931_0122330 3300035691 Bacteria 1489
314 Ga0372808_015066 3300036459 Bacteria 1105
315 Ga0373925_0000030 3300037068 Bacteria 146196
316 Ga0395900_0023706 3300037418 Bacteria 6279
317 Ga0395900_0038644 3300037418 Bacteria 4920
318 Ga0395900_0416670 3300037418 Bacteria 1305
319 Ga0395900_0606496 3300037418 Bacteria 1035
320 Ga0395900_0853637 3300037418 Bacteria 836
321 Ga0395898_0039593 3300037466 Bacteria 4664
322 Ga0395898_0049902 3300037466 Bacteria 4098
323 Ga0395898_0084914 3300037466 Bacteria 3052
324 Ga0395898_0198193 3300037466 Bacteria 1918
325 Ga0395901_0023355 3300038443 Bacteria 6337
326 Ga0395901_0074201 3300038443 Bacteria 3549
327 Ga0395901_0157248 3300038443 Bacteria 2387
328 Ga0395901_0329677 3300038443 Bacteria 1578
329 Ga0436365_1282228 3300039437 Bacteria 59682
330 Ga0436365_1377250 3300039437 Bacteria 2491
331 Ga0436362_0153049 3300039453 Bacteria 1458
332 Ga0451802_2137692 3300041460 Bacteria 1264
333 Ga0451853_3693024 3300041512 Bacteria 1711
334 Ga0439431_0010586 3300041997 Bacteria 2094
335 Ga0439445_0013152 3300042004 Bacteria 2001
336 Ga0450907_028689 3300042146 Bacteria 945
337 Ga0439446_0050302 3300042156 Bacteria 1243
338 Ga0439434_0004726 3300042435 Bacteria 3990
339 Ga0466969_0034744 3300044656 Bacteria 2553
340 Ga0466969_0110978 3300044656 Bacteria 1284
341 Ga0466972_0001090 3300044658 Bacteria 13020
342 Ga0466972_0109011 3300044658 Bacteria 1309
343 Ga0466972_0235333 3300044658 Bacteria 857
344 Ga0466965_0001948 3300044683 Bacteria 8622
345 Ga0466965_0006037 3300044683 Bacteria 5473
346 Ga0466965_0007075 3300044683 Bacteria 5135
347 Ga0466965_0010185 3300044683 Bacteria 4378
348 Ga0466965_0022208 3300044683 Bacteria 3059
349 Ga0466965_0062642 3300044683 Bacteria 1861
350 Ga0466966_0057655 3300044684 Bacteria 2455
351 Ga0466966_0083960 3300044684 Bacteria 1981
352 Ga0466966_0224233 3300044684 Bacteria 1134
353 Ga0466966_0246538 3300044684 Bacteria 1076
354 Ga0466966_0266982 3300044684 Bacteria 1030
355 Ga0466961_0007255 3300044693 Bacteria 7053
356 Ga0466961_0022688 3300044693 Bacteria 4037
357 Ga0466961_0060836 3300044693 Bacteria 2401
358 Ga0466961_0070852 3300044693 Bacteria 2213
359 Ga0466961_0070901 3300044693 Bacteria 2212
360 Ga0466963_0047474 3300044694 Bacteria 2834
361 Ga0466963_0053457 3300044694 Bacteria 2681
362 Ga0466963_0140765 3300044694 Bacteria 1671
363 Ga0466963_0221847 3300044694 Bacteria 1324
364 Ga0466963_0460483 3300044694 Bacteria 897
365 Ga0466963_0532438 3300044694 Bacteria 829
366 Ga0466964_0021785 3300044706 Bacteria 2480
367 Ga0466971_0006494 3300044719 Bacteria 5082
368 Ga0466968_0019035 3300044735 Bacteria 2759
369 Ga0466970_0011156 3300044765 Bacteria 4575
370 Ga0466970_0035893 3300044765 Bacteria 2625
371 Ga0466970_0078679 3300044765 Bacteria 1779
372 Ga0466970_0103946 3300044765 Bacteria 1548
373 Ga0466957_0004275 3300044842 Bacteria 7919
374 Ga0466957_0065013 3300044842 Bacteria 2245
375 Ga0466957_0067415 3300044842 Bacteria 2208
376 Ga0466957_0089302 3300044842 Bacteria 1929
377 Ga0466957_0210338 3300044842 Bacteria 1280
378 Ga0466960_0002897 3300044901 Bacteria 6520
379 Ga0466960_0005813 3300044901 Bacteria 4914
380 Ga0466960_0012418 3300044901 Bacteria 3593
381 Ga0466960_0016652 3300044901 Bacteria 3193
382 Ga0466960_0017323 3300044901 Bacteria 3140
383 Ga0466960_0023613 3300044901 Bacteria 2763
384 Ga0466960_0065720 3300044901 Bacteria 1792
385 Ga0466960_0118172 3300044901 Bacteria 1386
386 Ga0466960_0224900 3300044901 Bacteria 1034
387 Ga0466960_0361220 3300044901 Bacteria 830
388 Ga0466959_0140810 3300045049 Bacteria 1705
389 Ga0466959_0163462 3300045049 Bacteria 1564
390 Ga0466959_0480328 3300045049 Bacteria 841
391 Ga0466958_0004993 3300045836 Bacteria 7084
392 Ga0466958_0035040 3300045836 Bacteria 2997
393 Ga0466967_0031067 3300045976 Bacteria 4492
394 Ga0466967_0041221 3300045976 Bacteria 3979
395 Ga0466967_0066369 3300045976 Bacteria 3215
396 Ga0466967_0074937 3300045976 Bacteria 3041
397 Ga0466967_0074952 3300045976 Bacteria 3040
398 Ga0466967_0178184 3300045976 Bacteria 2003
