F472501
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 430 | 529 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100098820|Ga0070697_1000988202 |
| Length | 401 |
| Sequence | MFIIEQASFANATARQGDCSIRLIQKRASAMFRCNSTETEYALRVVDKVMEAAVPSRSESKVAVVGASGYAGEELVRLLLGHPQANLVAATSRQFAGKTLAQIFPRFSHDEKARQLRVAESEPTQLARMAEIIFLALPHGVSAEIARSLVDLGVRVIDLSADFRIRDPNVYKEFYGIDHRAPELLGEAVYGLPEIYREKIRAAKLVACPGCYPTSILLPLLPLIRGRIVESRSIIATSLSGVTGAGRKVEADYLFAECNESVRAYGVPKHRHLSEIEQELTILAGEKITVQFTPHLVPVNRGILSTIYVDLNRNNDPGVIDSFYEKAYRDEPFVRLLGEQRLPDTKEVIGTNFIDIAWRIDHRTRRLIVMSAIDNLIKGTSGQAIQCFNLMRDYPETTGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 12 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 13 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 14 | 2718217752 | Candidatus Xiphinematobacter sp. Idaho Grape | Isolate | Unclassified |
| 15 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 16 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 19 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 20 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 26 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 27 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 28 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 29 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 30 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 31 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 32 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 33 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 34 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 35 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 36 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 37 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 38 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 39 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 40 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 41 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 42 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 43 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 44 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 45 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 46 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 47 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 48 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 49 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 50 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 51 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 52 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 53 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 54 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 55 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 56 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 57 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 58 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 59 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 60 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 61 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 62 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 63 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 64 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 65 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 66 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 67 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 68 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 69 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 70 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 71 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 72 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 73 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 74 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 75 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 76 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 77 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 78 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 79 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 80 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 81 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 82 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 83 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 84 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 85 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 86 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 87 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 88 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 89 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 90 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 91 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 92 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 93 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 94 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 95 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 96 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 97 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 98 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 99 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 100 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 101 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 102 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 103 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 104 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 105 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 106 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 107 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 108 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 133 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 134 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 136 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 139 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 143 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 144 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 147 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 148 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 149 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 150 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 152 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 153 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 154 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 158 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 159 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 160 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 161 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 162 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 163 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 164 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 165 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 166 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 167 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 168 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 169 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 171 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 172 