F472503

General Info

Members Datasets Scaffolds Average Seq Length
650 409 1300 272

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100319662|Ga0070665_1003196621
Length 303
Sequence VTWAVREKGYSQRHACRLVGLHPKTYRYATKRSGDEELRGRLRELASQRRRFGYRRLGLMLKRQGIKLNHKKLYRLYKEERLTVRKRGGRKRALGTRAPMAIPQDRNLRWSIDFVADTLTSGRRFRILTVVDDFTRECLGLVVDTSLTGLRVARELDRIAELRGYPCMIVSDNGTELTSNAILAWQQLRDVEWHYIAPGKPMQNGFVESFNGRLRDECLNEHLFGNLKEAREIIEEWRIDYNTNRPHSSLNGLTPIEFAARPKEGKTGTDSPYERGQIGEQVICRAGKSYPPKNFVLQQCGGC

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
7 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
13 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
97 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
98 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
99 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
102 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
105 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
106 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
123 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
124 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
125 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
249 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
250 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
251 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
252 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
253 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
254 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
255 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
258 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
259 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
260 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
261 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
265 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
266 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
267 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
270 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
278 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
357 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
386 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
403 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
404 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
405 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
406 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
407 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
408 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
409 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0.15
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 1.23
Rhizoplane 3.08
Rhizosphere 89.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100319662 3300005548 Bacteria 1556
2 2214942444 2209111006 Bacteria 1304
3 ARcpr5oldR_c004865 3300000041 Bacteria 1159
4 ARcpr5yngRDRAFT_c005190 3300000043 Bacteria 1207
5 ARSoilOldRDRAFT_c004641 3300000044 Bacteria 1162
6 CNBas_1001599 3300000531 Bacteria 1204
7 CNAas_1002737 3300000532 Bacteria 1220
8 ARCol0yngRDRAFT_1002441 3300000652 Bacteria 1401
9 JGI24742J22300_10015711 3300002244 Bacteria 1274
10 rootH1_10299666 3300003323 Bacteria 1056
11 JGI25405J52794_10024828 3300003911 Bacteria 1226
12 Ga0065717_1003773 3300005276 Bacteria 1182
13 Ga0065716_1003248 3300005277 Bacteria 1291
14 Ga0070676_10051740 3300005328 Bacteria 2412
15 Ga0070683_100282219 3300005329 Bacteria 1579
16 Ga0070683_100321487 3300005329 Bacteria 1473
17 Ga0070690_100108055 3300005330 Bacteria 1852
18 Ga0070670_100225720 3300005331 Bacteria 1630
19 Ga0070677_10082651 3300005333 Bacteria 1378
20 Ga0070680_100138417 3300005336 Bacteria 2040
21 Ga0070680_100246940 3300005336 Bacteria 1509
22 Ga0070680_100316323 3300005336 Bacteria 1325
23 Ga0070682_100138542 3300005337 Bacteria 1656
24 Ga0070682_100186969 3300005337 Bacteria 1452
25 Ga0068868_100239665 3300005338 Bacteria 1523
26 Ga0068868_100324837 3300005338 Bacteria 1312
27 Ga0068868_100438758 3300005338 Bacteria 1133
28 Ga0070660_100281025 3300005339 Bacteria 1362
29 Ga0070660_100327041 3300005339 Bacteria 1260
30 Ga0070689_100131776 3300005340 Bacteria 2005
31 Ga0070689_100182518 3300005340 Bacteria 1705
32 Ga0070689_100263329 3300005340 Bacteria 1425
33 Ga0070689_100267352 3300005340 Bacteria 1415
34 Ga0070691_10033648 3300005341 Bacteria 2412
35 Ga0070691_10087471 3300005341 Bacteria 1532
36 Ga0070687_100154356 3300005343 Bacteria 1351
37 Ga0070661_100082055 3300005344 Bacteria 2381
38 Ga0070668_100223535 3300005347 Bacteria 1554
39 Ga0070669_100264300 3300005353 Bacteria 1374
40 Ga0070671_100159025 3300005355 Bacteria 1909
41 Ga0070674_100178188 3300005356 Bacteria 1626
42 Ga0070674_100211510 3300005356 Bacteria 1503
43 Ga0070674_100269575 3300005356 Bacteria 1345
44 Ga0070673_100218792 3300005364 Bacteria 1647
45 Ga0070688_100238065 3300005365 Bacteria 1290
46 Ga0070688_100292921 3300005365 Bacteria 1174
47 Ga0070659_100291239 3300005366 Bacteria 1360
48 Ga0070659_100315096 3300005366 Bacteria 1307
49 Ga0070667_100056812 3300005367 Bacteria 3306
50 Ga0070703_10050110 3300005406 Bacteria 1332
51 Ga0070709_10183406 3300005434 Bacteria 1471
52 Ga0070714_100039508 3300005435 Bacteria 3973
53 Ga0070714_100103084 3300005435 Bacteria 2516
54 Ga0070714_100345328 3300005435 Bacteria 1397
55 Ga0070714_100354790 3300005435 Bacteria 1378
56 Ga0070713_100253604 3300005436 Bacteria 1605
57 Ga0070713_100264595 3300005436 Bacteria 1573
58 Ga0070713_100364156 3300005436 Bacteria 1344
59 Ga0070713_100374415 3300005436 Bacteria 1325
60 Ga0070710_10042070 3300005437 Bacteria 2525
61 Ga0070710_10225805 3300005437 Bacteria 1193
62 Ga0070701_10161364 3300005438 Bacteria 1299
63 Ga0070711_100361775 3300005439 Bacteria 1169
64 Ga0070700_100093317 3300005441 Bacteria 1968
65 Ga0070694_100315366 3300005444 Bacteria 1202
66 Ga0070708_100221416 3300005445 Bacteria 1775
67 Ga0070663_100062297 3300005455 Bacteria 2688
68 Ga0070663_100194381 3300005455 Bacteria 1581
69 Ga0070663_100381793 3300005455 Bacteria 1148
70 Ga0070663_100690314 3300005455 Bacteria 867
71 Ga0070678_100067725 3300005456 Bacteria 2658
72 Ga0070678_100360294 3300005456 Bacteria 1253
73 Ga0070678_100460061 3300005456 Bacteria 1116
74 Ga0070662_100227482 3300005457 Bacteria 1491
75 Ga0070681_10218494 3300005458 Bacteria 1822
76 Ga0070681_10610348 3300005458 Bacteria 1005
77 Ga0070681_10701423 3300005458 Bacteria 928
78 Ga0068867_100164031 3300005459 Bacteria 1754
79 Ga0070706_100448732 3300005467 Bacteria 1200
80 Ga0070707_100212441 3300005468 Bacteria 1885
81 Ga0070698_100299611 3300005471 Bacteria 1538
82 Ga0074259_11865313 3300005507 Bacteria 1255
83 Ga0070699_100083325 3300005518 Bacteria 2789
84 Ga0070699_100317773 3300005518 Bacteria 1399
85 Ga0070679_100165911 3300005530 Bacteria 2182
86 Ga0070684_100334507 3300005535 Bacteria 1392
87 Ga0070684_100482975 3300005535 Bacteria 1147
88 Ga0070697_100143250 3300005536 Bacteria 2011