399 Ga0466967_0213508 3300045976 Bacteria 1831
400 Ga0466967_0255334 3300045976 Bacteria 1676
401 Ga0466967_0440460 3300045976 Bacteria 1272
402 Ga0466967_0758135 3300045976 Bacteria 963
403 Ga0495592_0052888 3300046454 Bacteria 3013
404 Ga0495603_0021712 3300046455 Bacteria 3888
405 Ga0495629_0287235 3300046459 Bacteria 1128
406 Ga0495653_0043162 3300046463 Bacteria 3507
407 Ga0495662_0000289 3300046476 Bacteria 21710
408 Ga0495608_0001114 3300046511 Bacteria 19045
409 Ga0495628_0033616 3300046516 Bacteria 4130
410 Ga0495666_0000329 3300046526 Bacteria 20753
411 Ga0495665_0000377 3300046531 Bacteria 22495
412 Ga0495586_0012765 3300046535 Bacteria 4453
413 Ga0495587_0002610 3300046536 Bacteria 12038
414 Ga0495645_0027334 3300046543 Bacteria 4144
415 Ga0495634_0153693 3300046642 Bacteria 1453
416 Ga0495657_0015302 3300046675 Bacteria 5616
417 Ga0495599_0033790 3300046678 Bacteria 3214
418 Ga0495623_0029552 3300046679 Bacteria 3526
419 Ga0495658_0080854 3300046683 Bacteria 1907
420 Ga0495613_0000744 3300046689 Bacteria 25543
421 Ga0495581_0001219 3300047315 Bacteria 14166
422 Ga0495604_0000347 3300047317 Bacteria 41557
423 Ga0495604_0255610 3300047317 Bacteria 1193
424 Ga0495674_0035910 3300047319 Bacteria 4467
425 Ga0495676_0124607 3300047321 Bacteria 1869
426 Ga0495593_0015036 3300047673 Bacteria 4396
427 Ga0495602_0072967 3300048088 Bacteria 2923
428 Ga0496100_0080431 3300048903 Bacteria 2199
429 Ga0496100_0114292 3300048903 Bacteria 1880
430 Ga0496100_0128069 3300048903 Bacteria 1784
431 Ga0496100_0174488 3300048903 Bacteria 1551
432 Ga0496100_0209586 3300048903 Bacteria 1425
433 Ga0496101_0103349 3300048904 Bacteria 2135
434 Ga0496101_0180743 3300048904 Bacteria 1624
435 Ga0496102_0006295 3300048905 Bacteria 10117
436 Ga0496102_0014458 3300048905 Bacteria 6858
437 Ga0496102_0184218 3300048905 Bacteria 1967
438 Ga0496103_0032232 3300048906 Bacteria 3197
439 Ga0496103_0068673 3300048906 Bacteria 2215
440 Ga0496103_0144126 3300048906 Bacteria 1524
441 Ga0496104_0001924 3300048907 Bacteria 17991
442 Ga0496104_0134786 3300048907 Bacteria 2372
443 Ga0496105_0007521 3300048908 Bacteria 8439
444 Ga0496105_0060728 3300048908 Bacteria 3119
445 Ga0496106_0020238 3300048909 Bacteria 4937
446 Ga0496106_0034968 3300048909 Bacteria 3755
447 Ga0496106_0492239 3300048909 Bacteria 985
448 Ga0496107_0112877 3300048910 Bacteria 1998
449 Ga0496107_0188630 3300048910 Bacteria 1531
450 Ga0496107_0217182 3300048910 Bacteria 1422
451 Ga0496108_0000227 3300048911 Bacteria 50319
452 Ga0496108_0032464 3300048911 Bacteria 4337
453 Ga0496108_0088531 3300048911 Bacteria 2631
454 Ga0496108_0089619 3300048911 Bacteria 2614
455 Ga0496108_0101999 3300048911 Bacteria 2448
456 Ga0496108_0266843 3300048911 Bacteria 1490
457 Ga0496109_0023477 3300048912 Bacteria 5476
458 Ga0496109_0027527 3300048912 Bacteria 5077
459 Ga0496109_0049181 3300048912 Bacteria 3837
460 Ga0496109_0065819 3300048912 Bacteria 3318
461 Ga0496109_0139099 3300048912 Bacteria 2270
462 Ga0496109_0209018 3300048912 Bacteria 1835
463 Ga0496109_0741684 3300048912 Bacteria 920
464 Ga0496109_0848077 3300048912 Bacteria 851
465 Ga0496110_0003710 3300048913 Bacteria 11756
466 Ga0496110_0041823 3300048913 Bacteria 4000
467 Ga0496110_0341964 3300048913 Bacteria 1363
468 Ga0496110_0445227 3300048913 Bacteria 1181
469 Ga0496111_0004923 3300048914 Bacteria 8480
470 Ga0496111_0037687 3300048914 Bacteria 3461
471 Ga0496111_0115693 3300048914 Bacteria 1977
472 Ga0496111_0270310 3300048914 Bacteria 1261
473 Ga0496111_0698947 3300048914 Bacteria 738
474 Ga0496112_0029124 3300048915 Bacteria 5337
475 Ga0496112_0120727 3300048915 Bacteria 2591
476 Ga0496113_0003599 3300048916 Bacteria 9308
477 Ga0496113_0089055 3300048916 Bacteria 2375
478 Ga0496113_0126117 3300048916 Bacteria 2005
479 Ga0496113_0214002 3300048916 Bacteria 1535
480 Ga0496113_0430143 3300048916 Bacteria 1060
481 Ga0496114_0076537 3300048917 Bacteria 2819
482 Ga0496114_0139297 3300048917 Bacteria 2099
483 Ga0496114_0245435 3300048917 Bacteria 1575
484 Ga0496114_0703587 3300048917 Bacteria 886