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 254 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 255 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 256 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 271 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 272 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 276 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 392 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 393 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 398 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 399 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 400 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 402 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 403 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 405 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 406 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 408 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 410 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 411 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 412 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 416 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 417 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 418 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 419 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 420 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 421 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 422 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 423 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 424 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 425 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 426 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 427 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 428 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 429 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 430 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.76 |
| Metatranscriptomes | 0 |
| Isolates | 18.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.85 |
| Nodule | 14.77 |
| Rhizoplane | 3.23 |
| Rhizosphere | 62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002928 | 3300003215 | Bacteria | 9662 |
| 2 | JGI25153J46596_10022590 | 3300003215 | Bacteria | 2313 |
| 3 | rootL2_10176537 | 3300003322 | Bacteria | 2043 |
| 4 | rootH1_10021139 | 3300003323 | Bacteria | 16333 |
| 5 | Ga0065165_1011557 | 3300005262 | Bacteria | 3665 |
| 6 | Ga0070658_10167908 | 3300005327 | Bacteria | 1843 |
| 7 | Ga0070658_10188276 | 3300005327 | Bacteria | 1739 |
| 8 | Ga0070683_100005606 | 3300005329 | Bacteria | 10489 |
| 9 | Ga0070683_100006772 | 3300005329 | Bacteria | 9631 |
| 10 | Ga0070680_100015488 | 3300005336 | Bacteria | 5980 |
| 11 | Ga0070680_100149426 | 3300005336 | Bacteria | 1961 |
| 12 | Ga0070668_100105438 | 3300005347 | Bacteria | 2238 |
| 13 | Ga0070669_100078653 | 3300005353 | Bacteria | 2452 |
| 14 | Ga0070669_100107058 | 3300005353 | Bacteria | 2117 |
| 15 | Ga0070675_100043941 | 3300005354 | Bacteria | 3654 |
| 16 | Ga0070675_100046550 | 3300005354 | Bacteria | 3552 |
| 17 | Ga0070671_100003024 | 3300005355 | Bacteria | 13093 |
| 18 | Ga0070674_100116470 | 3300005356 | Bacteria | 1971 |
| 19 | Ga0070674_100141033 | 3300005356 | Bacteria | 1809 |
| 20 | Ga0070674_100243525 | 3300005356 | Unclassified | 1409 |
| 21 | Ga0070674_100281720 | 3300005356 | Bacteria | 1318 |
| 22 | Ga0070667_100247234 | 3300005367 | Bacteria | 1594 |
| 23 | Ga0070709_10058345 | 3300005434 | Bacteria | 2447 |
| 24 | Ga0070709_10290993 | 3300005434 | Bacteria | 1190 |
| 25 | Ga0070714_100166333 | 3300005435 | Bacteria | 1999 |
| 26 | Ga0070714_100181389 | 3300005435 | Bacteria | 1916 |
| 27 | Ga0070714_100306355 | 3300005435 | Bacteria | 1482 |
| 28 | Ga0070713_100065531 | 3300005436 | Bacteria | 3052 |
| 29 | Ga0070713_100141477 | 3300005436 | Bacteria | 2132 |
| 30 | Ga0070713_100363358 | 3300005436 | Bacteria | 1345 |
| 31 | Ga0070710_10011469 | 3300005437 | Bacteria | 4378 |
| 32 | Ga0070711_100001071 | 3300005439 | Bacteria | 14608 |
| 33 | Ga0070711_100091166 | 3300005439 | Bacteria | 2196 |
| 34 | Ga0070694_100097086 | 3300005444 | Bacteria | 2078 |
| 35 | Ga0070708_100072247 | 3300005445 | Archaea | 3108 |
| 36 | Ga0070663_100087202 | 3300005455 | Bacteria | 2306 |
| 37 | Ga0070678_100174146 | 3300005456 | Bacteria | 1755 |
| 38 | Ga0070662_100047195 | 3300005457 | Bacteria | 3097 |
| 39 | Ga0070681_10031723 | 3300005458 | Bacteria | 5304 |
| 40 | Ga0070706_100001050 | 3300005467 | Bacteria | 30004 |
| 41 | Ga0070706_100011938 | 3300005467 | Bacteria | 8064 |
| 42 | Ga0070706_100075386 | 3300005467 | Unclassified | 3122 |
| 43 | Ga0070706_100131320 | 3300005467 | Bacteria | 2337 |
| 44 | Ga0070706_100144196 | 3300005467 | Bacteria | 2224 |
| 45 | Ga0070707_100000860 | 3300005468 | Bacteria | 30160 |
| 46 | Ga0070707_100048766 | 3300005468 | Bacteria | 4057 |
| 47 | Ga0070707_100117122 | 3300005468 | Bacteria | 2586 |
| 48 | Ga0070698_100008009 | 3300005471 | Bacteria | 11428 |
| 49 | Ga0070698_100009276 | 3300005471 | Bacteria | 10556 |
| 50 | Ga0070698_100137684 | 3300005471 | Bacteria | 2395 |
| 51 | Ga0070698_100245755 | 3300005471 | Unclassified | 1722 |
| 52 | Ga0070699_100014792 | 3300005518 | Bacteria | 6709 |
| 53 | Ga0070699_100022962 | 3300005518 | Bacteria | 5373 |
| 54 | Ga0070699_100041455 | 3300005518 | Bacteria | 3985 |
| 55 | Ga0070699_100091212 | 3300005518 | Bacteria | 2664 |
| 56 | Ga0070699_100189133 | 3300005518 | Bacteria | 1828 |
| 57 | Ga0070699_100228284 | 3300005518 | Bacteria | 1660 |
| 58 | Ga0070679_100026603 | 3300005530 | Bacteria | 5687 |
| 59 | Ga0070684_100013256 | 3300005535 | Bacteria | 6641 |
| 60 | Ga0070684_100037335 | 3300005535 | Bacteria | 4167 |
| 61 | Ga0070697_100002620 | 3300005536 | Bacteria | 13850 |
| 62 | Ga0070697_100031761 | 3300005536 | Bacteria | 4248 |
| 63 | Ga0070697_100081430 | 3300005536 | Bacteria | 2668 |
| 64 | Ga0070697_100098820 | 3300005536 | Bacteria | 2422 |
| 65 | Ga0070697_100142484 | 3300005536 | Bacteria | 2016 |
| 66 | Ga0070697_100233143 | 3300005536 | Bacteria | 1570 |
| 67 | Ga0068853_100000053 | 3300005539 | Bacteria | 85446 |
| 68 | Ga0068853_100244337 | 3300005539 | Bacteria | 1646 |
| 69 | Ga0070672_100339646 | 3300005543 | Bacteria | 1279 |
| 70 | Ga0070665_100028730 | 3300005548 | Bacteria | 5599 |
| 71 | Ga0070665_100053942 | 3300005548 | Bacteria | 4032 |
| 72 | Ga0070665_100090499 | 3300005548 | Bacteria | 3065 |
| 73 | Ga0070665_100098748 | 3300005548 | Bacteria | 2924 |
| 74 | Ga0068855_100146738 | 3300005563 | Bacteria | 2685 |
| 75 | Ga0068855_100353362 | 3300005563 | Bacteria | 1619 |
| 76 | Ga0070664_100298735 | 3300005564 | Bacteria | 1455 |
| 77 | Ga0068857_100006858 | 3300005577 | Bacteria | 9800 |
| 78 | Ga0068856_100390875 | 3300005614 | Bacteria | 1411 |
| 79 | Ga0068852_100077937 | 3300005616 | Bacteria | 2931 |
| 80 | Ga0068852_100123090 | 3300005616 | Bacteria | 2378 |
| 81 | Ga0068859_100468478 | 3300005617 | Bacteria | 1355 |
| 82 | Ga0068859_100505080 | 3300005617 | Unclassified | 1304 |
| 83 | Ga0068866_10106922 | 3300005718 | Bacteria | 1554 |
| 84 | Ga0068863_100205416 | 3300005841 | Bacteria | 1896 |
| 85 | Ga0068860_100008418 | 3300005843 | Bacteria | 10274 |