89 Ga0068853_100253025 3300005539 Bacteria 1617
90 Ga0068853_100300369 3300005539 Bacteria 1484
91 Ga0068853_100338471 3300005539 Bacteria 1398
92 Ga0070672_100190547 3300005543 Bacteria 1712
93 Ga0070672_100209362 3300005543 Bacteria 1633
94 Ga0070672_100234742 3300005543 Bacteria 1541
95 Ga0070686_100243742 3300005544 Bacteria 1310
96 Ga0070695_100178255 3300005545 Bacteria 1504
97 Ga0070665_100272951 3300005548 Bacteria 1693
98 Ga0068855_100293204 3300005563 Bacteria 1803
99 Ga0068855_100741558 3300005563 Bacteria 1048
100 Ga0068857_100030321 3300005577 Bacteria 4775
101 Ga0068857_100470525 3300005577 Bacteria 1177
102 Ga0068854_100187797 3300005578 Bacteria 1618
103 Ga0068854_100198244 3300005578 Bacteria 1576
104 Ga0068856_100203240 3300005614 Bacteria 1996
105 Ga0068856_100313694 3300005614 Bacteria 1586
106 Ga0068856_100670633 3300005614 Bacteria 1057
107 Ga0070702_100122363 3300005615 Bacteria 1631
108 Ga0070702_100206725 3300005615 Bacteria 1303
109 Ga0068864_100310363 3300005618 Bacteria 1479
110 Ga0068866_10077897 3300005718 Bacteria 1772
111 Ga0068866_10167903 3300005718 Bacteria 1286
112 Ga0068861_100265764 3300005719 Bacteria 1471
113 Ga0068863_100252277 3300005841 Bacteria 1704
114 Ga0068863_100342412 3300005841 Bacteria 1455
115 Ga0068863_100393305 3300005841 Bacteria 1355
116 Ga0068858_100130658 3300005842 Bacteria 2355
117 Ga0068860_100371272 3300005843 Bacteria 1411
118 Ga0068860_100449053 3300005843 Bacteria 1282
119 Ga0081455_10046286 3300005937 Bacteria 3776
120 Ga0081455_10250741 3300005937 Bacteria 1295
121 Ga0070717_10221698 3300006028 Bacteria 1662
122 Ga0070717_10417560 3300006028 Bacteria 1207
123 Ga0070717_10421593 3300006028 Bacteria 1200
124 Ga0075365_10168686 3300006038 Bacteria 1527
125 Ga0075365_10253025 3300006038 Bacteria 1238
126 Ga0075364_10145535 3300006051 Bacteria 1595
127 Ga0075364_10150979 3300006051 Bacteria 1566
128 Ga0075364_10180290 3300006051 Bacteria 1429
129 Ga0070715_10031823 3300006163 Bacteria 2144
130 Ga0070716_100240877 3300006173 Bacteria 1226
131 Ga0070712_100196704 3300006175 Bacteria 1581
132 Ga0070712_100300126 3300006175 Bacteria 1300
133 Ga0075367_10128896 3300006178 Bacteria 1563
134 Ga0075367_10192948 3300006178 Bacteria 1271
135 Ga0075366_10065204 3300006195 Bacteria 2166
136 Ga0075366_10147534 3300006195 Bacteria 1424
137 Ga0097621_100353795 3300006237 Bacteria 1307
138 Ga0097621_100534433 3300006237 Bacteria 1066
139 Ga0075370_10011536 3300006353 Bacteria 4647
140 Ga0068865_100278151 3300006881 Bacteria 1331
141 Ga0105240_10109573 3300009093 Bacteria 3344
142 Ga0105240_10204189 3300009093 Bacteria 2314
143 Ga0105240_10537827 3300009093 Bacteria 1294
144 Ga0105245_10255495 3300009098 Bacteria 1704
145 Ga0105247_10183660 3300009101 Bacteria 1397
146 Ga0114129_10592401 3300009147 Bacteria 1437
147 Ga0105243_10214752 3300009148 Bacteria 1696
148 Ga0105243_10227350 3300009148 Bacteria 1653
149 Ga0105248_10426812 3300009177 Bacteria 1493
150 Ga0105237_10288352 3300009545 Bacteria 1644
151 Ga0105237_10313963 3300009545 Bacteria 1571
152 Ga0105237_10451571 3300009545 Bacteria 1291
153 Ga0105238_10280974 3300009551 Bacteria 1646
154 Ga0105238_10308182 3300009551 Bacteria 1568
155 Ga0105238_10309197 3300009551 Bacteria 1565
156 Ga0105238_10434339 3300009551 Bacteria 1309
157 Ga0099796_10092905 3300010159 Bacteria 1124
158 Ga0105239_10066566 3300010375 Bacteria 3958
159 Ga0105239_10191792 3300010375 Bacteria 2287
160 Ga0105239_10339523 3300010375 Bacteria 1695
161 Ga0105239_10403074 3300010375 Bacteria 1548
162 Ga0105246_10175189 3300011119 Bacteria 1646
163 Ga0105246_10216814 3300011119 Bacteria 1497
164 Ga0105246_10380041 3300011119 Bacteria 1167
165 Ga0105246_10549995 3300011119 Bacteria 989
166 Ga0157346_1000827 3300012480 Bacteria 1385
167 Ga0157320_1000848 3300012481 Bacteria 1381
168 Ga0157343_1001162 3300012488 Bacteria 1232
169 Ga0157313_1001187 3300012503 Bacteria 1359
170 Ga0157339_1000951 3300012505 Bacteria 1636
171 Ga0157324_1000986 3300012506 Bacteria 1470
172 Ga0157342_1003829 3300012507 Bacteria 1309
173 Ga0157315_1001288 3300012508 Bacteria 1367
174 Ga0157316_1001942 3300012510 Bacteria 1352
175 Ga0157327_1001848 3300012512 Bacteria 1387
176 Ga0157338_1001446 3300012515 Bacteria 1697
177 Ga0157373_10128950 3300013100 Bacteria 1778
178 Ga0157373_10228363 3300013100 Bacteria 1314
179 Ga0157371_10151617 3300013102 Bacteria 1653
180 Ga0157370_10194609 3300013104 Bacteria 1882
181 Ga0157370_10218349 3300013104 Bacteria 1766
182 Ga0157369_10248690 3300013105 Bacteria 1856
183 Ga0157369_10439753 3300013105 Bacteria 1351
184 Ga0157369_10524714 3300013105 Bacteria 1225
185 Ga0157374_10205120 3300013296 Bacteria 1932
186 Ga0157374_10488770 3300013296 Bacteria 1234
187 Ga0157378_10183104 3300013297 Bacteria 1972
188 Ga0157378_10248553 3300013297 Bacteria 1702
189 Ga0157378_10567093 3300013297 Bacteria 1143
190 Ga0163162_10138913 3300013306 Bacteria 2542
191 Ga0163162_10346553 3300013306 Bacteria 1618
192 Ga0163162_10490939 3300013306 Bacteria 1359
193 Ga0157372_10042479 3300013307 Bacteria 5029
194 Ga0157372_10279149 3300013307 Bacteria 1942
195 Ga0157372_10285442 3300013307 Bacteria 1919
196 Ga0157372_10368459 3300013307 Bacteria 1674
197 Ga0157372_10388637 3300013307 Bacteria 1626
198 Ga0157375_10279253 3300013308 Bacteria 1833
199 Ga0157375_10862385 3300013308 Bacteria 1051
200 Ga0163163_10420491 3300014325 Bacteria 1395
201 Ga0163163_10613285 3300014325 Bacteria 1151
202 Ga0182008_10094018 3300014497 Bacteria 1479
203 Ga0157377_10157434 3300014745 Bacteria 1410
204 Ga0157379_10254372 3300014968 Bacteria 1595
205 Ga0157376_10158083 3300014969 Bacteria 2052
206 Ga0163161_10140339 3300017792 Bacteria 1830
207 Ga0163161_10221297 3300017792 Bacteria 1466
208 Ga0163161_10229481 3300017792 Bacteria 1440
209 Ga0214542_1019590 3300021321 Bacteria 5269
210 Ga0214543_1041273 3300021327 Bacteria 1198
211 Ga0224569_103709 3300022732 Bacteria 1186
212 Ga0224571_102319 3300022734 Bacteria 1211
213 Ga0224572_1022032 3300024225 Bacteria 1224
214 Ga0228598_1023645 3300024227 Bacteria 1209
215 Ga0207697_10111556 3300025315 Bacteria 1171
216 Ga0207653_10035981 3300025885 Bacteria 1612
217 Ga0207682_10094199 3300025893 Bacteria 1302
218 Ga0207692_10215685 3300025898 Bacteria 1135
219 Ga0207642_10151695 3300025899 Bacteria 1234
220 Ga0207642_10197706 3300025899 Bacteria 1108
221 Ga0207688_10165826 3300025901 Bacteria 1311
222 Ga0207680_10253007 3300025903 Bacteria 1217
223 Ga0207685_10019796 3300025905 Bacteria 2224
224 Ga0207645_10041875 3300025907 Bacteria 2931
225 Ga0207705_10306338 3300025909 Bacteria 1219
226 Ga0207684_10139016 3300025910 Bacteria 2087
227 Ga0207707_10081972 3300025912 Bacteria 2816
228 Ga0207707_10363783 3300025912 Bacteria 1245
229 Ga0207695_10161873 3300025913 Bacteria 2169
230 Ga0207695_10417591 3300025913 Bacteria 1226
231 Ga0207671_10155980 3300025914 Bacteria 1766
232 Ga0207671_10253897 3300025914 Bacteria 1382