485 Ga0496115_0010119 3300048918 Bacteria 7035
486 Ga0496115_0030337 3300048918 Bacteria 4253
487 Ga0496115_0121961 3300048918 Bacteria 2145
488 Ga0496126_0744792 3300048929 Bacteria 757
489 Ga0501031_0001642 3300049568 Bacteria 14030
490 Ga0501031_0003141 3300049568 Bacteria 10590
491 Ga0501031_0162363 3300049568 Bacteria 1460
492 Ga0501031_0267563 3300049568 Bacteria 1110
493 Ga0501031_0322285 3300049568 Bacteria 1001
494 Ga0501032_0012114 3300049569 Bacteria 6173
495 Ga0501032_0014543 3300049569 Bacteria 5573
496 Ga0501032_0070429 3300049569 Bacteria 2332
497 Ga0501032_0267342 3300049569 Bacteria 1108
498 Ga0501033_0003639 3300049570 Bacteria 12567
499 Ga0501033_0154189 3300049570 Bacteria 1656
500 Ga0501034_0026751 3300049571 Bacteria 5870
501 Ga0501034_0107003 3300049571 Bacteria 2789
502 Ga0501036_0000932 3300049572 Bacteria 21959
503 Ga0501036_0004317 3300049572 Bacteria 11475
504 Ga0501036_0060606 3300049572 Bacteria 3206
505 Ga0501036_0302194 3300049572 Bacteria 1338
506 Ga0501036_0720140 3300049572 Bacteria 824
507 Ga0501037_0002300 3300049573 Bacteria 13788
508 Ga0501037_0030277 3300049573 Bacteria 4000
509 Ga0501037_0030829 3300049573 Bacteria 3961
510 Ga0501038_0004110 3300049574 Bacteria 13537
511 Ga0501038_0011972 3300049574 Bacteria 7919
512 Ga0501038_0012988 3300049574 Bacteria 7597
513 Ga0501038_0344028 3300049574 Bacteria 1163
514 Ga0501039_0007533 3300049575 Bacteria 8317
515 Ga0501039_0029897 3300049575 Bacteria 4198
516 Ga0501039_0037859 3300049575 Bacteria 3725
517 Ga0501040_0024598 3300049576 Bacteria 4042
518 Ga0501041_0099911 3300049577 Bacteria 1795
519 Ga0501041_0103081 3300049577 Bacteria 1767
520 Ga0501042_0001323 3300049578 Bacteria 14449
521 Ga0501042_0002629 3300049578 Bacteria 11040
522 Ga0501042_0041575 3300049578 Bacteria 3270
523 Ga0501042_0051222 3300049578 Bacteria 2945
524 Ga0501042_0201195 3300049578 Bacteria 1436
525 Ga0501043_0062181 3300049579 Bacteria 2932
526 Ga0501043_0200180 3300049579 Bacteria 1550
527 Ga0501046_0005262 3300049580 Bacteria 11571
528 Ga0501046_0061187 3300049580 Bacteria 2945
529 Ga0501046_0288367 3300049580 Bacteria 1201
530 Ga0501046_0301713 3300049580 Bacteria 1169
531 Ga0501048_0008995 3300049582 Bacteria 7518
532 Ga0501048_0033168 3300049582 Bacteria 3731
533 Ga0501048_0073524 3300049582 Bacteria 2413
534 Ga0501048_0191883 3300049582 Bacteria 1448
535 Ga0501048_0228835 3300049582 Bacteria 1319
536 Ga0501067_0001156 3300049583 Bacteria 14320
537 Ga0501067_0003684 3300049583 Bacteria 8445
538 Ga0501067_0008552 3300049583 Bacteria 5678
539 Ga0501067_0018247 3300049583 Bacteria 3886
540 Ga0501067_0075370 3300049583 Bacteria 1869
541 Ga0501068_0008355 3300049584 Bacteria 5757
542 Ga0501068_0097491 3300049584 Bacteria 1819
543 Ga0501068_0280738 3300049584 Bacteria 1064
544 Ga0501069_0130397 3300049585 Bacteria 1439
545 Ga0501069_0132989 3300049585 Bacteria 1425
546 Ga0501069_0138845 3300049585 Bacteria 1394
547 Ga0501069_0173059 3300049585 Bacteria 1246
548 Ga0501069_0278516 3300049585 Bacteria 978
549 Ga0501070_0000763 3300049586 Bacteria 29376
550 Ga0501070_0004751 3300049586 Bacteria 11624
551 Ga0501070_0005416 3300049586 Bacteria 10892
552 Ga0501070_0005419 3300049586 Bacteria 10889
553 Ga0501070_0017696 3300049586 Bacteria 5984
554 Ga0501070_0076120 3300049586 Bacteria 2778
555 Ga0501070_0208302 3300049586 Bacteria 1605
556 Ga0501070_0353258 3300049586 Bacteria 1193
557 Ga0501070_0484709 3300049586 Bacteria 994
558 Ga0501071_0007691 3300049587 Bacteria 7100
559 Ga0501071_0020391 3300049587 Bacteria 4605
560 Ga0501071_0156666 3300049587 Bacteria 1701
561 Ga0501071_0557428 3300049587 Bacteria 880
562 Ga0501072_0128682 3300049588 Bacteria 2018
563 Ga0501072_0229210 3300049588 Bacteria 1480
564 Ga0501073_0005322 3300049589 Bacteria 9649
565 Ga0501073_0009274 3300049589 Bacteria 7260
566 Ga0501073_0134031 3300049589 Bacteria 1717
567 Ga0501074_0002479 3300049590 Bacteria 12871
568 Ga0501074_0003018 3300049590 Bacteria 11855
569 Ga0501074_0026779 3300049590 Bacteria 4181