| 86 | Ga0068862_100078173 | 3300005844 | Bacteria | 2866 |
| 87 | Ga0081538_10016160 | 3300005981 | Bacteria | 5738 |
| 88 | Ga0081540_1000020 | 3300005983 | Bacteria | 163043 |
| 89 | Ga0081540_1003158 | 3300005983 | Bacteria | 13152 |
| 90 | Ga0081540_1021269 | 3300005983 | Bacteria | 3871 |
| 91 | Ga0070717_10033478 | 3300006028 | Bacteria | 4146 |
| 92 | Ga0070717_10064845 | 3300006028 | Unclassified | 3035 |
| 93 | Ga0070717_10065514 | 3300006028 | Bacteria | 3020 |
| 94 | Ga0070717_10068533 | 3300006028 | Bacteria | 2953 |
| 95 | Ga0070717_10366217 | 3300006028 | Unclassified | 1291 |
| 96 | Ga0075365_10053206 | 3300006038 | Bacteria | 2680 |
| 97 | Ga0075365_10230250 | 3300006038 | Bacteria | 1301 |
| 98 | Ga0075368_10002969 | 3300006042 | Bacteria | 5601 |
| 99 | Ga0075368_10016302 | 3300006042 | Bacteria | 2769 |
| 100 | Ga0075363_100147580 | 3300006048 | Bacteria | 1326 |
| 101 | Ga0070715_10016848 | 3300006163 | Bacteria | 2755 |
| 102 | Ga0070716_100132079 | 3300006173 | Bacteria | 1580 |
| 103 | Ga0070712_100238027 | 3300006175 | Unclassified | 1449 |
| 104 | Ga0075362_10073845 | 3300006177 | Bacteria | 1562 |
| 105 | Ga0075362_10106912 | 3300006177 | Bacteria | 1314 |
| 106 | Ga0075367_10076377 | 3300006178 | Bacteria | 2021 |
| 107 | Ga0075367_10111756 | 3300006178 | Bacteria | 1678 |
| 108 | Ga0075367_10121551 | 3300006178 | Bacteria | 1609 |
| 109 | Ga0075369_10084131 | 3300006186 | Bacteria | 1414 |
| 110 | Ga0075366_10001495 | 3300006195 | Bacteria | 11673 |
| 111 | Ga0075366_10015523 | 3300006195 | Bacteria | 4368 |
| 112 | Ga0075370_10039630 | 3300006353 | Bacteria | 2655 |
| 113 | Ga0075370_10069162 | 3300006353 | Bacteria | 2017 |
| 114 | Ga0075370_10143693 | 3300006353 | Bacteria | 1395 |
| 115 | Ga0075428_100041368 | 3300006844 | Bacteria | 5069 |
| 116 | Ga0075428_100055937 | 3300006844 | Bacteria | 4322 |
| 117 | Ga0075428_100502522 | 3300006844 | Bacteria | 1297 |
| 118 | Ga0075430_100040236 | 3300006846 | Bacteria | 3957 |
| 119 | Ga0075430_100372347 | 3300006846 | Bacteria | 1179 |
| 120 | Ga0075431_100036260 | 3300006847 | Bacteria | 5079 |
| 121 | Ga0075433_10036576 | 3300006852 | Bacteria | 4230 |
| 122 | Ga0075434_100140232 | 3300006871 | Bacteria | 2437 |
| 123 | Ga0075429_100015588 | 3300006880 | Bacteria | 6587 |
| 124 | Ga0075436_100027892 | 3300006914 | Bacteria | 3887 |
| 125 | Ga0075436_100085016 | 3300006914 | Bacteria | 2196 |
| 126 | Ga0097620_100468487 | 3300006931 | Bacteria | 1355 |
| 127 | Ga0097620_100505016 | 3300006931 | Unclassified | 1304 |
| 128 | Ga0075435_100070822 | 3300007076 | Bacteria | 2847 |
| 129 | Ga0099794_10029452 | 3300007265 | Bacteria | 2558 |
| 130 | Ga0099795_10007449 | 3300007788 | Bacteria | 3057 |
| 131 | Ga0111539_10014710 | 3300009094 | Bacteria | 9762 |
| 132 | Ga0111539_10042364 | 3300009094 | Bacteria | 5467 |
| 133 | Ga0105245_10324473 | 3300009098 | Bacteria | 1518 |
| 134 | Ga0114129_10002219 | 3300009147 | Bacteria | 26787 |
| 135 | Ga0114129_10060268 | 3300009147 | Bacteria | 5306 |
| 136 | Ga0105243_10001455 | 3300009148 | Bacteria | 20801 |
| 137 | Ga0105248_10040070 | 3300009177 | Bacteria | 5250 |
| 138 | Ga0105237_10080055 | 3300009545 | Bacteria | 3257 |
| 139 | Ga0105237_10270496 | 3300009545 | Bacteria | 1702 |
| 140 | Ga0105238_10014128 | 3300009551 | Bacteria | 8075 |
| 141 | Ga0105249_10173207 | 3300009553 | Bacteria | 2094 |
| 142 | Ga0105239_10112781 | 3300010375 | Bacteria | 3015 |
| 143 | Ga0157369_10003699 | 3300013105 | Bacteria | 18177 |
| 144 | Ga0157369_10016823 | 3300013105 | Bacteria | 8219 |
| 145 | Ga0157374_10053155 | 3300013296 | Bacteria | 3775 |
| 146 | Ga0157374_10092239 | 3300013296 | Bacteria | 2890 |
| 147 | Ga0157378_10023465 | 3300013297 | Bacteria | 5428 |
| 148 | Ga0157378_10225964 | 3300013297 | Unclassified | 1781 |
| 149 | Ga0157378_10338349 | 3300013297 | Bacteria | 1467 |
| 150 | Ga0157378_10594832 | 3300013297 | Bacteria | 1117 |
| 151 | Ga0157372_10053685 | 3300013307 | Bacteria | 4493 |
| 152 | Ga0157372_10136377 | 3300013307 | Unclassified | 2826 |
| 153 | Ga0163163_10109104 | 3300014325 | Bacteria | 2795 |
| 154 | Ga0157380_10214935 | 3300014326 | Bacteria | 1716 |
| 155 | Ga0157379_10124007 | 3300014968 | Bacteria | 2324 |
| 156 | Ga0157376_10047669 | 3300014969 | Unclassified | 3539 |
| 157 | Ga0157376_10467884 | 3300014969 | Bacteria | 1233 |
| 158 | Ga0157376_10550684 | 3300014969 | Bacteria | 1142 |
| 159 | Ga0209563_101672 | 3300025230 | Bacteria | 5636 |
| 160 | Ga0209677_102352 | 3300025253 | Bacteria | 7239 |
| 161 | Ga0209758_1002215 | 3300025297 | Bacteria | 20262 |
| 162 | Ga0209758_1002500 | 3300025297 | Bacteria | 18668 |
| 163 | Ga0209758_1003196 | 3300025297 | Bacteria | 15292 |
| 164 | Ga0209758_1024907 | 3300025297 | Bacteria | 2647 |
| 165 | Ga0207426_1007061 | 3300025302 | Bacteria | 4757 |
| 166 | Ga0207426_1007558 | 3300025302 | Bacteria | 4529 |
| 167 | Ga0209257_1034669 | 3300025304 | Bacteria | 1571 |
| 168 | Ga0207692_10129454 | 3300025898 | Bacteria | 1423 |
| 169 | Ga0207642_10208440 | 3300025899 | Bacteria | 1084 |
| 170 | Ga0207688_10032942 | 3300025901 | Bacteria | 2864 |
| 171 | Ga0207685_10055546 | 3300025905 | Bacteria | 1546 |
| 172 | Ga0207699_10089032 | 3300025906 | Bacteria | 1933 |
| 173 | Ga0207699_10255215 | 3300025906 | Bacteria | 1210 |
| 174 | Ga0207643_10116528 | 3300025908 | Bacteria | 1578 |
| 175 | Ga0207684_10001226 | 3300025910 | Bacteria | 28469 |
| 176 | Ga0207684_10059683 | 3300025910 | Bacteria | 3239 |
| 177 | Ga0207684_10087388 | 3300025910 | Bacteria | 2656 |
| 178 | Ga0207684_10138337 | 3300025910 | Unclassified | 2092 |
| 179 | Ga0207707_10015990 | 3300025912 | Bacteria | 6544 |
| 180 | Ga0207707_10092324 | 3300025912 | Bacteria | 2645 |
| 181 | Ga0207695_10280825 | 3300025913 | Bacteria | 1559 |
| 182 | Ga0207671_10013859 | 3300025914 | Bacteria | 6402 |
| 183 | Ga0207660_10272761 | 3300025917 | Bacteria | 1340 |
| 184 | Ga0207649_10110600 | 3300025920 | Bacteria | 1835 |
| 185 | Ga0207646_10000972 | 3300025922 | Bacteria | 36941 |
| 186 | Ga0207646_10001722 | 3300025922 | Bacteria | 26594 |
| 187 | Ga0207646_10010284 | 3300025922 | Bacteria | 9157 |
| 188 | Ga0207646_10097940 | 3300025922 | Bacteria | 2628 |
| 189 | Ga0207681_10200228 | 3300025923 | Bacteria | 1533 |
| 190 | Ga0207681_10355008 | 3300025923 | Bacteria | 1174 |
| 191 | Ga0207681_10385995 | 3300025923 | Bacteria | 1128 |
| 192 | Ga0207659_10088096 | 3300025926 | Bacteria | 2312 |
| 193 | Ga0207659_10094567 | 3300025926 | Bacteria | 2239 |
| 194 | Ga0207659_10268644 | 3300025926 | Bacteria | 1390 |
| 195 | Ga0207700_10021835 | 3300025928 | Bacteria | 4380 |
| 196 | Ga0207700_10120517 | 3300025928 | Bacteria | 2126 |
| 197 | Ga0207664_10149144 | 3300025929 | Unclassified | 1985 |
| 198 | Ga0207664_10241103 | 3300025929 | Bacteria | 1574 |
| 199 | Ga0207706_10221862 | 3300025933 | Bacteria | 1655 |
| 200 | Ga0207709_10001978 | 3300025935 | Bacteria | 13364 |
| 201 | Ga0207665_10033693 | 3300025939 | Bacteria | 3397 |
| 202 | Ga0207691_10287467 | 3300025940 | Bacteria | 1414 |
| 203 | Ga0207691_10380438 | 3300025940 | Bacteria | 1205 |
| 204 | Ga0207689_10023076 | 3300025942 | Bacteria | 5225 |
| 205 | Ga0207661_10003495 | 3300025944 | Bacteria | 10912 |
| 206 | Ga0207661_10079177 | 3300025944 | Bacteria | 2708 |
| 207 | Ga0207661_10100708 | 3300025944 | Bacteria | 2425 |