233 Ga0207663_10277228 3300025916 Bacteria 1244
234 Ga0207663_10284567 3300025916 Bacteria 1229
235 Ga0207660_10339566 3300025917 Bacteria 1202
236 Ga0207660_10356812 3300025917 Bacteria 1172
237 Ga0207662_10102725 3300025918 Bacteria 1773
238 Ga0207657_10025550 3300025919 Bacteria 5444
239 Ga0207657_10260248 3300025919 Bacteria 1381
240 Ga0207657_10352292 3300025919 Bacteria 1161
241 Ga0207649_10260032 3300025920 Bacteria 1254
242 Ga0207649_10459375 3300025920 Bacteria 962
243 Ga0207652_10099154 3300025921 Bacteria 2570
244 Ga0207652_10396381 3300025921 Bacteria 1246
245 Ga0207652_10404184 3300025921 Bacteria 1232
246 Ga0207652_10407288 3300025921 Bacteria 1227
247 Ga0207646_10400095 3300025922 Bacteria 1240
248 Ga0207681_10291784 3300025923 Bacteria 1287
249 Ga0207694_10153299 3300025924 Bacteria 1857
250 Ga0207694_10284265 3300025924 Bacteria 1359
251 Ga0207650_10407498 3300025925 Bacteria 1126
252 Ga0207659_10171827 3300025926 Bacteria 1710
253 Ga0207687_10330903 3300025927 Bacteria 1236
254 Ga0207700_10201475 3300025928 Bacteria 1677
255 Ga0207700_10322369 3300025928 Bacteria 1339
256 Ga0207700_10407354 3300025928 Bacteria 1192
257 Ga0207664_10037599 3300025929 Bacteria 3748
258 Ga0207664_10355697 3300025929 Bacteria 1297
259 Ga0207664_10369341 3300025929 Bacteria 1272
260 Ga0207644_10167343 3300025931 Bacteria 1713
261 Ga0207690_10312900 3300025932 Bacteria 1232
262 Ga0207690_10387000 3300025932 Bacteria 1113
263 Ga0207706_10239068 3300025933 Bacteria 1588
264 Ga0207686_10292778 3300025934 Bacteria 1206
265 Ga0207670_10139473 3300025936 Bacteria 1786
266 Ga0207670_10290602 3300025936 Bacteria 1277
267 Ga0207669_10124742 3300025937 Bacteria 1756
268 Ga0207669_10328392 3300025937 Bacteria 1173
269 Ga0207704_10306240 3300025938 Bacteria 1219
270 Ga0207665_10150074 3300025939 Bacteria 1669
271 Ga0207665_10303648 3300025939 Bacteria 1194
272 Ga0207691_10298557 3300025940 Bacteria 1384
273 Ga0207691_10321342 3300025940 Bacteria 1327
274 Ga0207711_10312963 3300025941 Bacteria 1450
275 Ga0207661_10124452 3300025944 Bacteria 2200
276 Ga0207679_10221064 3300025945 Bacteria 1593
277 Ga0207667_10556319 3300025949 Bacteria 1160
278 Ga0207651_10042818 3300025960 Bacteria 3017
279 Ga0207651_10358793 3300025960 Bacteria 1229
280 Ga0207651_10390637 3300025960 Bacteria 1181
281 Ga0207640_10320883 3300025981 Bacteria 1233
282 Ga0207677_10753439 3300026023 Bacteria 868
283 Ga0207703_10298665 3300026035 Bacteria 1468
284 Ga0207703_10680588 3300026035 Bacteria 977
285 Ga0207639_10341581 3300026041 Bacteria 1335
286 Ga0207639_10374102 3300026041 Bacteria 1278
287 Ga0207678_10129710 3300026067 Bacteria 2150
288 Ga0207678_10339962 3300026067 Bacteria 1293
289 Ga0207678_10463357 3300026067 Bacteria 1102
290 Ga0207702_10293980 3300026078 Bacteria 1540
291 Ga0207676_10431972 3300026095 Bacteria 1237
292 Ga0207674_10542265 3300026116 Bacteria 1124
293 Ga0207675_100214846 3300026118 Bacteria 1851
294 Ga0207675_100414728 3300026118 Bacteria 1329
295 Ga0207675_100572763 3300026118 Bacteria 1130
296 Ga0207683_10063437 3300026121 Bacteria 3255
297 Ga0207683_10309625 3300026121 Bacteria 1445
298 Ga0207698_10458976 3300026142 Bacteria 1232
299 Ga0207698_10687411 3300026142 Bacteria 1017
300 Ga0265356_1007901 3300028017 Bacteria 1218
301 Ga0268266_10002531 3300028379 Bacteria 19418
302 Ga0268266_10303467 3300028379 Bacteria 1490
303 Ga0268266_10481814 3300028379 Bacteria 1183
304 Ga0268264_10427688 3300028381 Bacteria 1278
305 Ga0265319_1061017 3300028563 Bacteria 1223
306 Ga0265334_10076067 3300028573 Bacteria 1243
307 Ga0265318_10075889 3300028577 Bacteria 1243
308 Ga0265338_10199517 3300028800 Bacteria 1509
309 Ga0265338_10263345 3300028800 Bacteria 1266
310 Ga0265338_10273330 3300028800 Bacteria 1237
311 Ga0265762_1007147 3300030760 Bacteria 1992
312 Ga0265330_10015058 3300031235 Bacteria 3581
313 Ga0265330_10064883 3300031235 Bacteria 1585
314 Ga0265330_10072655 3300031235 Bacteria 1487
315 Ga0265330_10087350 3300031235 Bacteria 1340
316 Ga0265332_10047576 3300031238 Bacteria 1845
317 Ga0265332_10063520 3300031238 Bacteria 1577
318 Ga0265332_10109867 3300031238 Bacteria 1162
319 Ga0265328_10048948 3300031239 Bacteria 1552
320 Ga0265328_10079784 3300031239 Bacteria 1206
321 Ga0265320_10041934 3300031240 Bacteria 2273
322 Ga0265320_10103775 3300031240 Bacteria 1307
323 Ga0265320_10112585 3300031240 Bacteria 1245
324 Ga0265320_10152475 3300031240 Bacteria 1043
325 Ga0265325_10032088 3300031241 Bacteria 2806
326 Ga0265325_10054640 3300031241 Bacteria 2043
327 Ga0265325_10128642 3300031241 Bacteria 1214
328 Ga0265329_10049337 3300031242 Bacteria 1341
329 Ga0265329_10051588 3300031242 Bacteria 1309
330 Ga0265340_10079142 3300031247 Bacteria 1549
331 Ga0265340_10123761 3300031247 Bacteria 1188
332 Ga0265339_10056966 3300031249 Bacteria 2114
333 Ga0265339_10135113 3300031249 Bacteria 1258
334 Ga0265339_10135652 3300031249 Bacteria 1255
335 Ga0265331_10047454 3300031250 Bacteria 2066
336 Ga0265331_10081048 3300031250 Bacteria 1507
337 Ga0265316_10150647 3300031344 Bacteria 1742
338 Ga0265316_10166360 3300031344 Bacteria 1647
339 Ga0265316_10225778 3300031344 Bacteria 1380
340 Ga0265316_10264059 3300031344 Bacteria 1261
341 Ga0265313_10055329 3300031595 Bacteria 1879
342 Ga0265313_10076729 3300031595 Bacteria 1526
343 Ga0265313_10109435 3300031595 Bacteria 1216
344 Ga0265314_10110600 3300031711 Bacteria 1746
345 Ga0265314_10124768 3300031711 Bacteria 1614
346 Ga0265314_10231177 3300031711 Bacteria 1072
347 Ga0265342_10065842 3300031712 Bacteria 2122
348 Ga0265342_10075554 3300031712 Bacteria 1954
349 Ga0265342_10106018 3300031712 Bacteria 1595
350 Ga0316576_10239741 3300031727 Bacteria 1363
351 Ga0307516_10077964 3300031730 Bacteria 3160
352 Ga0307407_10211132 3300031903 Bacteria 1307
353 Ga0307407_10328732 3300031903 Bacteria 1075
354 Ga0307412_10275288 3300031911 Bacteria 1319
355 Ga0307416_100268704 3300032002 Bacteria 1672
356 Ga0307416_100745827 3300032002 Bacteria 1071
357 Ga0307414_10000935 3300032004 Bacteria 14921
358 Ga0307411_10182162 3300032005 Bacteria 1595
359 Ga0307411_10323386 3300032005 Bacteria 1246
360 Ga0373948_0005448 3300034817 Bacteria 2065
361 Ga0373948_0030571 3300034817 Bacteria 1083
362 Ga0373958_0010738 3300034819 Bacteria 1533
363 Ga0373938_0001426 3300034957 Bacteria 3828
364 Ga0373926_0033508 3300035083 Bacteria 1815
365 Ga0373934_0071883 3300035086 Bacteria 1384
366 Ga0373934_0121732 3300035086 Bacteria 1062
367 Ga0373944_0063350 3300035089 Bacteria 1190
368 Ga0373949_0025912 3300035090 Bacteria 1371
369 Ga0373951_0027396 3300035091 Bacteria 1331
370 Ga0373952_0002595 3300035092 Bacteria 3255
371 Ga0373952_0025345 3300035092 Bacteria 1280
372 Ga0373923_0058728 3300035111 Bacteria 1629
373 Ga0373923_0063642 3300035111 Bacteria 1571
374 Ga0373932_0008784 3300035112 Bacteria 2418
375 Ga0373932_0041450 3300035112 Bacteria 1330
376 Ga0373936_0188211 3300035113 Bacteria 907
377 Ga0373939_0010117 3300035114 Bacteria 2350
378 Ga0373941_0039099 3300035115 Bacteria 1456