570 Ga0501074_0101011 3300049590 Bacteria 2064
571 Ga0501075_0028331 3300049591 Bacteria 4134
572 Ga0501075_0097105 3300049591 Bacteria 2236
573 Ga0501076_0064642 3300049592 Bacteria 2916
574 Ga0501077_0014762 3300049593 Bacteria 4908
575 Ga0501077_0034432 3300049593 Bacteria 3224
576 Ga0501079_0005516 3300049741 Bacteria 9431
577 Ga0501079_0043657 3300049741 Bacteria 3461
578 Ga0501079_0229428 3300049741 Bacteria 1450
579 Ga0501079_0298162 3300049741 Bacteria 1261
580 Ga0501080_0010354 3300049742 Bacteria 8529
581 Ga0501080_0010624 3300049742 Bacteria 8429
582 Ga0501080_0050874 3300049742 Bacteria 3855
583 Ga0501080_0076216 3300049742 Bacteria 3119
584 Ga0501080_0094623 3300049742 Bacteria 2774
585 Ga0501080_0199249 3300049742 Bacteria 1838
586 Ga0501080_0244558 3300049742 Bacteria 1637
587 Ga0501083_0018059 3300049744 Bacteria 4917
588 Ga0501035_0001668 3300049822 Bacteria 22446
589 Ga0501035_0063042 3300049822 Bacteria 3297
590 Ga0501035_0096207 3300049822 Bacteria 2602
591 Ga0501035_0160154 3300049822 Bacteria 1949
592 Ga0501035_0541003 3300049822 Bacteria 955
593 Ga0501044_0002171 3300049823 Bacteria 22494
594 Ga0501044_0009429 3300049823 Bacteria 10631
595 Ga0501044_0155604 3300049823 Bacteria 2265
596 Ga0501044_0473395 3300049823 Bacteria 1156
597 Ga0501045_0092732 3300049824 Bacteria 2234
598 nmdc:mga03683_23682_c1 3300050489 Bacteria 2395
599 nmdc:mga03n38_12897_c1 3300050490 Bacteria 3161
600 nmdc:mga00v17_31733_c1 3300050491 Bacteria 3118
601 nmdc:mga0yw44_127858_c1 3300050492 Bacteria 1642
602 nmdc:mga0yw44_139386_c1 3300050492 Bacteria 1575
603 nmdc:mga0yw44_1894_c1 3300050492 Bacteria 8620
604 nmdc:mga0yw44_23850_c1 3300050492 Bacteria 3453
605 nmdc:mga0yw44_61778_c1 3300050492 Bacteria 2300
606 nmdc:mga0yw44_71738_c1 3300050492 Bacteria 2151
607 nmdc:mga06z11_269058_c1 3300050494 Bacteria 1007
608 nmdc:mga06z11_337056_c1 3300050494 Bacteria 901
609 nmdc:mga06z11_7898_c1 3300050494 Bacteria 4406
610 nmdc:mga07m45_8437_c2 3300050496 Bacteria 3519
611 nmdc:mga05p37_709569_c1 3300050507 Bacteria 1116
612 nmdc:mga05p37_87169_c1 3300050507 Bacteria 3848
613 nmdc:mga09592_16977_c1 3300050508 Bacteria 5956
614 nmdc:mga0sz30_16826_c1 3300050516 Bacteria 2602
615 Ga0495601_0046982 3300053077 Bacteria 2717
616 Ga0495595_0187985 3300053084 Bacteria 1026
617 Ga0495619_0057853 3300053085 Bacteria 2573
618 Ga0495619_0109213 3300053085 Bacteria 1889
619 Ga0500644_0000129 3300053088 Bacteria 46233
620 Ga0500646_0000186 3300053090 Bacteria 18701
621 Ga0500583_0003883 3300053092 Bacteria 4789
622 Ga0500556_0000724 3300053104 Bacteria 19897
623 Ga0500593_000276 3300053117 Bacteria 20922
624 Ga0500573_0015555 3300053140 Bacteria 4315
625 Ga0501084_0033760 3300054114 Bacteria 4280
626 Ga0501084_0501073 3300054114 Bacteria 1026
627 Ga0501082_0080821 3300060353 Bacteria 2805
628 Ga0501082_0212468 3300060353 Bacteria 1683
629 Ga0501082_0302485 3300060353 Bacteria 1393
630 Ga0466962_0052203 3300061719 Bacteria 1954
631 Ga0466962_0255826 3300061719 Bacteria 861
632 Ga0530510_0029040 3300061734 Bacteria 3968
633 Ga0530510_0375196 3300061734 Bacteria 1070
634 2643891637 2643221576 Bacteria 5214352
635 2643960685 2643221590 Bacteria 5214697
636 2644035800 2643221604 Bacteria 5014917
637 2644093898 2643221615 Bacteria 5487866
638 2644102305 2643221617 Bacteria 5139111
639 2644115529 2643221620 Bacteria 5134593
640 2644229287 2643221641 Bacteria 4490190
641 2644323742 2643221657 Bacteria 5490246
642 2738868089 2738541305 Bacteria 4910150
643 2740169506 2739367898 Bacteria 4367674
644 2812333181 2811994874 Bacteria 5367947
645 2855386911 2855386786 Bacteria 4752232
646 2857484664 2857481737 Bacteria 4761446
647 2915364553 2915358134 Bacteria 6050864
648 2984580305 2984576629 Bacteria 4248407
649 2990259155 2990256926 Bacteria 4252839
650 8054612818 8054609563 Bacteria 5170090
651 Ga0105245_10573415
652 LJQas_1000412
653 JGI24740J21852_10017099
654 JGI24735J21928_10022661
655 JGI24735J21928_10028744
656 JGI25406J46586_10084803
657 rootL2_10117377
658 Ga0070658_10165353