| 208 | Ga0207661_10209159 | 3300025944 | Bacteria | 1719 |
| 209 | Ga0207679_10007469 | 3300025945 | Bacteria | 6937 |
| 210 | Ga0207679_10282194 | 3300025945 | Bacteria | 1425 |
| 211 | Ga0207667_10154237 | 3300025949 | Bacteria | 2364 |
| 212 | Ga0207667_10394908 | 3300025949 | Bacteria | 1408 |
| 213 | Ga0207651_10004939 | 3300025960 | Bacteria | 6807 |
| 214 | Ga0207651_10247015 | 3300025960 | Bacteria | 1458 |
| 215 | Ga0207668_10297558 | 3300025972 | Bacteria | 1330 |
| 216 | Ga0207658_10321648 | 3300025986 | Bacteria | 1339 |
| 217 | Ga0207677_10270995 | 3300026023 | Bacteria | 1389 |
| 218 | Ga0207703_10039350 | 3300026035 | Bacteria | 3779 |
| 219 | Ga0207703_10200593 | 3300026035 | Bacteria | 1773 |
| 220 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 221 | Ga0207639_10053911 | 3300026041 | Bacteria | 3071 |
| 222 | Ga0207639_10073292 | 3300026041 | Bacteria | 2684 |
| 223 | Ga0207639_10108702 | 3300026041 | Bacteria | 2255 |
| 224 | Ga0207639_10130893 | 3300026041 | Bacteria | 2077 |
| 225 | Ga0207678_10049664 | 3300026067 | Bacteria | 3626 |
| 226 | Ga0207678_10062685 | 3300026067 | Bacteria | 3195 |
| 227 | Ga0207641_10222569 | 3300026088 | Bacteria | 1751 |
| 228 | Ga0207683_10108103 | 3300026121 | Bacteria | 2489 |
| 229 | Ga0207683_10195592 | 3300026121 | Bacteria | 1837 |
| 230 | Ga0207683_10234524 | 3300026121 | Bacteria | 1673 |
| 231 | Ga0209389_1000969 | 3300027296 | Bacteria | 18934 |
| 232 | Ga0209489_108549 | 3300027361 | Bacteria | 13807 |
| 233 | Ga0209700_100036 | 3300027363 | Bacteria | 187888 |
| 234 | Ga0209588_1020310 | 3300027671 | Bacteria | 2080 |
| 235 | Ga0207428_10033516 | 3300027907 | Bacteria | 4218 |
| 236 | Ga0268266_10054352 | 3300028379 | Bacteria | 3440 |
| 237 | Ga0268266_10200038 | 3300028379 | Unclassified | 1828 |
| 238 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 239 | Ga0265319_1001566 | 3300028563 | Bacteria | 13424 |
| 240 | Ga0265319_1008064 | 3300028563 | Bacteria | 4656 |
| 241 | Ga0265319_1011763 | 3300028563 | Bacteria | 3565 |
| 242 | Ga0307515_10272445 | 3300028794 | Bacteria | 1412 |
| 243 | Ga0265338_10079347 | 3300028800 | Bacteria | 2762 |
| 244 | Ga0265338_10084077 | 3300028800 | Unclassified | 2658 |
| 245 | Ga0265338_10126950 | 3300028800 | Bacteria | 2022 |
| 246 | Ga0307511_10129144 | 3300030521 | Bacteria | 1529 |
| 247 | Ga0265325_10070043 | 3300031241 | Bacteria | 1762 |
| 248 | Ga0265339_10019806 | 3300031249 | Bacteria | 3941 |
| 249 | Ga0265331_10070824 | 3300031250 | Bacteria | 1632 |
| 250 | Ga0265316_10034216 | 3300031344 | Bacteria | 4129 |
| 251 | Ga0307408_100001553 | 3300031548 | Bacteria | 16983 |
| 252 | Ga0307408_100005094 | 3300031548 | Bacteria | 8817 |
| 253 | Ga0307508_10001059 | 3300031616 | Bacteria | 31801 |
| 254 | Ga0307508_10060565 | 3300031616 | Bacteria | 3346 |
| 255 | Ga0307508_10110406 | 3300031616 | Bacteria | 2349 |
| 256 | Ga0265342_10002731 | 3300031712 | Bacteria | 15016 |
| 257 | Ga0316576_10000938 | 3300031727 | Bacteria | 14898 |
| 258 | Ga0316578_10006890 | 3300031728 | Bacteria | 5649 |
| 259 | Ga0307516_10015493 | 3300031730 | Bacteria | 8019 |
| 260 | Ga0316577_10011046 | 3300031733 | Bacteria | 4885 |
| 261 | Ga0307406_10000620 | 3300031901 | Bacteria | 20259 |
| 262 | Ga0307409_100030172 | 3300031995 | Bacteria | 3892 |
| 263 | Ga0307409_100090269 | 3300031995 | Bacteria | 2508 |
| 264 | Ga0307415_100052195 | 3300032126 | Bacteria | 2779 |
| 265 | Ga0307510_10010241 | 3300033180 | Bacteria | 11147 |
| 266 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 267 | Ga0373944_0005144 | 3300035089 | Bacteria | 3437 |
| 268 | Ga0373945_0008018 | 3300035116 | Bacteria | 3430 |
| 269 | Ga0373945_0021013 | 3300035116 | Bacteria | 2239 |
| 270 | Ga0373943_0049080 | 3300035170 | Bacteria | 2070 |
| 271 | Ga0373946_0003228 | 3300035171 | Bacteria | 5789 |
| 272 | Ga0373955_0035662 | 3300035172 | Bacteria | 2635 |
| 273 | Ga0373924_0006263 | 3300035410 | Bacteria | 4256 |
| 274 | Ga0373924_0017596 | 3300035410 | Bacteria | 2744 |
| 275 | Ga0373931_0037237 | 3300035691 | Bacteria | 2540 |
| 276 | Ga0373931_0190368 | 3300035691 | Bacteria | 1220 |
| 277 | Ga0373935_0000435 | 3300035692 | Bacteria | 21766 |
| 278 | Ga0373927_0002587 | 3300035695 | Bacteria | 13194 |
| 279 | Ga0373927_0008673 | 3300035695 | Bacteria | 6833 |
| 280 | Ga0373927_0183294 | 3300035695 | Bacteria | 1374 |
| 281 | Ga0373933_0031946 | 3300035724 | Bacteria | 3057 |
| 282 | Ga0373933_0178204 | 3300035724 | Bacteria | 1355 |
| 283 | Ga0373947_0007586 | 3300035725 | Bacteria | 6278 |
| 284 | Ga0373947_0012060 | 3300035725 | Bacteria | 4949 |
| 285 | Ga0373947_0036798 | 3300035725 | Bacteria | 2903 |
| 286 | Ga0373947_0160666 | 3300035725 | Bacteria | 1453 |
| 287 | Ga0373937_0026658 | 3300036401 | Bacteria | 5221 |
| 288 | Ga0373937_0357645 | 3300036401 | Bacteria | 1383 |
| 289 | Ga0373925_0001774 | 3300037068 | Bacteria | 18013 |
| 290 | Ga0373925_0039911 | 3300037068 | Bacteria | 3474 |
| 291 | Ga0373925_0054102 | 3300037068 | Bacteria | 3001 |
| 292 | Ga0373925_0103549 | 3300037068 | Bacteria | 2191 |
| 293 | Ga0373925_0113488 | 3300037068 | Bacteria | 2096 |
| 294 | Ga0373925_0336507 | 3300037068 | Bacteria | 1224 |
| 295 | Ga0436364_0699776 | 3300037853 | Bacteria | 2850 |
| 296 | Ga0400490_08718 | 3300038726 | Bacteria | 17463 |
| 297 | Ga0400491_02437 | 3300038727 | Bacteria | 3312 |
| 298 | Ga0400483_206430 | 3300039062 | Bacteria | 78978 |
| 299 | Ga0436365_0417128 | 3300039437 | Bacteria | 2498 |
| 300 | Ga0436365_0584888 | 3300039437 | Bacteria | 2364 |
| 301 | Ga0436365_1401961 | 3300039437 | Bacteria | 2404 |
| 302 | Ga0436363_1347498 | 3300039450 | Bacteria | 5320 |
| 303 | Ga0451793_1479997 | 3300041452 | Bacteria | 1221 |
| 304 | Ga0450923_021562 | 3300042125 | Bacteria | 1257 |
| 305 | Ga0439446_0005273 | 3300042156 | Unclassified | 3319 |
| 306 | Ga0439434_0046397 | 3300042435 | Unclassified | 1341 |
| 307 | Ga0451577_0000011 | 3300042876 | Bacteria | 597389 |
| 308 | Ga0451577_0006289 | 3300042876 | Bacteria | 11889 |
| 309 | Ga0451577_0018580 | 3300042876 | Bacteria | 6402 |
| 310 | Ga0451577_0075704 | 3300042876 | Bacteria | 3001 |
| 311 | Ga0451577_0225061 | 3300042876 | Bacteria | 1696 |
| 312 | Ga0453683_0000007 | 3300044673 | Bacteria | 581341 |
| 313 | Ga0453683_0000043 | 3300044673 | Bacteria | 217530 |
| 314 | Ga0453684_0000224 | 3300044712 | Bacteria | 248668 |
| 315 | Ga0453684_0009668 | 3300044712 | Bacteria | 16795 |
| 316 | Ga0453684_0300983 | 3300044712 | Bacteria | 1823 |
| 317 | Ga0466957_0028272 | 3300044842 | Bacteria | 3338 |
| 318 | Ga0466959_0011001 | 3300045049 | Bacteria | 6494 |
| 319 | Ga0466959_0043000 | 3300045049 | Bacteria | 3332 |
| 320 | Ga0466959_0247568 | 3300045049 | Bacteria | 1230 |
| 321 | Ga0451576_0009359 | 3300045051 | Bacteria | 11362 |
| 322 | Ga0451576_0016026 | 3300045051 | Bacteria | 8282 |
| 323 | Ga0451576_0124221 | 3300045051 | Bacteria | 2689 |
| 324 | Ga0451576_0226593 | 3300045051 | Bacteria | 1952 |
| 325 | Ga0451576_0371263 | 3300045051 | Bacteria | 1499 |
| 326 | Ga0466958_0017952 | 3300045836 | Bacteria | 4100 |
| 327 | Ga0495592_0047468 | 3300046454 | Bacteria | 3198 |
| 328 | Ga0495592_0125968 | 3300046454 | Bacteria | 1797 |
| 329 | Ga0495603_0001446 | 3300046455 | Bacteria | 13824 |