379 Ga0373941_0079369 3300035115 Bacteria 1105
380 Ga0373954_0097433 3300035118 Bacteria 1417
381 Ga0373954_0097961 3300035118 Bacteria 1413
382 Ga0373956_0123252 3300035119 Bacteria 1211
383 Ga0373960_0002462 3300035121 Bacteria 4159
384 Ga0373943_0024217 3300035170 Bacteria 2829
385 Ga0373943_0063267 3300035170 Bacteria 1854
386 Ga0373946_0052657 3300035171 Bacteria 1708
387 Ga0373955_0402857 3300035172 Bacteria 831
388 Ga0373942_0049827 3300035207 Bacteria 1170
389 Ga0373962_0030328 3300035242 Bacteria 1479
390 Ga0316574_0115026 3300035398 Bacteria 1725
391 Ga0316574_0223937 3300035398 Bacteria 1205
392 Ga0373924_0078841 3300035410 Bacteria 1398
393 Ga0373931_0107722 3300035691 Bacteria 1576
394 Ga0373935_0139382 3300035692 Bacteria 1637
395 Ga0373935_0167623 3300035692 Bacteria 1500
396 Ga0373935_0189880 3300035692 Bacteria 1414
397 Ga0373935_0255626 3300035692 Bacteria 1227
398 Ga0373935_0284632 3300035692 Bacteria 1164
399 Ga0373927_0108408 3300035695 Bacteria 1809
400 Ga0373927_0132110 3300035695 Bacteria 1631
401 Ga0373927_0184055 3300035695 Bacteria 1370
402 Ga0373933_0164167 3300035724 Bacteria 1411
403 Ga0373947_0136962 3300035725 Bacteria 1567
404 Ga0373947_0365793 3300035725 Bacteria 969
405 Ga0373937_0382347 3300036401 Bacteria 1335
406 Ga0373937_0390445 3300036401 Bacteria 1320
407 Ga0316582_0250181 3300036647 Bacteria 1214
408 Ga0316582_0257896 3300036647 Bacteria 1195
409 Ga0373925_0026850 3300037068 Bacteria 4215
410 Ga0373925_0052739 3300037068 Bacteria 3039
411 Ga0373925_0181422 3300037068 Bacteria 1666
412 Ga0373925_0274961 3300037068 Bacteria 1355
413 Ga0373925_0389572 3300037068 Bacteria 1135
414 Ga0395899_0215275 3300037312 Bacteria 1333
415 Ga0395901_0679651 3300038443 Bacteria 1029
416 Ga0400483_165962 3300039062 Bacteria 2125
417 Ga0436365_0966114 3300039437 Bacteria 1454
418 Ga0436365_1923617 3300039437 Bacteria 1119
419 Ga0436363_0018834 3300039450 Bacteria 1611
420 Ga0436363_0312190 3300039450 Bacteria 1333
421 Ga0436363_0928990 3300039450 Bacteria 1241
422 Ga0436362_0747237 3300039453 Bacteria 1087
423 Ga0439436_0033996 3300041404 Bacteria 1474
424 Ga0439439_0036586 3300041406 Bacteria 1263
425 Ga0439447_027919 3300041407 Bacteria 1437
426 Ga0439453_0017139 3300041408 Bacteria 1270
427 Ga0439461_0008144 3300041410 Bacteria 1872
428 Ga0451791_1748283 3300041451 Bacteria 1376
429 Ga0451793_0571572 3300041452 Bacteria 1031
430 Ga0451806_119271 3300041462 Bacteria 1305
431 Ga0451849_1486900 3300041505 Bacteria 1502
432 Ga0451853_1048281 3300041512 Bacteria 1355
433 Ga0439431_0031889 3300041997 Bacteria 1311
434 Ga0439433_0038199 3300041999 Bacteria 1113
435 Ga0439437_010248 3300042000 Bacteria 1066
436 Ga0439441_031212 3300042001 Bacteria 1033
437 Ga0439442_045953 3300042002 Bacteria 920
438 Ga0439445_0056208 3300042004 Bacteria 1070
439 Ga0439432_056030 3300042006 Bacteria 1222
440 Ga0439449_0138721 3300042007 Bacteria 905
441 Ga0439452_031173 3300042010 Bacteria 1309
442 Ga0439454_009771 3300042011 Bacteria 1252
443 Ga0439457_028826 3300042014 Bacteria 1229
444 Ga0439462_0031121 3300042015 Bacteria 1412
445 Ga0439462_0035441 3300042015 Bacteria 1326
446 Ga0450898_016660 3300042134 Bacteria 1256
447 Ga0450910_010059 3300042147 Bacteria 1343
448 Ga0439446_0051970 3300042156 Bacteria 1225
449 Ga0439458_0048142 3300042157 Bacteria 1047
450 Ga0439434_0027544 3300042435 Bacteria 1718
451 Ga0439435_0032471 3300042436 Bacteria 1424
452 Ga0439459_0037588 3300042438 Bacteria 1014
453 Ga0439464_0042650 3300042439 Bacteria 1296
454 Ga0439460_0051046 3300042461 Bacteria 1240
455 Ga0466969_0120383 3300044656 Bacteria 1222
456 Ga0466966_0191340 3300044684 Bacteria 1239
457 Ga0466961_0177888 3300044693 Bacteria 1321
458 Ga0466963_0136281 3300044694 Bacteria 1698
459 Ga0466964_0069974 3300044706 Bacteria 1481
460 Ga0466964_0106656 3300044706 Bacteria 1243
461 Ga0466971_0078765 3300044719 Bacteria 1501
462 Ga0466968_0077765 3300044735 Bacteria 1453
463 Ga0466970_0132543 3300044765 Bacteria 1369
464 Ga0466957_0226723 3300044842 Bacteria 1235
465 Ga0466959_0382595 3300045049 Bacteria 957
466 Ga0451576_0303015 3300045051 Bacteria 1671
467 Ga0466958_0176781 3300045836 Bacteria 1353
468 Ga0495617_101526 3300046452 Bacteria 935
469 Ga0495592_0068959 3300046454 Bacteria 2580
470 Ga0495592_0334188 3300046454 Bacteria 976
471 Ga0495629_0004206 3300046459 Bacteria 10799
472 Ga0495641_0088208 3300046461 Bacteria 1387
473 Ga0495651_0049459 3300046462 Bacteria 3245
474 Ga0495653_0043981 3300046463 Bacteria 3469
475 Ga0495580_0205114 3300046472 Bacteria 1357
476 Ga0495582_0030063 3300046473 Bacteria 2981
477 Ga0495582_0039511 3300046473 Bacteria 2597
478 Ga0495639_0073529 3300046475 Bacteria 1582
479 Ga0495639_0101308 3300046475 Bacteria 1360
480 Ga0495662_0112644 3300046476 Bacteria 1333
481 Ga0495585_0122083 3300046492 Bacteria 1377
482 Ga0495596_0035814 3300046500 Bacteria 1967
483 Ga0495607_0183260 3300046501 Bacteria 1048
484 Ga0495618_0005410 3300046514 Bacteria 7787
485 Ga0495618_0322008 3300046514 Bacteria 957
486 Ga0495628_0091317 3300046516 Bacteria 2357
487 Ga0495628_0274870 3300046516 Bacteria 1252
488 Ga0495630_0264249 3300046517 Bacteria 1314
489 Ga0495637_0085192 3300046520 Bacteria 1254
490 Ga0495652_0137051 3300046529 Bacteria 1930
491 Ga0495652_0177190 3300046529 Bacteria 1640
492 Ga0495665_0034464 3300046531 Bacteria 2707
493 Ga0495665_0130856 3300046531 Bacteria 1313
494 Ga0495640_0005221 3300046533 Bacteria 10323
495 Ga0495640_0178474 3300046533 Bacteria 1354
496 Ga0495640_0192539 3300046533 Bacteria 1295
497 Ga0495586_0133551 3300046535 Bacteria 1390
498 Ga0495586_0160847 3300046535 Bacteria 1266
499 Ga0495587_0195654 3300046536 Bacteria 1144
500 Ga0495598_0099274 3300046537 Bacteria 961
501 Ga0495597_0164455 3300046542 Bacteria 904
502 Ga0495645_0257099 3300046543 Bacteria 1158
503 Ga0495667_0008185 3300046559 Bacteria 7095
504 Ga0495667_0191564 3300046559 Bacteria 1310
505 Ga0495656_0148084 3300046615 Bacteria 1131
506 Ga0495668_0126731 3300046616 Bacteria 1397
507 Ga0495634_0179009 3300046642 Bacteria 1328
508 Ga0495611_0070204 3300046648 Bacteria 1601
509 Ga0495635_0002033 3300046663 Bacteria 13709
510 Ga0495659_0022049 3300046664 Bacteria 2150
511 Ga0495659_0120672 3300046664 Bacteria 1032
512 Ga0495661_0177059 3300046665 Bacteria 1133
513 Ga0495661_0205311 3300046665 Bacteria 1029
514 Ga0495588_0135876 3300046674 Bacteria 1298
515 Ga0495599_0348709 3300046678 Bacteria 888
516 Ga0495646_0015151 3300046680 Bacteria 4898
517 Ga0495658_0007995 3300046683 Bacteria 5240
518 Ga0495613_0069059 3300046689 Bacteria 2577
519 Ga0495624_0149462 3300046690 Bacteria 1429
520 Ga0495624_0149607 3300046690 Bacteria 1428
521 Ga0495670_0028458 3300046691 Bacteria 2770
522 Ga0495670_0040340 3300046691 Bacteria 2328
523 Ga0495671_0003148 3300046692 Bacteria 10258
524 Ga0495600_0084427 3300046809 Bacteria 2072
525 Ga0495581_0096297 3300047315 Bacteria 1718
526 Ga0495581_0102214 3300047315 Bacteria 1665