659 Ga0070658_10302533
660 Ga0070658_10467988
661 Ga0070683_100014266
662 Ga0070683_100021520
663 Ga0070683_100029029
664 Ga0070683_100098007
665 Ga0070683_100226006
666 Ga0070670_100162956
667 Ga0068869_100128075
668 Ga0068869_100302461
669 Ga0070680_100000461
670 Ga0070680_100102926
671 Ga0070680_100320293
672 Ga0070682_100005770
673 Ga0070682_100074894
674 Ga0068868_100039847
675 Ga0068868_100173268
676 Ga0068868_100424554
677 Ga0070660_100008169
678 Ga0070660_100064295
679 Ga0070660_100064904
680 Ga0070660_100069805
681 Ga0070660_100190787
682 Ga0070660_100332300
683 Ga0070691_10116749
684 Ga0070687_100159063
685 Ga0070692_10009398
686 Ga0070668_100117634
687 Ga0070669_100231582
688 Ga0070675_100228645
689 Ga0070675_100318766
690 Ga0070659_100000127
691 Ga0070659_100005038
692 Ga0070659_100046347
693 Ga0070659_100082916
694 Ga0070659_100091089
695 Ga0070709_10136426
696 Ga0070714_100058075
697 Ga0070713_100053292
698 Ga0070710_10001862
699 Ga0070694_100057184
700 Ga0070663_100176541
701 Ga0070663_100251008
702 Ga0070678_100399370
703 Ga0070662_100056979
704 Ga0070681_10000013
705 Ga0070681_10009958
706 Ga0070681_10041695
707 Ga0070698_100008451
708 Ga0070679_100000006
709 Ga0070679_100032172
710 Ga0070679_100036108
711 Ga0070679_100057022
712 Ga0070679_100118692
713 Ga0070679_100198363
714 Ga0070679_100219262
715 Ga0070679_100316244
716 Ga0070684_100010611
717 Ga0070684_100017579
718 Ga0070684_100026802
719 Ga0070684_100051353
720 Ga0070684_100425670
721 Ga0070684_100599635
722 Ga0070686_100212732
723 Ga0070686_100234364
724 Ga0070665_100000863
725 Ga0068855_100041832
726 Ga0068855_100125890
727 Ga0068855_100659518
728 Ga0070664_100151469
729 Ga0068857_100020341
730 Ga0068857_100041933
731 Ga0068857_100734613
732 Ga0068854_100620527
733 Ga0068856_100139969
734 Ga0068856_100167619
735 Ga0068852_100043863
736 Ga0068864_100052792
737 Ga0068864_100910664
738 Ga0068861_100206038
739 Ga0068861_100301802
740 Ga0068870_10203364
741 Ga0068863_100002158
742 Ga0068858_100243273
743 Ga0068860_100153849
744 Ga0081539_10057626
745 Ga0081539_10073121
746 Ga0075365_10002441
747 Ga0075365_10004436
748 Ga0075365_10074775
749 Ga0075365_10175250
750 Ga0075365_10239045
751 Ga0075363_100013028
752 Ga0075363_100055393
753 Ga0075363_100163560
754 Ga0075364_10005225
755 Ga0075364_10073713
756 Ga0075367_10034317
757 Ga0075367_10165542
758 Ga0075367_10228257
759 Ga0075367_10379562
760 Ga0075369_10025803
761 Ga0097621_100692163
762 Ga0075370_10007612
763 Ga0075428_100040450
764 Ga0075431_100024377
765 Ga0105240_10053118
766 Ga0111539_10352329
767 Ga0105245_10031866
768 Ga0114129_10136326
769 Ga0105243_10168209
770 Ga0105243_10198052
771 Ga0105243_10333262
772 Ga0105243_10601174
773 Ga0105242_10020637
774 Ga0105242_10062802
775 Ga0105242_10198154
776 Ga0105242_10425258
777 Ga0105248_10048253
778 Ga0105248_10455762
779 Ga0105248_10876674
780 Ga0105237_10140489
781 Ga0105238_10057186
782 Ga0105249_10204512
783 Ga0105239_10007799
784 Ga0105239_10035882
785 Ga0105239_10283359
786 Ga0105246_10002293
787 Ga0105246_10219789
788 Ga0157371_10012474
789 Ga0157370_10038213
790 Ga0157370_10194917
791 Ga0157369_10006587
792 Ga0157369_10007928
793 Ga0157369_10044516
794 Ga0157369_10056150
795 Ga0157369_10078869
796 Ga0157369_10205818
797 Ga0157369_10214595
798 Ga0157369_10385976
799 Ga0157369_10412109
800 Ga0157369_11058315
801 Ga0157374_10798145
802 Ga0163162_10017211
803 Ga0163162_10143265
804 Ga0157372_10001640
805 Ga0157372_10836405
806 Ga0157372_11101928
807 Ga0157372_11528749
808 Ga0157375_10003295
809 Ga0157375_10110865
810 Ga0157375_10161005
811 Ga0157375_10163570
812 Ga0157375_10208579
813 Ga0157375_11026832
814 Ga0163163_10204811
815 Ga0163163_10273003
816 Ga0163163_10274931
817 Ga0157380_10273653
818 Ga0182008_10014550
819 Ga0157379_10078826
820 Ga0157379_10224056
821 Ga0157379_10254618
822 Ga0157379_10409312
823 Ga0157376_10143530
824 Ga0157376_11184282
825 Ga0163161_10207168
826 Ga0197907_10982223
827 Ga0206349_1403162
828 Ga0206350_10719707
829 Ga0206354_10434256
830 Ga0206353_10055876