| 330 | Ga0495603_0046198 | 3300046455 | Bacteria | 2595 |
| 331 | Ga0495603_0110991 | 3300046455 | Bacteria | 1600 |
| 332 | Ga0495629_0008069 | 3300046459 | Bacteria | 7750 |
| 333 | Ga0495629_0046573 | 3300046459 | Bacteria | 3042 |
| 334 | Ga0495629_0128970 | 3300046459 | Bacteria | 1762 |
| 335 | Ga0495638_0052409 | 3300046460 | Bacteria | 2541 |
| 336 | Ga0495638_0086536 | 3300046460 | Bacteria | 1894 |
| 337 | Ga0495641_0007242 | 3300046461 | Bacteria | 6978 |
| 338 | Ga0495651_0018417 | 3300046462 | Bacteria | 5409 |
| 339 | Ga0495651_0034663 | 3300046462 | Bacteria | 3934 |
| 340 | Ga0495651_0073151 | 3300046462 | Bacteria | 2602 |
| 341 | Ga0495653_0272292 | 3300046463 | Bacteria | 1115 |
| 342 | Ga0495580_0001310 | 3300046472 | Bacteria | 21988 |
| 343 | Ga0495580_0171641 | 3300046472 | Bacteria | 1499 |
| 344 | Ga0495582_0000545 | 3300046473 | Bacteria | 20797 |
| 345 | Ga0495582_0019184 | 3300046473 | Bacteria | 3741 |
| 346 | Ga0495639_0010592 | 3300046475 | Bacteria | 3970 |
| 347 | Ga0495662_0000429 | 3300046476 | Bacteria | 18792 |
| 348 | Ga0495664_0022116 | 3300046477 | Bacteria | 3681 |
| 349 | Ga0495664_0097184 | 3300046477 | Bacteria | 1772 |
| 350 | Ga0495664_0173577 | 3300046477 | Bacteria | 1308 |
| 351 | Ga0495584_0025083 | 3300046491 | Bacteria | 3022 |
| 352 | Ga0495594_0000020 | 3300046499 | Bacteria | 80534 |
| 353 | Ga0495606_0045016 | 3300046507 | Bacteria | 2929 |
| 354 | Ga0495618_0061407 | 3300046514 | Bacteria | 2384 |
| 355 | Ga0495628_0159369 | 3300046516 | Bacteria | 1715 |
| 356 | Ga0495630_0010792 | 3300046517 | Bacteria | 6594 |
| 357 | Ga0495630_0044087 | 3300046517 | Bacteria | 3333 |
| 358 | Ga0495632_0040857 | 3300046519 | Bacteria | 2333 |
| 359 | Ga0495643_0142019 | 3300046522 | Bacteria | 1196 |
| 360 | Ga0495644_0062393 | 3300046523 | Bacteria | 1400 |
| 361 | Ga0495648_0153077 | 3300046524 | Bacteria | 1201 |
| 362 | Ga0495666_0034184 | 3300046526 | Bacteria | 2481 |
| 363 | Ga0495652_0111764 | 3300046529 | Bacteria | 2196 |
| 364 | Ga0495665_0000170 | 3300046531 | Bacteria | 32921 |
| 365 | Ga0495665_0107724 | 3300046531 | Bacteria | 1462 |
| 366 | Ga0495640_0002547 | 3300046533 | Bacteria | 14649 |
| 367 | Ga0495586_0111222 | 3300046535 | Bacteria | 1525 |
| 368 | Ga0495587_0060059 | 3300046536 | Bacteria | 2230 |
| 369 | Ga0495609_0025737 | 3300046538 | Bacteria | 2696 |
| 370 | Ga0495622_0002079 | 3300046557 | Bacteria | 9785 |
| 371 | Ga0495622_0026866 | 3300046557 | Bacteria | 2686 |
| 372 | Ga0495633_0058257 | 3300046558 | Bacteria | 1813 |
| 373 | Ga0495667_0046148 | 3300046559 | Bacteria | 2882 |
| 374 | Ga0495656_0012948 | 3300046615 | Bacteria | 3092 |
| 375 | Ga0495634_0000998 | 3300046642 | Bacteria | 26678 |
| 376 | Ga0495634_0104132 | 3300046642 | Bacteria | 1831 |
| 377 | Ga0495635_0030879 | 3300046663 | Bacteria | 3722 |
| 378 | Ga0495635_0240549 | 3300046663 | Bacteria | 1221 |
| 379 | Ga0495588_0010035 | 3300046674 | Bacteria | 4389 |
| 380 | Ga0495588_0015435 | 3300046674 | Bacteria | 3676 |
| 381 | Ga0495588_0046936 | 3300046674 | Bacteria | 2216 |
| 382 | Ga0495599_0006305 | 3300046678 | Bacteria | 7147 |
| 383 | Ga0495599_0049469 | 3300046678 | Bacteria | 2635 |
| 384 | Ga0495599_0049581 | 3300046678 | Bacteria | 2632 |
| 385 | Ga0495599_0107295 | 3300046678 | Bacteria | 1740 |
| 386 | Ga0495623_0085754 | 3300046679 | Bacteria | 1942 |
| 387 | Ga0495646_0040056 | 3300046680 | Bacteria | 2887 |
| 388 | Ga0495646_0095903 | 3300046680 | Bacteria | 1706 |
| 389 | Ga0495647_0001303 | 3300046681 | Bacteria | 7665 |
| 390 | Ga0495658_0002344 | 3300046683 | Bacteria | 9568 |
| 391 | Ga0495658_0117760 | 3300046683 | Bacteria | 1603 |
| 392 | Ga0495613_0017244 | 3300046689 | Bacteria | 5380 |
| 393 | Ga0495624_0009089 | 3300046690 | Bacteria | 6894 |
| 394 | Ga0495649_0106080 | 3300046694 | Bacteria | 1491 |
| 395 | Ga0495649_0110719 | 3300046694 | Bacteria | 1456 |
| 396 | Ga0495600_0179951 | 3300046809 | Bacteria | 1363 |
| 397 | Ga0495600_0223757 | 3300046809 | Bacteria | 1203 |
| 398 | Ga0495581_0003140 | 3300047315 | Bacteria | 9453 |
| 399 | Ga0495581_0023393 | 3300047315 | Bacteria | 3580 |
| 400 | Ga0495674_0000600 | 3300047319 | Bacteria | 33795 |
| 401 | Ga0495674_0077886 | 3300047319 | Bacteria | 2850 |
| 402 | Ga0495676_0037688 | 3300047321 | Bacteria | 4021 |
| 403 | Ga0495676_0049266 | 3300047321 | Bacteria | 3389 |
| 404 | Ga0495676_0196207 | 3300047321 | Bacteria | 1405 |
| 405 | Ga0495685_029342 | 3300047447 | Bacteria | 1891 |
| 406 | Ga0495684_0035362 | 3300047471 | Bacteria | 3831 |
| 407 | Ga0495684_0041506 | 3300047471 | Bacteria | 3526 |
| 408 | Ga0495684_0067514 | 3300047471 | Bacteria | 2719 |
| 409 | Ga0495686_0140430 | 3300047472 | Bacteria | 1426 |
| 410 | Ga0495593_0005773 | 3300047673 | Bacteria | 7300 |
| 411 | Ga0495602_0290638 | 3300048088 | Bacteria | 1200 |
| 412 | Ga0495614_0028553 | 3300048089 | Bacteria | 2403 |
| 413 | Ga0496101_0045055 | 3300048904 | Bacteria | 3158 |
| 414 | Ga0496102_0790019 | 3300048905 | Bacteria | 872 |
| 415 | Ga0496103_0182648 | 3300048906 | Bacteria | 1348 |
| 416 | Ga0496104_0070744 | 3300048907 | Bacteria | 3317 |
| 417 | Ga0496105_0065322 | 3300048908 | Bacteria | 3003 |
| 418 | Ga0496105_0124932 | 3300048908 | Bacteria | 2121 |
| 419 | Ga0496106_0008202 | 3300048909 | Bacteria | 7720 |
| 420 | Ga0496106_0085862 | 3300048909 | Bacteria | 2423 |
| 421 | Ga0496106_0251821 | 3300048909 | Bacteria | 1412 |
| 422 | Ga0496107_0050312 | 3300048910 | Bacteria | 3004 |
| 423 | Ga0496108_0096675 | 3300048911 | Bacteria | 2516 |
| 424 | Ga0496110_0071103 | 3300048913 | Bacteria | 3084 |
| 425 | Ga0496111_0071461 | 3300048914 | Bacteria | 2526 |
| 426 | Ga0496111_0085614 | 3300048914 | Bacteria | 2305 |
| 427 | Ga0496111_0160899 | 3300048914 | Bacteria | 1667 |
| 428 | Ga0496112_0034260 | 3300048915 | Bacteria | 4940 |
| 429 | Ga0496112_0386985 | 3300048915 | Bacteria | 1339 |
| 430 | Ga0496114_0105958 | 3300048917 | Bacteria | 2405 |
| 431 | Ga0496115_0038527 | 3300048918 | Bacteria | 3793 |
| 432 | Ga0496115_0196810 | 3300048918 | Bacteria | 1665 |
| 433 | Ga0496116_0049722 | 3300048919 | Bacteria | 2800 |
| 434 | Ga0496116_0080543 | 3300048919 | Bacteria | 2022 |
| 435 | Ga0496117_0012161 | 3300048920 | Bacteria | 7622 |
| 436 | Ga0496117_0130733 | 3300048920 | Bacteria | 1522 |
| 437 | Ga0496118_0001670 | 3300048921 | Bacteria | 32550 |
| 438 | Ga0496118_0075771 | 3300048921 | Bacteria | 2397 |
| 439 | Ga0496119_0074812 | 3300048922 | Bacteria | 1971 |
| 440 | Ga0496121_0000183 | 3300048924 | Bacteria | 139168 |
| 441 | Ga0496121_0072999 | 3300048924 | Bacteria | 2752 |
| 442 | Ga0496121_0118231 | 3300048924 | Bacteria | 2007 |
| 443 | Ga0496121_0157177 | 3300048924 | Bacteria | 1667 |
| 444 | Ga0496124_0001382 | 3300048927 | Bacteria | 36359 |
| 445 | Ga0496124_0033784 | 3300048927 | Bacteria | 4496 |
| 446 | Ga0496125_0048308 | 3300048928 | Bacteria | 3550 |
| 447 | Ga0496126_0004782 | 3300048929 | Bacteria | 15924 |
| 448 | Ga0496126_0008321 | 3300048929 | Bacteria | 11202 |
| 449 | Ga0496126_0013413 | 3300048929 | Bacteria | 8338 |
| 450 | Ga0496126_0042307 | 3300048929 | Bacteria | 4208 |
| 451 | Ga0496126_0061727 | 3300048929 | Bacteria | 3366 |
| 452 | Ga0496126_0093975 | 3300048929 | Bacteria | 2632 |
| 453 | Ga0495682_0041561 | 3300049460 | Bacteria | 1685 |