527 Ga0495581_0186413 3300047315 Bacteria 1213
528 Ga0495604_0076629 3300047317 Bacteria 2515
529 Ga0495674_0002631 3300047319 Bacteria 17472
530 Ga0495674_0253868 3300047319 Bacteria 1446
531 Ga0495676_0229807 3300047321 Bacteria 1275
532 Ga0495676_0237430 3300047321 Bacteria 1249
533 Ga0495680_0001455 3300047322 Bacteria 25531
534 Ga0495679_045467 3300047446 Bacteria 1341
535 Ga0495673_0036266 3300047469 Bacteria 2264
536 Ga0495684_0000464 3300047471 Bacteria 33167
537 Ga0495686_0004864 3300047472 Bacteria 10834
538 Ga0495593_0137444 3300047673 Bacteria 1238
539 Ga0495614_0011434 3300048089 Bacteria 3907
540 Ga0496101_0237315 3300048904 Bacteria 1418
541 Ga0496102_0388194 3300048905 Bacteria 1313
542 Ga0496102_0689833 3300048905 Bacteria 944
543 Ga0496103_0208364 3300048906 Bacteria 1257
544 Ga0496104_0417735 3300048907 Bacteria 1253
545 Ga0496104_0778559 3300048907 Bacteria 863
546 Ga0496105_0350605 3300048908 Bacteria 1179
547 Ga0496106_0212744 3300048909 Bacteria 1540
548 Ga0496110_0379246 3300048913 Bacteria 1288
549 Ga0496111_0269719 3300048914 Bacteria 1262
550 Ga0496112_0401425 3300048915 Bacteria 1310
551 Ga0496112_0412018 3300048915 Bacteria 1290
552 Ga0496114_0347574 3300048917 Bacteria 1311
553 Ga0496114_0362511 3300048917 Bacteria 1282
554 Ga0496114_0373830 3300048917 Bacteria 1261
555 Ga0496115_0330471 3300048918 Bacteria 1245
556 Ga0496115_0615396 3300048918 Bacteria 862
557 Ga0496125_0254716 3300048928 Bacteria 1104
558 Ga0496126_0007244 3300048929 Bacteria 12196
559 Ga0495682_0000540 3300049460 Bacteria 26138
560 Ga0501300_000460 3300049523 Bacteria 6195
561 Ga0501031_0187223 3300049568 Bacteria 1352
562 Ga0501033_0006647 3300049570 Bacteria 9043
563 Ga0501033_0095445 3300049570 Bacteria 2173
564 Ga0501033_0229707 3300049570 Bacteria 1318
565 Ga0501033_0384541 3300049570 Bacteria 980
566 Ga0501034_0078724 3300049571 Bacteria 3300
567 Ga0501034_0276118 3300049571 Bacteria 1620
568 Ga0501036_0003926 3300049572 Bacteria 11944
569 Ga0501037_0210791 3300049573 Bacteria 1370
570 Ga0501037_0226233 3300049573 Bacteria 1314
571 Ga0501038_0179638 3300049574 Bacteria 1708
572 Ga0501038_0302303 3300049574 Bacteria 1255
573 Ga0501039_0154854 3300049575 Bacteria 1800
574 Ga0501042_0248139 3300049578 Bacteria 1284
575 Ga0501043_0011933 3300049579 Bacteria 6798
576 Ga0501043_0275616 3300049579 Bacteria 1290
577 Ga0501043_0315424 3300049579 Bacteria 1193
578 Ga0501046_0226516 3300049580 Bacteria 1382
579 Ga0501047_0000871 3300049581 Bacteria 30824
580 Ga0501047_0397925 3300049581 Bacteria 1210
581 Ga0501048_0197090 3300049582 Bacteria 1427
582 Ga0501048_0207595 3300049582 Bacteria 1389
583 Ga0501048_0262756 3300049582 Bacteria 1226
584 Ga0501068_0191421 3300049584 Bacteria 1295
585 Ga0501069_0137949 3300049585 Bacteria 1398
586 Ga0501070_0250350 3300049586 Bacteria 1449
587 Ga0501070_0267208 3300049586 Bacteria 1397
588 Ga0501070_0298774 3300049586 Bacteria 1312
589 Ga0501070_0303880 3300049586 Bacteria 1299
590 Ga0501070_0362692 3300049586 Bacteria 1175
591 Ga0501070_0477324 3300049586 Bacteria 1003
592 Ga0501071_0145173 3300049587 Bacteria 1768
593 Ga0501071_0437084 3300049587 Bacteria 1001
594 Ga0501073_0039852 3300049589 Bacteria 3327
595 Ga0501074_0162839 3300049590 Bacteria 1593
596 Ga0501076_0671228 3300049592 Bacteria 855
597 Ga0501077_0314462 3300049593 Bacteria 998
598 Ga0501240_002662 3300049673 Bacteria 1918
599 Ga0501079_0283211 3300049741 Bacteria 1296
600 Ga0501079_0336290 3300049741 Bacteria 1183
601 Ga0501080_0351650 3300049742 Bacteria 1330
602 Ga0501083_0255308 3300049744 Bacteria 1141
603 Ga0501280_000837 3300049776 Bacteria 6650
604 Ga0501035_0194310 3300049822 Bacteria 1743
605 Ga0501035_0297159 3300049822 Bacteria 1361
606 Ga0501044_0247604 3300049823 Bacteria 1724
607 Ga0501044_0351835 3300049823 Bacteria 1392
608 Ga0501044_0617813 3300049823 Bacteria 975
609 Ga0501204_020216 3300049850 Bacteria 864
610 Ga0501226_004689 3300049853 Bacteria 1574
611 nmdc:mga00v17_151397_c1 3300050491 Bacteria 1491
612 nmdc:mga00v17_177806_c1 3300050491 Bacteria 1373
613 nmdc:mga0yw44_217286_c1 3300050492 Bacteria 1266
614 nmdc:mga0yw44_31548_c1 3300050492 Bacteria 3083
615 nmdc:mga0yw44_442211_c1 3300050492 Bacteria 881
616 nmdc:mga0k408_139762_c1 3300050493 Bacteria 1440
617 nmdc:mga0k408_68844_c1 3300050493 Bacteria 2065
618 nmdc:mga06z11_135910_c1 3300050494 Bacteria 1385
619 nmdc:mga06z11_174562_c1 3300050494 Bacteria 1236
620 nmdc:mga07m45_11406_c1 3300050496 Bacteria 4668
621 nmdc:mga08y16_432759_c1 3300050511 Bacteria 1343
622 Ga0495601_0000907 3300053077 Bacteria 16149
623 Ga0495601_0191747 3300053077 Bacteria 1335
624 Ga0495612_0050047 3300053078 Bacteria 1715
625 Ga0495595_0001429 3300053084 Bacteria 9292
626 Ga0495619_0001195 3300053085 Bacteria 17097
627 Ga0500595_055178 3300053119 Bacteria 1217
628 Ga0500655_017384 3300053133 Bacteria 1329
629 Ga0500559_0002048 3300053136 Bacteria 10790
630 Ga0500559_0107805 3300053136 Bacteria 1288
631 Ga0501084_0357294 3300054114 Bacteria 1234
632 Ga0466962_0114097 3300061719 Bacteria 1301
633 Ga0530510_0138411 3300061734 Bacteria 1793
634 2558861057 2558860100 Bacteria 8458965
635 2558862948 2558860100 Bacteria 8458965
636 2558865537 2558860100 Bacteria 8458965
637 2558865747 2558860100 Bacteria 8458965
638 2558867121 2558860100 Bacteria 8458965
639 2558868156 2558860100 Bacteria 8458965
640 2776268343 2775506902 Bacteria 6208009
641 2776268484 2775506902 Bacteria 6208009
642 2861697042 2861691609 Bacteria 5628931
643 2889309758 2889306138 Bacteria 6358934
644 2889311933 2889306138 Bacteria 6358934
645 2889312010 2889306138 Bacteria 6358934
646 2889312411 2889306138 Bacteria 6358934
647 2896385283 2896384573 Bacteria 7700774
648 2919124274 2919119836 Bacteria 5208557
649 2919124353 2919119836 Bacteria 5208557
650 2928130861 2928125067 Bacteria 5937560
651 Ga0070665_100319662
652 2214942444
653 ARcpr5oldR_c004865
654 ARcpr5yngRDRAFT_c005190
655 ARSoilOldRDRAFT_c004641
656 CNBas_1001599
657 CNAas_1002737
658 ARCol0yngRDRAFT_1002441
659 JGI24742J22300_10015711
660 rootH1_10299666
661 JGI25405J52794_10024828
662 Ga0065717_1003773
663 Ga0065716_1003248
664 Ga0070676_10051740
665 Ga0070683_100282219
666 Ga0070683_100321487
667 Ga0070690_100108055
668 Ga0070670_100225720
669 Ga0070677_10082651
670 Ga0070680_100138417
671 Ga0070680_100246940
672 Ga0070680_100316323
673 Ga0070682_100138542
674 Ga0070682_100186969
675 Ga0068868_100239665
676 Ga0068868_100324837
677 Ga0068868_100438758
678 Ga0070660_100281025
679 Ga0070660_100327041
680 Ga0070689_100131776
681 Ga0070689_100182518
682 Ga0070689_100263329
683 Ga0070689_100267352
684 Ga0070691_10033648
685 Ga0070691_10087471
686 Ga0070687_100154356
687 Ga0070661_100082055
688 Ga0070668_100223535
689 Ga0070669_100264300
690 Ga0070671_100159025
691 Ga0070674_100178188
692 Ga0070674_100211510
693 Ga0070674_100269575
694 Ga0070673_100218792
695 Ga0070688_100238065
696 Ga0070688_100292921
697 Ga0070659_100291239