831 Ga0206353_10409269
832 Ga0206353_11590552
833 Ga0206353_11911907
834 Ga0154015_1708112
835 Ga0224712_10013909
836 Ga0224712_10015224
837 Ga0207692_10005771
838 Ga0207688_10007027
839 Ga0207647_10031355
840 Ga0207647_10048021
841 Ga0207647_10049211
842 Ga0207647_10071960
843 Ga0207699_10255066
844 Ga0207643_10162959
845 Ga0207705_10012173
846 Ga0207705_10018300
847 Ga0207705_10107744
848 Ga0207707_10000211
849 Ga0207707_10007133
850 Ga0207707_10008328
851 Ga0207695_10105209
852 Ga0207660_10000809
853 Ga0207660_10187772
854 Ga0207662_10192477
855 Ga0207657_10007599
856 Ga0207657_10031278
857 Ga0207657_10068677
858 Ga0207657_10146458
859 Ga0207657_10160724
860 Ga0207657_10180901
861 Ga0207657_10248623
862 Ga0207657_10302496
863 Ga0207657_10363899
864 Ga0207652_10000012
865 Ga0207652_10040934
866 Ga0207652_10075931
867 Ga0207652_10125912
868 Ga0207652_10148653
869 Ga0207652_10225637
870 Ga0207652_10595064
871 Ga0207687_10014323
872 Ga0207687_10131458
873 Ga0207700_10948041
874 Ga0207664_10047636
875 Ga0207664_10182444
876 Ga0207690_10000653
877 Ga0207690_10006668
878 Ga0207690_10031049
879 Ga0207690_10145590
880 Ga0207706_10058568
881 Ga0207706_10570627
882 Ga0207686_10040739
883 Ga0207686_10275434
884 Ga0207711_10048933
885 Ga0207711_10071729
886 Ga0207689_10034288
887 Ga0207689_10111159
888 Ga0207661_10019211
889 Ga0207661_10056793
890 Ga0207661_10144561
891 Ga0207661_10227048
892 Ga0207661_10248493
893 Ga0207679_10309555
894 Ga0207679_10657524
895 Ga0207667_10249891
896 Ga0207651_10113424
897 Ga0207640_10305402
898 Ga0207658_10492860
899 Ga0207658_10646292
900 Ga0207677_10022061
901 Ga0207677_10138192
902 Ga0207703_10227862
903 Ga0207703_10335262
904 Ga0207678_10100243
905 Ga0207678_10262459
906 Ga0207702_10071142
907 Ga0207702_10112056
908 Ga0207702_10123488
909 Ga0207676_10015857
910 Ga0207676_10484458
911 Ga0207674_10031204
912 Ga0207674_10052078
913 Ga0207675_100027909
914 Ga0207675_100126097
915 Ga0207675_100214984
916 Ga0207683_10383286
917 Ga0207698_10604979
918 Ga0268266_10055142
919 Ga0268266_10170571
920 Ga0268265_10067790
921 Ga0268264_10110489
922 Ga0265338_10018246
923 Ga0316177_1148011
924 Ga0316176_1212495
925 Ga0314311_1118353
926 Ga0316182_1157798
927 Ga0265320_10086211
928 Ga0265325_10001095
929 Ga0265340_10001753
930 Ga0265339_10008428
931 Ga0265316_10183694
932 Ga0265313_10062438
933 Ga0307508_10103616
934 Ga0265342_10052295
935 Ga0307413_10026116
936 Ga0307413_10148690
937 Ga0307413_10221403
938 Ga0307518_10194742
939 Ga0307410_10104667
940 Ga0307410_10183619
941 Ga0307406_10135846
942 Ga0307407_10024450
943 Ga0307412_10151902
944 Ga0307409_100113666
945 Ga0307409_100210856
946 Ga0307409_100606799
947 Ga0307409_100937322
948 Ga0307416_100042351
949 Ga0307416_100230371
950 Ga0307414_10380419
951 Ga0307414_10563502
952 Ga0307414_10986902
953 Ga0307411_10049485
954 Ga0307411_10100639
955 Ga0307411_10217552
956 Ga0307411_10340332
957 Ga0307415_100007954
958 Ga0307415_100109083
959 Ga0307415_100137591
960 Ga0307415_100165523
961 Ga0307415_100412449
962 Ga0316212_1000449
963 Ga0373931_0122330
964 Ga0372808_015066
965 Ga0373925_0000030
966 Ga0395900_0023706
967 Ga0395900_0038644
968 Ga0395900_0416670
969 Ga0395900_0606496
970 Ga0395900_0853637
971 Ga0395898_0039593
972 Ga0395898_0049902
973 Ga0395898_0084914
974 Ga0395898_0198193
975 Ga0395901_0023355
976 Ga0395901_0074201
977 Ga0395901_0157248
978 Ga0395901_0329677
979 Ga0436365_1282228
980 Ga0436365_1377250
981 Ga0436362_0153049
982 Ga0451802_2137692
983 Ga0451853_3693024
984 Ga0439431_0010586
985 Ga0439445_0013152
986 Ga0450907_028689
987 Ga0439446_0050302
988 Ga0439434_0004726
989 Ga0466969_0034744
990 Ga0466969_0110978
991 Ga0466972_0001090
992 Ga0466972_0109011
993 Ga0466972_0235333
994 Ga0466965_0001948
995 Ga0466965_0006037
996 Ga0466965_0007075
997 Ga0466965_0010185
998 Ga0466965_0022208
999 Ga0466965_0062642
1000 Ga0466966_0057655
1001 Ga0466966_0083960
1002 Ga0466966_0224233
1003 Ga0466966_0246538
1004 Ga0466966_0266982
1005 Ga0466961_0007255
1006 Ga0466961_0022688