| 454 | Ga0501034_0148900 | 3300049571 | Bacteria | 2317 |
| 455 | Ga0501047_0014124 | 3300049581 | Bacteria | 7588 |
| 456 | Ga0501048_0308176 | 3300049582 | Bacteria | 1127 |
| 457 | Ga0501070_0148579 | 3300049586 | Bacteria | 1934 |
| 458 | Ga0501070_0204740 | 3300049586 | Bacteria | 1620 |
| 459 | Ga0501071_0025032 | 3300049587 | Bacteria | 4179 |
| 460 | Ga0501073_0037221 | 3300049589 | Bacteria | 3456 |
| 461 | Ga0501073_0062010 | 3300049589 | Bacteria | 2608 |
| 462 | Ga0501073_0115904 | 3300049589 | Bacteria | 1857 |
| 463 | Ga0501075_0118924 | 3300049591 | Bacteria | 2010 |
| 464 | Ga0501075_0148936 | 3300049591 | Unclassified | 1784 |
| 465 | Ga0501079_0074514 | 3300049741 | Bacteria | 2624 |
| 466 | Ga0501080_0142049 | 3300049742 | Bacteria | 2219 |
| 467 | Ga0501035_0210772 | 3300049822 | Bacteria | 1662 |
| 468 | Ga0501044_0070718 | 3300049823 | Bacteria | 3549 |
| 469 | Ga0501044_0137022 | 3300049823 | Bacteria | 2439 |
| 470 | Ga0501045_0060948 | 3300049824 | Bacteria | 2767 |
| 471 | nmdc:mga03683_118025_c1 | 3300050489 | Bacteria | 1177 |
| 472 | nmdc:mga03n38_10058_c1 | 3300050490 | Bacteria | 3465 |
| 473 | nmdc:mga0k408_14943_c1 | 3300050493 | Bacteria | 4288 |
| 474 | nmdc:mga0k408_16841_c1 | 3300050493 | Bacteria | 4063 |
| 475 | nmdc:mga0k408_18216_c1 | 3300050493 | Bacteria | 3918 |
| 476 | nmdc:mga06z11_50511_c1 | 3300050494 | Bacteria | 2126 |
| 477 | nmdc:mga06z11_94845_c1 | 3300050494 | Bacteria | 1627 |
| 478 | nmdc:mga07m45_28463_c1 | 3300050496 | Bacteria | 3084 |
| 479 | nmdc:mga05p37_386_c1 | 3300050507 | Bacteria | 47260 |
| 480 | nmdc:mga05p37_49134_c1 | 3300050507 | Bacteria | 5189 |
| 481 | nmdc:mga09592_21012_c1 | 3300050508 | Bacteria | 5375 |
| 482 | nmdc:mga0qj67_23455_c1 | 3300050509 | Bacteria | 4748 |
| 483 | nmdc:mga06r32_3877_c1 | 3300050510 | Bacteria | 13395 |
| 484 | nmdc:mga08y16_114740_c1 | 3300050511 | Bacteria | 2804 |
| 485 | nmdc:mga08y16_4487_c1 | 3300050511 | Bacteria | 14585 |
| 486 | nmdc:mga0n895_36005_c1 | 3300050512 | Bacteria | 4776 |
| 487 | nmdc:mga0rr50_5199_c1 | 3300050513 | Bacteria | 7738 |
| 488 | nmdc:mga0a205_44880_c1 | 3300050515 | Bacteria | 4262 |
| 489 | nmdc:mga0sz30_35016_c1 | 3300050516 | Bacteria | 2093 |
| 490 | Ga0495601_0035091 | 3300053077 | Unclassified | 3130 |
| 491 | Ga0495601_0135335 | 3300053077 | Bacteria | 1606 |
| 492 | Ga0495612_0027346 | 3300053078 | Bacteria | 2293 |
| 493 | Ga0495612_0060219 | 3300053078 | Bacteria | 1571 |
| 494 | Ga0495619_0137558 | 3300053085 | Bacteria | 1680 |
| 495 | Ga0495619_0227812 | 3300053085 | Unclassified | 1291 |
| 496 | Ga0500583_0099368 | 3300053092 | Bacteria | 1424 |
| 497 | Ga0500651_0042489 | 3300053093 | Bacteria | 2864 |
| 498 | Ga0500566_0001358 | 3300053094 | Bacteria | 14315 |
| 499 | Ga0500640_046339 | 3300053095 | Bacteria | 1906 |
| 500 | Ga0500641_0017411 | 3300053096 | Bacteria | 2687 |
| 501 | Ga0500641_0034704 | 3300053096 | Bacteria | 2009 |
| 502 | Ga0500555_000354 | 3300053103 | Bacteria | 19470 |
| 503 | Ga0500557_000071 | 3300053105 | Bacteria | 39461 |
| 504 | Ga0500569_054745 | 3300053109 | Bacteria | 1215 |
| 505 | Ga0500594_0042173 | 3300053118 | Bacteria | 1253 |
| 506 | Ga0500595_002414 | 3300053119 | Bacteria | 9324 |
| 507 | Ga0500595_017347 | 3300053119 | Bacteria | 2659 |
| 508 | Ga0500642_0000132 | 3300053130 | Bacteria | 33714 |
| 509 | Ga0500642_0052489 | 3300053130 | Bacteria | 1805 |
| 510 | Ga0500642_0080193 | 3300053130 | Bacteria | 1498 |
| 511 | Ga0500573_0034401 | 3300053140 | Bacteria | 2923 |
| 512 | Ga0500616_0001441 | 3300053153 | Bacteria | 22831 |
| 513 | Ga0500620_002592 | 3300053155 | Bacteria | 3682 |
| 514 | Ga0500620_053111 | 3300053155 | Bacteria | 1364 |
| 515 | Ga0500634_0037633 | 3300053161 | Bacteria | 2631 |
| 516 | Ga0500636_0000206 | 3300053177 | Bacteria | 31849 |
| 517 | Ga0500636_0044375 | 3300053177 | Bacteria | 2622 |
| 518 | Ga0500625_002939 | 3300053729 | Bacteria | 6573 |
| 519 | Ga0500645_000232 | 3300053730 | Bacteria | 42429 |
| 520 | Ga0500645_009547 | 3300053730 | Bacteria | 3255 |
| 521 | Ga0500645_021447 | 3300053730 | Unclassified | 1994 |
| 522 | Ga0500596_003022 | 3300053735 | Bacteria | 3246 |
| 523 | Ga0590071_000105 | 3300059421 | Bacteria | 24044 |
| 524 | Ga0590074_001380 | 3300059423 | Bacteria | 3888 |
| 525 | Ga0590075_001105 | 3300059424 | Bacteria | 6954 |
| 526 | Ga0590075_028523 | 3300059424 | Bacteria | 1410 |
| 527 | Ga0501082_0055092 | 3300060353 | Bacteria | 3427 |
| 528 | Ga0466962_0035597 | 3300061719 | Bacteria | 2383 |
| 529 | Ga0530510_0300863 | 3300061734 | Bacteria | 1200 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0371263 | Ga0451576_0371263_386_1210 | 270 |
| 2 | 3300048905 | Ga0496102_0790019 | Ga0496102_0790019_19_843 | 270 |
| 3 | 3300048909 | Ga0496106_0251821 | Ga0496106_0251821_157_981 | 270 |
| 4 | 3300030521 | Ga0307511_10129144 | Ga0307511_101291442 | 305 |
| 5 | 3300046463 | Ga0495653_0272292 | Ga0495653_0272292_178_1095 | 305 |
| 6 | 3300046535 | Ga0495586_0111222 | Ga0495586_0111222_61_978 | 305 |
| 7 | 3300046558 | Ga0495633_0058257 | Ga0495633_0058257_11_928 | 305 |
| 8 | 3300046642 | Ga0495634_0104132 | Ga0495634_0104132_849_1766 | 305 |
| 9 | 3300047321 | Ga0495676_0196207 | Ga0495676_0196207_11_928 | 305 |
| 10 | 3300009147 | Ga0114129_10002219 | Ga0114129_1000221916 | 306 |
| 11 | 3300050507 | nmdc:mga05p37_386_c1 | nmdc:mga05p37_386_c1_41603_42535 | 306 |
| 12 | 3300006042 | Ga0075368_10016302 | Ga0075368_100163023 | 309 |
| 13 | 3300013297 | Ga0157378_10594832 | Ga0157378_105948321 | 312 |
| 14 | 3300006844 | Ga0075428_100502522 | Ga0075428_1005025221 | 318 |
| 15 | 3300038726 | Ga0400490_08718 | Ga0400490_08718_6645_7682 | 319 |
| 16 | 3300038727 | Ga0400491_02437 | Ga0400491_02437_460_1497 | 319 |
| 17 | 3300013296 | Ga0157374_10053155 | Ga0157374_100531552 | 320 |
| 18 | 3300013307 | Ga0157372_10053685 | Ga0157372_100536852 | 320 |
| 19 | 3300028563 | Ga0265319_1001566 | Ga0265319_10015664 | 321 |
| 20 | 3300028563 | Ga0265319_1011763 | Ga0265319_10117633 | 321 |
| 21 | 3300025922 | Ga0207646_10010284 | Ga0207646_100102845 | 322 |
| 22 | 3300025944 | Ga0207661_10209159 | Ga0207661_102091591 | 322 |
| 23 | 3300053153 | Ga0500616_0001441 | Ga0500616_0001441_13115_14101 | 322 |
| 24 | 3300059424 | Ga0590075_028523 | Ga0590075_028523_356_1345 | 322 |
| 25 | 3300045051 | Ga0451576_0009359 | Ga0451576_0009359_4277_5266 | 324 |
| 26 | 3300005548 | Ga0070665_100098748 | Ga0070665_1000987482 | 325 |
| 27 | 3300006852 | Ga0075433_10036576 | Ga0075433_100365762 | 325 |
| 28 | 3300009177 | Ga0105248_10040070 | Ga0105248_100400705 | 325 |
| 29 | 3300014969 | Ga0157376_10550684 | Ga0157376_105506841 | 325 |
| 30 | 3300049582 | Ga0501048_0308176 | Ga0501048_0308176_35_1027 | 325 |
| 31 | 3300049589 | Ga0501073_0037221 | Ga0501073_0037221_1392_2387 | 325 |
| 32 | 3300049591 | Ga0501075_0118924 | Ga0501075_0118924_828_1823 | 325 |
| 33 | 3300049741 | Ga0501079_0074514 | Ga0501079_0074514_136_1131 | 325 |
| 34 | 3300049824 | Ga0501045_0060948 | Ga0501045_0060948_1411_2403 | 325 |
| 35 | 3300050515 | nmdc:mga0a205_44880_c1 | nmdc:mga0a205_44880_c1_2744_3739 | 325 |
| 36 | 3300060353 | Ga0501082_0055092 | Ga0501082_0055092_1626_2621 | 325 |
| 37 | 3300005354 | Ga0070675_100043941 | Ga0070675_1000439411 | 327 |
| 38 | 3300005354 | Ga0070675_100046550 | Ga0070675_1000465503 | 327 |