698 Ga0070659_100315096
699 Ga0070667_100056812
700 Ga0070703_10050110
701 Ga0070709_10183406
702 Ga0070714_100039508
703 Ga0070714_100103084
704 Ga0070714_100345328
705 Ga0070714_100354790
706 Ga0070713_100253604
707 Ga0070713_100264595
708 Ga0070713_100364156
709 Ga0070713_100374415
710 Ga0070710_10042070
711 Ga0070710_10225805
712 Ga0070701_10161364
713 Ga0070711_100361775
714 Ga0070700_100093317
715 Ga0070694_100315366
716 Ga0070708_100221416
717 Ga0070663_100062297
718 Ga0070663_100194381
719 Ga0070663_100381793
720 Ga0070663_100690314
721 Ga0070678_100067725
722 Ga0070678_100360294
723 Ga0070678_100460061
724 Ga0070662_100227482
725 Ga0070681_10218494
726 Ga0070681_10610348
727 Ga0070681_10701423
728 Ga0068867_100164031
729 Ga0070706_100448732
730 Ga0070707_100212441
731 Ga0070698_100299611
732 Ga0074259_11865313
733 Ga0070699_100083325
734 Ga0070699_100317773
735 Ga0070679_100165911
736 Ga0070684_100334507
737 Ga0070684_100482975
738 Ga0070697_100143250
739 Ga0068853_100253025
740 Ga0068853_100300369
741 Ga0068853_100338471
742 Ga0070672_100190547
743 Ga0070672_100209362
744 Ga0070672_100234742
745 Ga0070686_100243742
746 Ga0070695_100178255
747 Ga0070665_100272951
748 Ga0068855_100293204
749 Ga0068855_100741558
750 Ga0068857_100030321
751 Ga0068857_100470525
752 Ga0068854_100187797
753 Ga0068854_100198244
754 Ga0068856_100203240
755 Ga0068856_100313694
756 Ga0068856_100670633
757 Ga0070702_100122363
758 Ga0070702_100206725
759 Ga0068864_100310363
760 Ga0068866_10077897
761 Ga0068866_10167903
762 Ga0068861_100265764
763 Ga0068863_100252277
764 Ga0068863_100342412
765 Ga0068863_100393305
766 Ga0068858_100130658
767 Ga0068860_100371272
768 Ga0068860_100449053
769 Ga0081455_10046286
770 Ga0081455_10250741
771 Ga0070717_10221698
772 Ga0070717_10417560
773 Ga0070717_10421593
774 Ga0075365_10168686
775 Ga0075365_10253025
776 Ga0075364_10145535
777 Ga0075364_10150979
778 Ga0075364_10180290
779 Ga0070715_10031823
780 Ga0070716_100240877
781 Ga0070712_100196704
782 Ga0070712_100300126
783 Ga0075367_10128896
784 Ga0075367_10192948
785 Ga0075366_10065204
786 Ga0075366_10147534
787 Ga0097621_100353795
788 Ga0097621_100534433
789 Ga0075370_10011536
790 Ga0068865_100278151
791 Ga0105240_10109573
792 Ga0105240_10204189
793 Ga0105240_10537827
794 Ga0105245_10255495
795 Ga0105247_10183660
796 Ga0114129_10592401
797 Ga0105243_10214752
798 Ga0105243_10227350
799 Ga0105248_10426812
800 Ga0105237_10288352
801 Ga0105237_10313963
802 Ga0105237_10451571
803 Ga0105238_10280974
804 Ga0105238_10308182
805 Ga0105238_10309197
806 Ga0105238_10434339
807 Ga0099796_10092905
808 Ga0105239_10066566
809 Ga0105239_10191792
810 Ga0105239_10339523
811 Ga0105239_10403074
812 Ga0105246_10175189
813 Ga0105246_10216814
814 Ga0105246_10380041
815 Ga0105246_10549995
816 Ga0157346_1000827
817 Ga0157320_1000848
818 Ga0157343_1001162
819 Ga0157313_1001187
820 Ga0157339_1000951
821 Ga0157324_1000986
822 Ga0157342_1003829
823 Ga0157315_1001288
824 Ga0157316_1001942
825 Ga0157327_1001848
826 Ga0157338_1001446
827 Ga0157373_10128950
828 Ga0157373_10228363
829 Ga0157371_10151617
830 Ga0157370_10194609
831 Ga0157370_10218349
832 Ga0157369_10248690
833 Ga0157369_10439753
834 Ga0157369_10524714
835 Ga0157374_10205120
836 Ga0157374_10488770
837 Ga0157378_10183104
838 Ga0157378_10248553
839 Ga0157378_10567093
840 Ga0163162_10138913
841 Ga0163162_10346553
842 Ga0163162_10490939
843 Ga0157372_10042479
844 Ga0157372_10279149
845 Ga0157372_10285442
846 Ga0157372_10368459
847 Ga0157372_10388637
848 Ga0157375_10279253
849 Ga0157375_10862385
850 Ga0163163_10420491
851 Ga0163163_10613285
852 Ga0182008_10094018
853 Ga0157377_10157434
854 Ga0157379_10254372
855 Ga0157376_10158083
856 Ga0163161_10140339
857 Ga0163161_10221297
858 Ga0163161_10229481
859 Ga0214542_1019590
860 Ga0214543_1041273
861 Ga0224569_103709
862 Ga0224571_102319
863 Ga0224572_1022032
864 Ga0228598_1023645
865 Ga0207697_10111556
866 Ga0207653_10035981
867 Ga0207682_10094199
868 Ga0207692_10215685
869 Ga0207642_10151695
870 Ga0207642_10197706
871 Ga0207688_10165826
872 Ga0207680_10253007
873 Ga0207685_10019796
874 Ga0207645_10041875
875 Ga0207705_10306338
876 Ga0207684_10139016
877 Ga0207707_10081972
878 Ga0207707_10363783
879 Ga0207695_10161873
880 Ga0207695_10417591
881 Ga0207671_10155980
882 Ga0207671_10253897
883 Ga0207663_10277228
884 Ga0207663_10284567
885 Ga0207660_10339566
886 Ga0207660_10356812
887 Ga0207662_10102725
888 Ga0207657_10025550
889 Ga0207657_10260248
890 Ga0207657_10352292
891 Ga0207649_10260032
892 Ga0207649_10459375
893 Ga0207652_10099154
894 Ga0207652_10396381
895 Ga0207652_10404184
896 Ga0207652_10407288
897 Ga0207646_10400095
898 Ga0207681_10291784
899 Ga0207694_10153299
900 Ga0207694_10284265
901 Ga0207650_10407498
902 Ga0207659_10171827
903 Ga0207687_10330903
904 Ga0207700_10201475
905 Ga0207700_10322369
906 Ga0207700_10407354
907 Ga0207664_10037599
908 Ga0207664_10355697
909 Ga0207664_10369341
910 Ga0207644_10167343
911 Ga0207690_10312900
912 Ga0207690_10387000
913 Ga0207706_10239068
914 Ga0207686_10292778
915 Ga0207670_10139473
916 Ga0207670_10290602
917 Ga0207669_10124742
918 Ga0207669_10328392
919 Ga0207704_10306240
920 Ga0207665_10150074
921 Ga0207665_10303648
922 Ga0207691_10298557
923 Ga0207691_10321342
924 Ga0207711_10312963
925 Ga0207661_10124452
926 Ga0207679_10221064
927 Ga0207667_10556319
928 Ga0207651_10042818
929 Ga0207651_10358793
930 Ga0207651_10390637
931 Ga0207640_10320883
932 Ga0207677_10753439
933 Ga0207703_10298665
934 Ga0207703_10680588
935 Ga0207639_10341581
936 Ga0207639_10374102
937 Ga0207678_10129710
938 Ga0207678_10339962
939 Ga0207678_10463357
940 Ga0207702_10293980
941 Ga0207676_10431972
942 Ga0207674_10542265
943 Ga0207675_100214846
944 Ga0207675_100414728
945 Ga0207675_100572763
946 Ga0207683_10063437
947 Ga0207683_10309625
948 Ga0207698_10458976
949 Ga0207698_10687411
950 Ga0265356_1007901
951 Ga0268266_10002531
952 Ga0268266_10303467
953 Ga0268266_10481814
954 Ga0268264_10427688
955 Ga0265319_1061017
956 Ga0265334_10076067
957 Ga0265318_10075889
958 Ga0265338_10199517
959 Ga0265338_10263345
960 Ga0265338_10273330
961 Ga0265762_1007147
962 Ga0265330_10015058
963 Ga0265330_10064883
964 Ga0265330_10072655
965 Ga0265330_10087350
966 Ga0265332_10047576
967 Ga0265332_10063520
968 Ga0265332_10109867
969 Ga0265328_10048948
970 Ga0265328_10079784
971 Ga0265320_10041934
972 Ga0265320_10103775
973 Ga0265320_10112585
974 Ga0265320_10152475
975 Ga0265325_10032088
976 Ga0265325_10054640
977 Ga0265325_10128642
978 Ga0265329_10049337
979 Ga0265329_10051588
980 Ga0265340_10079142
981 Ga0265340_10123761
982 Ga0265339_10056966
983 Ga0265339_10135113
984 Ga0265339_10135652
985 Ga0265331_10047454
986 Ga0265331_10081048
987 Ga0265316_10150647
988 Ga0265316_10166360
989 Ga0265316_10225778
990 Ga0265316_10264059
991 Ga0265313_10055329
992 Ga0265313_10076729
993 Ga0265313_10109435
994 Ga0265314_10110600
995 Ga0265314_10124768
996 Ga0265314_10231177
997 Ga0265342_10065842