1007 Ga0466961_0060836
1008 Ga0466961_0070852
1009 Ga0466961_0070901
1010 Ga0466963_0047474
1011 Ga0466963_0053457
1012 Ga0466963_0140765
1013 Ga0466963_0221847
1014 Ga0466963_0460483
1015 Ga0466963_0532438
1016 Ga0466964_0021785
1017 Ga0466971_0006494
1018 Ga0466968_0019035
1019 Ga0466970_0011156
1020 Ga0466970_0035893
1021 Ga0466970_0078679
1022 Ga0466970_0103946
1023 Ga0466957_0004275
1024 Ga0466957_0065013
1025 Ga0466957_0067415
1026 Ga0466957_0089302
1027 Ga0466957_0210338
1028 Ga0466960_0002897
1029 Ga0466960_0005813
1030 Ga0466960_0012418
1031 Ga0466960_0016652
1032 Ga0466960_0017323
1033 Ga0466960_0023613
1034 Ga0466960_0065720
1035 Ga0466960_0118172
1036 Ga0466960_0224900
1037 Ga0466960_0361220
1038 Ga0466959_0140810
1039 Ga0466959_0163462
1040 Ga0466959_0480328
1041 Ga0466958_0004993
1042 Ga0466958_0035040
1043 Ga0466967_0031067
1044 Ga0466967_0041221
1045 Ga0466967_0066369
1046 Ga0466967_0074937
1047 Ga0466967_0074952
1048 Ga0466967_0178184
1049 Ga0466967_0213508
1050 Ga0466967_0255334
1051 Ga0466967_0440460
1052 Ga0466967_0758135
1053 Ga0495592_0052888
1054 Ga0495603_0021712
1055 Ga0495629_0287235
1056 Ga0495653_0043162
1057 Ga0495662_0000289
1058 Ga0495608_0001114
1059 Ga0495628_0033616
1060 Ga0495666_0000329
1061 Ga0495665_0000377
1062 Ga0495586_0012765
1063 Ga0495587_0002610
1064 Ga0495645_0027334
1065 Ga0495634_0153693
1066 Ga0495657_0015302
1067 Ga0495599_0033790
1068 Ga0495623_0029552
1069 Ga0495658_0080854
1070 Ga0495613_0000744
1071 Ga0495581_0001219
1072 Ga0495604_0000347
1073 Ga0495604_0255610
1074 Ga0495674_0035910
1075 Ga0495676_0124607
1076 Ga0495593_0015036
1077 Ga0495602_0072967
1078 Ga0496100_0080431
1079 Ga0496100_0114292
1080 Ga0496100_0128069
1081 Ga0496100_0174488
1082 Ga0496100_0209586
1083 Ga0496101_0103349
1084 Ga0496101_0180743
1085 Ga0496102_0006295
1086 Ga0496102_0014458
1087 Ga0496102_0184218
1088 Ga0496103_0032232
1089 Ga0496103_0068673
1090 Ga0496103_0144126
1091 Ga0496104_0001924
1092 Ga0496104_0134786
1093 Ga0496105_0007521
1094 Ga0496105_0060728
1095 Ga0496106_0020238
1096 Ga0496106_0034968
1097 Ga0496106_0492239
1098 Ga0496107_0112877
1099 Ga0496107_0188630
1100 Ga0496107_0217182
1101 Ga0496108_0000227
1102 Ga0496108_0032464
1103 Ga0496108_0088531
1104 Ga0496108_0089619
1105 Ga0496108_0101999
1106 Ga0496108_0266843
1107 Ga0496109_0023477
1108 Ga0496109_0027527
1109 Ga0496109_0049181
1110 Ga0496109_0065819
1111 Ga0496109_0139099
1112 Ga0496109_0209018
1113 Ga0496109_0741684
1114 Ga0496109_0848077
1115 Ga0496110_0003710
1116 Ga0496110_0041823
1117 Ga0496110_0341964
1118 Ga0496110_0445227
1119 Ga0496111_0004923
1120 Ga0496111_0037687
1121 Ga0496111_0115693
1122 Ga0496111_0270310
1123 Ga0496111_0698947
1124 Ga0496112_0029124
1125 Ga0496112_0120727
1126 Ga0496113_0003599
1127 Ga0496113_0089055
1128 Ga0496113_0126117
1129 Ga0496113_0214002
1130 Ga0496113_0430143
1131 Ga0496114_0076537
1132 Ga0496114_0139297
1133 Ga0496114_0245435
1134 Ga0496114_0703587
1135 Ga0496115_0010119
1136 Ga0496115_0030337
1137 Ga0496115_0121961
1138 Ga0496126_0744792
1139 Ga0501031_0001642
1140 Ga0501031_0003141
1141 Ga0501031_0162363
1142 Ga0501031_0267563
1143 Ga0501031_0322285
1144 Ga0501032_0012114
1145 Ga0501032_0014543
1146 Ga0501032_0070429
1147 Ga0501032_0267342
1148 Ga0501033_0003639
1149 Ga0501033_0154189
1150 Ga0501034_0026751
1151 Ga0501034_0107003
1152 Ga0501036_0000932
1153 Ga0501036_0004317
1154 Ga0501036_0060606
1155 Ga0501036_0302194
1156 Ga0501036_0720140
1157 Ga0501037_0002300
1158 Ga0501037_0030277
1159 Ga0501037_0030829
1160 Ga0501038_0004110
1161 Ga0501038_0011972
1162 Ga0501038_0012988
1163 Ga0501038_0344028
1164 Ga0501039_0007533
1165 Ga0501039_0029897
1166 Ga0501039_0037859
1167 Ga0501040_0024598
1168 Ga0501041_0099911
1169 Ga0501041_0103081
1170 Ga0501042_0001323
1171 Ga0501042_0002629
1172 Ga0501042_0041575
1173 Ga0501042_0051222
1174 Ga0501042_0201195
1175 Ga0501043_0062181
1176 Ga0501043_0200180
1177 Ga0501046_0005262
1178 Ga0501046_0061187
1179 Ga0501046_0288367
1180 Ga0501046_0301713
1181 Ga0501048_0008995