| 39 | 3300005355 | Ga0070671_100003024 | Ga0070671_10000302414 | 327 |
| 40 | 3300005356 | Ga0070674_100141033 | Ga0070674_1001410331 | 327 |
| 41 | 3300005367 | Ga0070667_100247234 | Ga0070667_1002472342 | 327 |
| 42 | 3300005456 | Ga0070678_100174146 | Ga0070678_1001741462 | 327 |
| 43 | 3300005548 | Ga0070665_100053942 | Ga0070665_1000539423 | 327 |
| 44 | 3300006042 | Ga0075368_10002969 | Ga0075368_100029694 | 327 |
| 45 | 3300006178 | Ga0075367_10121551 | Ga0075367_101215512 | 327 |
| 46 | 3300006195 | Ga0075366_10001495 | Ga0075366_1000149513 | 327 |
| 47 | 3300006195 | Ga0075366_10015523 | Ga0075366_100155234 | 327 |
| 48 | 3300014326 | Ga0157380_10214935 | Ga0157380_102149352 | 327 |
| 49 | 3300025926 | Ga0207659_10088096 | Ga0207659_100880962 | 327 |
| 50 | 3300025926 | Ga0207659_10094567 | Ga0207659_100945673 | 327 |
| 51 | 3300025940 | Ga0207691_10380438 | Ga0207691_103804381 | 327 |
| 52 | 3300025945 | Ga0207679_10007469 | Ga0207679_100074697 | 327 |
| 53 | 3300025960 | Ga0207651_10004939 | Ga0207651_100049396 | 327 |
| 54 | 3300025986 | Ga0207658_10321648 | Ga0207658_103216481 | 327 |
| 55 | 3300026067 | Ga0207678_10049664 | Ga0207678_100496644 | 327 |
| 56 | 3300026121 | Ga0207683_10108103 | Ga0207683_101081033 | 327 |
| 57 | 3300042125 | Ga0450923_021562 | Ga0450923_021562_125_1132 | 327 |
| 58 | 3300042156 | Ga0439446_0005273 | Ga0439446_0005273_573_1592 | 327 |
| 59 | 3300042435 | Ga0439434_0046397 | Ga0439434_0046397_198_1217 | 327 |
| 60 | 3300049587 | Ga0501071_0025032 | Ga0501071_0025032_2942_3943 | 327 |
| 61 | 3300049591 | Ga0501075_0148936 | Ga0501075_0148936_732_1733 | 327 |
| 62 | 3300050490 | nmdc:mga03n38_10058_c1 | nmdc:mga03n38_10058_c1_638_1648 | 327 |
| 63 | 3300050493 | nmdc:mga0k408_14943_c1 | nmdc:mga0k408_14943_c1_2420_3427 | 327 |
| 64 | 3300050493 | nmdc:mga0k408_18216_c1 | nmdc:mga0k408_18216_c1_154_1164 | 327 |
| 65 | 3300050494 | nmdc:mga06z11_50511_c1 | nmdc:mga06z11_50511_c1_298_1308 | 327 |
| 66 | 3300050494 | nmdc:mga06z11_94845_c1 | nmdc:mga06z11_94845_c1_309_1316 | 327 |
| 67 | 3300050496 | nmdc:mga07m45_28463_c1 | nmdc:mga07m45_28463_c1_749_1759 | 327 |
| 68 | 3300053103 | Ga0500555_000354 | Ga0500555_000354_2734_3738 | 327 |
| 69 | 3300053730 | Ga0500645_000232 | Ga0500645_000232_24560_25564 | 327 |
| 70 | 3300059421 | Ga0590071_000105 | Ga0590071_000105_17663_18673 | 327 |
| 71 | 3300059423 | Ga0590074_001380 | Ga0590074_001380_593_1603 | 327 |
| 72 | 3300059424 | Ga0590075_001105 | Ga0590075_001105_2589_3599 | 327 |
| 73 | 3300005617 | Ga0068859_100505080 | Ga0068859_1005050801 | 328 |
| 74 | 3300006931 | Ga0097620_100505016 | Ga0097620_1005050161 | 328 |
| 75 | 3300053085 | Ga0495619_0227812 | Ga0495619_0227812_269_1276 | 328 |
| 76 | 3300003215 | JGI25153J46596_10022590 | JGI25153J46596_100225902 | 329 |
| 77 | 3300005467 | Ga0070706_100001050 | Ga0070706_10000105017 | 329 |
| 78 | 3300025910 | Ga0207684_10001226 | Ga0207684_1000122612 | 329 |
| 79 | iso_pu_bacteria | 2738541276 | 2738716964 | 331 |
| 80 | 3300031727 | Ga0316576_10000938 | Ga0316576_1000093811 | 332 |
| 81 | 3300031728 | Ga0316578_10006890 | Ga0316578_100068904 | 332 |
| 82 | 3300031733 | Ga0316577_10011046 | Ga0316577_100110464 | 332 |
| 83 | 3300003323 | rootH1_10021139 | rootH1_100211397 | 333 |
| 84 | 3300028800 | Ga0265338_10126950 | Ga0265338_101269502 | 333 |
| 85 | 3300031548 | Ga0307408_100005094 | Ga0307408_1000050942 | 333 |
| 86 | 3300039062 | Ga0400483_206430 | Ga0400483_206430_7654_8700 | 333 |
| 87 | 3300039437 | Ga0436365_0584888 | Ga0436365_0584888_261_1271 | 333 |
| 88 | 3300061734 | Ga0530510_0300863 | Ga0530510_0300863_136_1164 | 333 |
| 89 | 3300005536 | Ga0070697_100031761 | Ga0070697_1000317612 | 334 |
| 90 | 3300037068 | Ga0373925_0103549 | Ga0373925_0103549_634_1650 | 334 |
| 91 | 3300053730 | Ga0500645_009547 | Ga0500645_009547_939_1967 | 334 |
| 92 | 3300045051 | Ga0451576_0016026 | Ga0451576_0016026_4811_5839 | 335 |
| 93 | 3300005329 | Ga0070683_100006772 | Ga0070683_1000067721 | 336 |
| 94 | 3300005535 | Ga0070684_100037335 | Ga0070684_1000373353 | 336 |
| 95 | 3300025929 | Ga0207664_10149144 | Ga0207664_101491442 | 336 |
| 96 | 3300025944 | Ga0207661_10079177 | Ga0207661_100791771 | 336 |
| 97 | 3300035724 | Ga0373933_0178204 | Ga0373933_0178204_55_1095 | 336 |
| 98 | 3300048915 | Ga0496112_0386985 | Ga0496112_0386985_284_1324 | 336 |
| 99 | 3300053077 | Ga0495601_0035091 | Ga0495601_0035091_1930_2967 | 336 |
| 100 | iso_pu_bacteria | 2718217752 | 2718716300 | 336 |
| 101 | 3300006175 | Ga0070712_100238027 | Ga0070712_1002380271 | 337 |
| 102 | 3300005439 | Ga0070711_100001071 | Ga0070711_1000010719 | 338 |
| 103 | 3300005467 | Ga0070706_100144196 | Ga0070706_1001441961 | 338 |
| 104 | 3300005539 | Ga0068853_100000053 | Ga0068853_10000005319 | 338 |
| 105 | 3300006028 | Ga0070717_10033478 | Ga0070717_100334782 | 338 |
| 106 | 3300007076 | Ga0075435_100070822 | Ga0075435_1000708222 | 338 |
| 107 | 3300009148 | Ga0105243_10001455 | Ga0105243_100014553 | 338 |
| 108 | 3300014969 | Ga0157376_10467884 | Ga0157376_104678841 | 338 |
| 109 | 3300025935 | Ga0207709_10001978 | Ga0207709_100019783 | 338 |
| 110 | 3300026041 | Ga0207639_10000001 | Ga0207639_10000001297 | 338 |
| 111 | 3300031548 | Ga0307408_100001553 | Ga0307408_1000015537 | 338 |
| 112 | 3300031901 | Ga0307406_10000620 | Ga0307406_1000062018 | 338 |
| 113 | 3300042876 | Ga0451577_0225061 | Ga0451577_0225061_473_1510 | 338 |
| 114 | 3300045051 | Ga0451576_0124221 | Ga0451576_0124221_828_1862 | 338 |
| 115 | 3300050513 | nmdc:mga0rr50_5199_c1 | nmdc:mga0rr50_5199_c1_1466_2503 | 338 |
| 116 | 3300053118 | Ga0500594_0042173 | Ga0500594_0042173_39_1076 | 338 |
| 117 | 3300005468 | Ga0070707_100000860 | Ga0070707_10000086021 | 339 |
| 118 | 3300005518 | Ga0070699_100022962 | Ga0070699_1000229622 | 339 |
| 119 | 3300005518 | Ga0070699_100041455 | Ga0070699_1000414554 | 339 |
| 120 | 3300005536 | Ga0070697_100081430 | Ga0070697_1000814303 | 339 |
| 121 | 3300006028 | Ga0070717_10366217 | Ga0070717_103662172 | 339 |
| 122 | 3300006846 | Ga0075430_100372347 | Ga0075430_1003723471 | 339 |
| 123 | 3300006914 | Ga0075436_100085016 | Ga0075436_1000850162 | 339 |
| 124 | 3300013297 | Ga0157378_10225964 | Ga0157378_102259642 | 339 |
| 125 | 3300014969 | Ga0157376_10047669 | Ga0157376_100476694 | 339 |
| 126 | 3300025910 | Ga0207684_10087388 | Ga0207684_100873882 | 339 |
| 127 | 3300025922 | Ga0207646_10001722 | Ga0207646_100017228 | 339 |
| 128 | 3300028563 | Ga0265319_1008064 | Ga0265319_10080644 | 339 |
| 129 | 3300028800 | Ga0265338_10079347 | Ga0265338_100793472 | 339 |
| 130 | 3300028800 | Ga0265338_10084077 | Ga0265338_100840772 | 339 |
| 131 | 3300031241 | Ga0265325_10070043 | Ga0265325_100700433 | 339 |
| 132 | 3300031344 | Ga0265316_10034216 | Ga0265316_100342162 | 339 |
| 133 | 3300031995 | Ga0307409_100030172 | Ga0307409_1000301722 | 339 |
| 134 | 3300037068 | Ga0373925_0336507 | Ga0373925_0336507_71_1108 | 339 |
| 135 | 3300042876 | Ga0451577_0000011 | Ga0451577_0000011_575735_576775 | 339 |
| 136 | 3300042876 | Ga0451577_0018580 | Ga0451577_0018580_1200_2261 | 339 |
| 137 | 3300042876 | Ga0451577_0075704 | Ga0451577_0075704_113_1153 | 339 |
| 138 | 3300044673 | Ga0453683_0000007 | Ga0453683_0000007_80736_81776 | 339 |
| 139 | 3300044673 | Ga0453683_0000043 | Ga0453683_0000043_20291_21331 | 339 |