998 Ga0265342_10075554
999 Ga0265342_10106018
1000 Ga0316576_10239741
1001 Ga0307516_10077964
1002 Ga0307407_10211132
1003 Ga0307407_10328732
1004 Ga0307412_10275288
1005 Ga0307416_100268704
1006 Ga0307416_100745827
1007 Ga0307414_10000935
1008 Ga0307411_10182162
1009 Ga0307411_10323386
1010 Ga0373948_0005448
1011 Ga0373948_0030571
1012 Ga0373958_0010738
1013 Ga0373938_0001426
1014 Ga0373926_0033508
1015 Ga0373934_0071883
1016 Ga0373934_0121732
1017 Ga0373944_0063350
1018 Ga0373949_0025912
1019 Ga0373951_0027396
1020 Ga0373952_0002595
1021 Ga0373952_0025345
1022 Ga0373923_0058728
1023 Ga0373923_0063642
1024 Ga0373932_0008784
1025 Ga0373932_0041450
1026 Ga0373936_0188211
1027 Ga0373939_0010117
1028 Ga0373941_0039099
1029 Ga0373941_0079369
1030 Ga0373954_0097433
1031 Ga0373954_0097961
1032 Ga0373956_0123252
1033 Ga0373960_0002462
1034 Ga0373943_0024217
1035 Ga0373943_0063267
1036 Ga0373946_0052657
1037 Ga0373955_0402857
1038 Ga0373942_0049827
1039 Ga0373962_0030328
1040 Ga0316574_0115026
1041 Ga0316574_0223937
1042 Ga0373924_0078841
1043 Ga0373931_0107722
1044 Ga0373935_0139382
1045 Ga0373935_0167623
1046 Ga0373935_0189880
1047 Ga0373935_0255626
1048 Ga0373935_0284632
1049 Ga0373927_0108408
1050 Ga0373927_0132110
1051 Ga0373927_0184055
1052 Ga0373933_0164167
1053 Ga0373947_0136962
1054 Ga0373947_0365793
1055 Ga0373937_0382347
1056 Ga0373937_0390445
1057 Ga0316582_0250181
1058 Ga0316582_0257896
1059 Ga0373925_0026850
1060 Ga0373925_0052739
1061 Ga0373925_0181422
1062 Ga0373925_0274961
1063 Ga0373925_0389572
1064 Ga0395899_0215275
1065 Ga0395901_0679651
1066 Ga0400483_165962
1067 Ga0436365_0966114
1068 Ga0436365_1923617
1069 Ga0436363_0018834
1070 Ga0436363_0312190
1071 Ga0436363_0928990
1072 Ga0436362_0747237
1073 Ga0439436_0033996
1074 Ga0439439_0036586
1075 Ga0439447_027919
1076 Ga0439453_0017139
1077 Ga0439461_0008144
1078 Ga0451791_1748283
1079 Ga0451793_0571572
1080 Ga0451806_119271
1081 Ga0451849_1486900
1082 Ga0451853_1048281
1083 Ga0439431_0031889
1084 Ga0439433_0038199
1085 Ga0439437_010248
1086 Ga0439441_031212
1087 Ga0439442_045953
1088 Ga0439445_0056208
1089 Ga0439432_056030
1090 Ga0439449_0138721
1091 Ga0439452_031173
1092 Ga0439454_009771
1093 Ga0439457_028826
1094 Ga0439462_0031121
1095 Ga0439462_0035441
1096 Ga0450898_016660
1097 Ga0450910_010059
1098 Ga0439446_0051970
1099 Ga0439458_0048142
1100 Ga0439434_0027544
1101 Ga0439435_0032471
1102 Ga0439459_0037588
1103 Ga0439464_0042650
1104 Ga0439460_0051046
1105 Ga0466969_0120383
1106 Ga0466966_0191340
1107 Ga0466961_0177888
1108 Ga0466963_0136281
1109 Ga0466964_0069974
1110 Ga0466964_0106656
1111 Ga0466971_0078765
1112 Ga0466968_0077765
1113 Ga0466970_0132543
1114 Ga0466957_0226723
1115 Ga0466959_0382595
1116 Ga0451576_0303015
1117 Ga0466958_0176781
1118 Ga0495617_101526
1119 Ga0495592_0068959
1120 Ga0495592_0334188
1121 Ga0495629_0004206
1122 Ga0495641_0088208
1123 Ga0495651_0049459
1124 Ga0495653_0043981
1125 Ga0495580_0205114
1126 Ga0495582_0030063
1127 Ga0495582_0039511
1128 Ga0495639_0073529
1129 Ga0495639_0101308
1130 Ga0495662_0112644
1131 Ga0495585_0122083
1132 Ga0495596_0035814
1133 Ga0495607_0183260
1134 Ga0495618_0005410
1135 Ga0495618_0322008
1136 Ga0495628_0091317
1137 Ga0495628_0274870
1138 Ga0495630_0264249
1139 Ga0495637_0085192
1140 Ga0495652_0137051
1141 Ga0495652_0177190
1142 Ga0495665_0034464
1143 Ga0495665_0130856
1144 Ga0495640_0005221
1145 Ga0495640_0178474
1146 Ga0495640_0192539
1147 Ga0495586_0133551
1148 Ga0495586_0160847
1149 Ga0495587_0195654
1150 Ga0495598_0099274
1151 Ga0495597_0164455
1152 Ga0495645_0257099
1153 Ga0495667_0008185
1154 Ga0495667_0191564
1155 Ga0495656_0148084
1156 Ga0495668_0126731
1157 Ga0495634_0179009
1158 Ga0495611_0070204
1159 Ga0495635_0002033
1160 Ga0495659_0022049
1161 Ga0495659_0120672
1162 Ga0495661_0177059
1163 Ga0495661_0205311
1164 Ga0495588_0135876
1165 Ga0495599_0348709
1166 Ga0495646_0015151
1167 Ga0495658_0007995
1168 Ga0495613_0069059
1169 Ga0495624_0149462
1170 Ga0495624_0149607
1171 Ga0495670_0028458
1172 Ga0495670_0040340
1173 Ga0495671_0003148
1174 Ga0495600_0084427
1175 Ga0495581_0096297
1176 Ga0495581_0102214
1177 Ga0495581_0186413
1178 Ga0495604_0076629
1179 Ga0495674_0002631
1180 Ga0495674_0253868
1181 Ga0495676_0229807
1182 Ga0495676_0237430
1183 Ga0495680_0001455
1184 Ga0495679_045467
1185 Ga0495673_0036266
1186 Ga0495684_0000464
1187 Ga0495686_0004864
1188 Ga0495593_0137444
1189 Ga0495614_0011434
1190 Ga0496101_0237315
1191 Ga0496102_0388194
1192 Ga0496102_0689833
1193 Ga0496103_0208364
1194 Ga0496104_0417735
1195 Ga0496104_0778559
1196 Ga0496105_0350605
1197 Ga0496106_0212744
1198 Ga0496110_0379246
1199 Ga0496111_0269719
1200 Ga0496112_0401425
1201 Ga0496112_0412018
1202 Ga0496114_0347574
1203 Ga0496114_0362511
1204 Ga0496114_0373830
1205 Ga0496115_0330471
1206 Ga0496115_0615396
1207 Ga0496125_0254716
1208 Ga0496126_0007244
1209 Ga0495682_0000540
1210 Ga0501300_000460
1211 Ga0501031_0187223
1212 Ga0501033_0006647
1213 Ga0501033_0095445
1214 Ga0501033_0229707
1215 Ga0501033_0384541
1216 Ga0501034_0078724
1217 Ga0501034_0276118
1218 Ga0501036_0003926
1219 Ga0501037_0210791
1220 Ga0501037_0226233
1221 Ga0501038_0179638
1222 Ga0501038_0302303
1223 Ga0501039_0154854
1224 Ga0501042_0248139
1225 Ga0501043_0011933
1226 Ga0501043_0275616
1227 Ga0501043_0315424
1228 Ga0501046_0226516
1229 Ga0501047_0000871
1230 Ga0501047_0397925
1231 Ga0501048_0197090
1232 Ga0501048_0207595
1233 Ga0501048_0262756
1234 Ga0501068_0191421
1235 Ga0501069_0137949
1236 Ga0501070_0250350
1237 Ga0501070_0267208
1238 Ga0501070_0298774
1239 Ga0501070_0303880
1240 Ga0501070_0362692
1241 Ga0501070_0477324
1242 Ga0501071_0145173
1243 Ga0501071_0437084
1244 Ga0501073_0039852
1245 Ga0501074_0162839
1246 Ga0501076_0671228
1247 Ga0501077_0314462
1248 Ga0501240_002662
1249 Ga0501079_0283211
1250 Ga0501079_0336290
1251 Ga0501080_0351650
1252 Ga0501083_0255308
1253 Ga0501280_000837
1254 Ga0501035_0194310
1255 Ga0501035_0297159
1256 Ga0501044_0247604
1257 Ga0501044_0351835
1258 Ga0501044_0617813
1259 Ga0501204_020216
1260 Ga0501226_004689
1261 nmdc:mga00v17_151397_c1
1262 nmdc:mga00v17_177806_c1
1263 nmdc:mga0yw44_217286_c1
1264 nmdc:mga0yw44_31548_c1
1265 nmdc:mga0yw44_442211_c1
1266 nmdc:mga0k408_139762_c1
1267 nmdc:mga0k408_68844_c1
1268 nmdc:mga06z11_135910_c1
1269 nmdc:mga06z11_174562_c1
1270 nmdc:mga07m45_11406_c1
1271 nmdc:mga08y16_432759_c1
1272 Ga0495601_0000907
1273 Ga0495601_0191747
1274 Ga0495612_0050047
1275 Ga0495595_0001429
1276 Ga0495619_0001195
1277 Ga0500595_055178
1278 Ga0500655_017384
1279 Ga0500559_0002048
1280 Ga0500559_0107805
1281 Ga0501084_0357294
1282 Ga0466962_0114097
1283 Ga0530510_0138411
1284 2558861057
1285 2558862948
1286 2558865537
1287 2558865747
1288 2558867121
1289 2558868156
1290 2776268343
1291 2776268484
1292 2861697042
1293 2889309758
1294 2889311933
1295 2889312010
1296 2889312411
1297 2896385283
1298 2919124274
1299 2919124353
1300 2928130861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