1182 Ga0501048_0033168
1183 Ga0501048_0073524
1184 Ga0501048_0191883
1185 Ga0501048_0228835
1186 Ga0501067_0001156
1187 Ga0501067_0003684
1188 Ga0501067_0008552
1189 Ga0501067_0018247
1190 Ga0501067_0075370
1191 Ga0501068_0008355
1192 Ga0501068_0097491
1193 Ga0501068_0280738
1194 Ga0501069_0130397
1195 Ga0501069_0132989
1196 Ga0501069_0138845
1197 Ga0501069_0173059
1198 Ga0501069_0278516
1199 Ga0501070_0000763
1200 Ga0501070_0004751
1201 Ga0501070_0005416
1202 Ga0501070_0005419
1203 Ga0501070_0017696
1204 Ga0501070_0076120
1205 Ga0501070_0208302
1206 Ga0501070_0353258
1207 Ga0501070_0484709
1208 Ga0501071_0007691
1209 Ga0501071_0020391
1210 Ga0501071_0156666
1211 Ga0501071_0557428
1212 Ga0501072_0128682
1213 Ga0501072_0229210
1214 Ga0501073_0005322
1215 Ga0501073_0009274
1216 Ga0501073_0134031
1217 Ga0501074_0002479
1218 Ga0501074_0003018
1219 Ga0501074_0026779
1220 Ga0501074_0101011
1221 Ga0501075_0028331
1222 Ga0501075_0097105
1223 Ga0501076_0064642
1224 Ga0501077_0014762
1225 Ga0501077_0034432
1226 Ga0501079_0005516
1227 Ga0501079_0043657
1228 Ga0501079_0229428
1229 Ga0501079_0298162
1230 Ga0501080_0010354
1231 Ga0501080_0010624
1232 Ga0501080_0050874
1233 Ga0501080_0076216
1234 Ga0501080_0094623
1235 Ga0501080_0199249
1236 Ga0501080_0244558
1237 Ga0501083_0018059
1238 Ga0501035_0001668
1239 Ga0501035_0063042
1240 Ga0501035_0096207
1241 Ga0501035_0160154
1242 Ga0501035_0541003
1243 Ga0501044_0002171
1244 Ga0501044_0009429
1245 Ga0501044_0155604
1246 Ga0501044_0473395
1247 Ga0501045_0092732
1248 nmdc:mga03683_23682_c1
1249 nmdc:mga03n38_12897_c1
1250 nmdc:mga00v17_31733_c1
1251 nmdc:mga0yw44_127858_c1
1252 nmdc:mga0yw44_139386_c1
1253 nmdc:mga0yw44_1894_c1
1254 nmdc:mga0yw44_23850_c1
1255 nmdc:mga0yw44_61778_c1
1256 nmdc:mga0yw44_71738_c1
1257 nmdc:mga06z11_269058_c1
1258 nmdc:mga06z11_337056_c1
1259 nmdc:mga06z11_7898_c1
1260 nmdc:mga07m45_8437_c2
1261 nmdc:mga05p37_709569_c1
1262 nmdc:mga05p37_87169_c1
1263 nmdc:mga09592_16977_c1
1264 nmdc:mga0sz30_16826_c1
1265 Ga0495601_0046982
1266 Ga0495595_0187985
1267 Ga0495619_0057853
1268 Ga0495619_0109213
1269 Ga0500644_0000129
1270 Ga0500646_0000186
1271 Ga0500583_0003883
1272 Ga0500556_0000724
1273 Ga0500593_000276
1274 Ga0500573_0015555
1275 Ga0501084_0033760
1276 Ga0501084_0501073
1277 Ga0501082_0080821
1278 Ga0501082_0212468
1279 Ga0501082_0302485
1280 Ga0466962_0052203
1281 Ga0466962_0255826
1282 Ga0530510_0029040
1283 Ga0530510_0375196
1284 2643891637
1285 2643960685
1286 2644035800
1287 2644093898
1288 2644102305
1289 2644115529
1290 2644229287
1291 2644323742
1292 2738868089
1293 2740169506
1294 2812333181
1295 2855386911
1296 2857484664
1297 2915364553
1298 2984580305
1299 2990259155
1300 8054612818

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

36

232

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9007 16 212
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.8699 14 210
2zzi-assembly1.cif.gz_A crystal structure of ttha1623 in a di-iron-bound form 0.856 4 210
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.8504 14 194
7l0b-assembly3.cif.gz_C crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8014 4 210
ID Description Score Start End Superfamily
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9427 3 210 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9007 16 212 3.60.15.10
af_Q4D0L0_259_399_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8994 118 215 3.60.15.10
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8802 3 210 3.60.15.10
2zwrB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8724 5 213 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7V9J9S7-F1-model_v4 MBL fold metallo-hydrolase 0.9686 109 213 GO:0016787
AF-A0A6V8K2Y8-F1-model_v4 Hydrolase 0.9515 11 218 GO:0016787
AF-A0A4Q7JCC8-F1-model_v4 MBL fold metallo-hydrolase 0.9435 5 213 GO:0016787
AF-A0A2U3P0L5-F1-model_v4 Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II 0.9429 12 213 GO:0016787
AF-A0A3C1FG22-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9411 121 211 GO:0016787

Map