189

255

0.99

PF13333

rve_2

Integrase core domain

208

261

0.97

PF00665

rve

Integrase core domain

103

201

0.96

PF13276

HTH_21

HTH-like domain

33

91

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qbt-assembly1.cif.gz_A structure of the htlv-2 integrase catalytic core domain in complex with magnesium (trimeric form) 0.8731 104 259
3dlr-assembly1.cif.gz_A-2 crystal structure of the catalytic core domain from pfv integrase 0.8728 104 260
6qbt-assembly1.cif.gz_A structure of the htlv-2 integrase catalytic core domain in complex with magnesium (trimeric form) 0.8514 104 259
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8306 104 259
3ere-assembly1.cif.gz_D crystal structure of the arginine repressor protein from mycobacterium tuberculosis in complex with the dna operator 0.8296 39 79
ID Description Score Start End Superfamily
af_P37007_135_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9245 103 255 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9231 103 258 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9109 103 259 3.30.420.10
af_P0CF56_119_291_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9104 103 258 3.30.420.10
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9089 103 259 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2T1AC00-F1-model_v4 Integrase-like protein 0.9995 105 258 GO:0003676
GO:0015074
AF-A0A7U9A6C0-F1-model_v4 deleted 0.9984 113 259
AF-A0A839ZG82-F1-model_v4 Transposase InsO family protein 0.9973 115 259 GO:0003676
GO:0015074
AF-A0A837AND9-F1-model_v4 deleted 0.9934 107 259
AF-A0A3D0PVF2-F1-model_v4 IS3 family transposase 0.9934 115 259 GO:0003676
GO:0015074

Map