| 140 | 3300044712 | Ga0453684_0000224 | Ga0453684_0000224_227664_228704 | 339 |
| 141 | 3300044712 | Ga0453684_0009668 | Ga0453684_0009668_6552_7592 | 339 |
| 142 | 3300044712 | Ga0453684_0300983 | Ga0453684_0300983_213_1274 | 339 |
| 143 | 3300045051 | Ga0451576_0226593 | Ga0451576_0226593_288_1328 | 339 |
| 144 | 3300005327 | Ga0070658_10188276 | Ga0070658_101882762 | 340 |
| 145 | 3300005444 | Ga0070694_100097086 | Ga0070694_1000970862 | 340 |
| 146 | 3300005467 | Ga0070706_100131320 | Ga0070706_1001313201 | 340 |
| 147 | 3300006871 | Ga0075434_100140232 | Ga0075434_1001402323 | 340 |
| 148 | 3300009098 | Ga0105245_10324473 | Ga0105245_103244731 | 340 |
| 149 | 3300045049 | Ga0466959_0247568 | Ga0466959_0247568_28_1077 | 340 |
| 150 | 3300048088 | Ga0495602_0290638 | Ga0495602_0290638_105_1154 | 340 |
| 151 | 3300048924 | Ga0496121_0072999 | Ga0496121_0072999_316_1359 | 340 |
| 152 | 3300050512 | nmdc:mga0n895_36005_c1 | nmdc:mga0n895_36005_c1_2602_3654 | 340 |
| 153 | 3300053730 | Ga0500645_021447 | Ga0500645_021447_91_1140 | 340 |
| 154 | 3300005329 | Ga0070683_100005606 | Ga0070683_1000056067 | 341 |
| 155 | 3300005336 | Ga0070680_100015488 | Ga0070680_1000154882 | 341 |
| 156 | 3300005353 | Ga0070669_100107058 | Ga0070669_1001070582 | 341 |
| 157 | 3300005356 | Ga0070674_100243525 | Ga0070674_1002435251 | 341 |
| 158 | 3300005518 | Ga0070699_100091212 | Ga0070699_1000912121 | 341 |
| 159 | 3300005530 | Ga0070679_100026603 | Ga0070679_1000266034 | 341 |
| 160 | 3300005536 | Ga0070697_100142484 | Ga0070697_1001424842 | 341 |
| 161 | 3300013296 | Ga0157374_10092239 | Ga0157374_100922393 | 341 |
| 162 | 3300025944 | Ga0207661_10100708 | Ga0207661_101007083 | 341 |
| 163 | iso_pu_bacteria | 2824600985 | 2824603446 | 341 |
| 164 | iso_pu_bacteria | 2824609381 | 2824614725 | 341 |
| 165 | iso_pu_bacteria | 2824653114 | 2824654770 | 341 |
| 166 | 3300005445 | Ga0070708_100072247 | Ga0070708_1000722473 | 342 |
| 167 | 3300005467 | Ga0070706_100011938 | Ga0070706_1000119389 | 342 |
| 168 | 3300005468 | Ga0070707_100048766 | Ga0070707_1000487663 | 342 |
| 169 | 3300005468 | Ga0070707_100117122 | Ga0070707_1001171222 | 342 |
| 170 | 3300005471 | Ga0070698_100008009 | Ga0070698_1000080097 | 342 |
| 171 | 3300005471 | Ga0070698_100009276 | Ga0070698_10000927610 | 342 |
| 172 | 3300005471 | Ga0070698_100245755 | Ga0070698_1002457552 | 342 |
| 173 | 3300005536 | Ga0070697_100002620 | Ga0070697_10000262011 | 342 |
| 174 | 3300005536 | Ga0070697_100098820 | Ga0070697_1000988202 | 342 |
| 175 | 3300005536 | Ga0070697_100233143 | Ga0070697_1002331432 | 342 |
| 176 | 3300006028 | Ga0070717_10068533 | Ga0070717_100685332 | 342 |
| 177 | 3300006914 | Ga0075436_100027892 | Ga0075436_1000278925 | 342 |
| 178 | 3300013297 | Ga0157378_10023465 | Ga0157378_100234657 | 342 |
| 179 | 3300013307 | Ga0157372_10136377 | Ga0157372_101363772 | 342 |
| 180 | 3300025910 | Ga0207684_10059683 | Ga0207684_100596832 | 342 |
| 181 | 3300025922 | Ga0207646_10000972 | Ga0207646_1000097222 | 342 |
| 182 | 3300005435 | Ga0070714_100166333 | Ga0070714_1001663332 | 344 |
| 183 | 3300005467 | Ga0070706_100075386 | Ga0070706_1000753862 | 344 |
| 184 | 3300005471 | Ga0070698_100137684 | Ga0070698_1001376842 | 344 |
| 185 | 3300005548 | Ga0070665_100028730 | Ga0070665_1000287302 | 344 |
| 186 | 3300005983 | Ga0081540_1000020 | Ga0081540_100002063 | 344 |
| 187 | 3300006028 | Ga0070717_10064845 | Ga0070717_100648452 | 344 |
| 188 | 3300025910 | Ga0207684_10138337 | Ga0207684_101383372 | 344 |
| 189 | 3300025939 | Ga0207665_10033693 | Ga0207665_100336934 | 344 |
| 190 | 3300028379 | Ga0268266_10200038 | Ga0268266_102000381 | 344 |
| 191 | 3300042876 | Ga0451577_0006289 | Ga0451577_0006289_6320_7435 | 344 |
| 192 | 3300048910 | Ga0496107_0050312 | Ga0496107_0050312_161_1195 | 344 |
| 193 | iso_pu_bacteria | 2507262055 | 2507508716 | 344 |
| 194 | iso_pu_bacteria | 2508501009 | 2508542809 | 344 |
| 195 | iso_pu_bacteria | 2508501042 | 2508691430 | 344 |
| 196 | iso_pu_bacteria | 2513237092 | 2513623166 | 344 |
| 197 | iso_pu_bacteria | 2513237102 | 2513700536 | 344 |
| 198 | iso_pu_bacteria | 2513237137 | 2513860981 | 344 |
| 199 | iso_pu_bacteria | 2517572143 | 2517892504 | 344 |
| 200 | iso_pu_bacteria | 2528768022 | 2528856554 | 344 |
| 201 | iso_pu_bacteria | 2791355196 | 2793062533 | 344 |
| 202 | iso_pu_bacteria | 2791355197 | 2793068671 | 344 |
| 203 | iso_pu_bacteria | 2824617872 | 2824622433 | 344 |
| 204 | iso_pu_bacteria | 2824626560 | 2824631558 | 344 |
| 205 | iso_pu_bacteria | 2824635225 | 2824640124 | 344 |
| 206 | iso_pu_bacteria | 2824644064 | 2824647631 | 344 |
| 207 | iso_pu_bacteria | 2824661429 | 2824664620 | 344 |
| 208 | iso_pu_bacteria | 2824714736 | 2824717589 | 344 |
| 209 | iso_pu_bacteria | 2824723954 | 2824727804 | 344 |
| 210 | iso_pu_bacteria | 2842038055 | 2842039199 | 344 |
| 211 | iso_pu_bacteria | 2842045827 | 2842047854 | 344 |
| 212 | iso_pu_bacteria | 2847930680 | 2847936089 | 344 |
| 213 | iso_pu_bacteria | 2849076700 | 2849079440 | 344 |
| 214 | iso_pu_bacteria | 2879083081 | 2879090067 | 344 |
| 215 | iso_pu_bacteria | 2879099564 | 2879103413 | 344 |
| 216 | iso_pu_bacteria | 2881364244 | 2881367063 | 344 |
| 217 | iso_pu_bacteria | 2885374607 | 2885375312 | 344 |
| 218 | iso_pu_bacteria | 2888388044 | 2888393933 | 344 |
| 219 | iso_pu_bacteria | 2903748898 | 2903759306 | 344 |
| 220 | iso_pu_bacteria | 2906610324 | 2906618504 | 344 |
| 221 | iso_pu_bacteria | 2906635258 | 2906640923 | 344 |
| 222 | iso_pu_bacteria | 2906660503 | 2906664200 | 344 |
| 223 | iso_pu_bacteria | 2908739725 | 2908742825 | 344 |
| 224 | iso_pu_bacteria | 2922368715 | 2922374242 | 344 |
| 225 | iso_pu_bacteria | 2929615660 | 2929617922 | 344 |
| 226 | iso_pu_bacteria | 2929624759 | 2929627603 | 344 |
| 227 | iso_pu_bacteria | 2932784394 | 2932788301 | 344 |
| 228 | iso_pu_bacteria | 2932809354 | 2932810553 | 344 |
| 229 | iso_pu_bacteria | 2932818245 | 2932821304 | 344 |
| 230 | iso_pu_bacteria | 2932828146 | 2932831296 | 344 |
| 231 | iso_pu_bacteria | 2933577622 | 2933579851 | 344 |
| 232 | iso_pu_bacteria | 2935608549 | 2935608760 | 344 |
| 233 | iso_pu_bacteria | 2935616580 | 2935622911 | 344 |
| 234 | iso_pu_bacteria | 2935630451 | 2935631772 | 344 |
| 235 | iso_pu_bacteria | 2935638405 | 2935642269 | 344 |
| 236 | iso_pu_bacteria | 2935648319 | 2935649912 | 344 |
| 237 | iso_pu_bacteria | 2935656913 | 2935661936 | 344 |
| 238 | iso_pu_bacteria | 2935665750 | 2935668427 | 344 |
| 239 | iso_pu_bacteria | 2935675223 | 2935680643 | 344 |
| 240 | iso_pu_bacteria | 2935684952 | 2935692768 | 344 |
| 241 | iso_pu_bacteria | 2935703347 | 2935706286 | 344 |
| 242 | iso_pu_bacteria | 2935713505 | 2935721507 | 344 |
| 243 | iso_pu_bacteria | 2935722832 | 2935730425 | 344 |
| 244 | iso_pu_bacteria | 2935732158 | 2935740438 | 344 |
| 245 | iso_pu_bacteria | 2935741537 | 2935749702 | 344 |
| 246 | iso_pu_bacteria | 2935750917 | 2935758985 | 344 |
| 247 | iso_pu_bacteria | 2935760218 | 2935762683 | 344 |
| 248 | iso_pu_bacteria | 2935801545 | 2935803282 | 344 |
| 249 | iso_pu_bacteria | 2935810662 | 2935814602 | 344 |
| 250 | iso_pu_bacteria | 2935819856 | 2935821921 | 344 |
| 251 | iso_pu_bacteria | 2935827899 | 2935831740 | 344 |
| 252 | iso_pu_bacteria | 2935837841 | 2935838608 | 344 |
| 253 | iso_pu_bacteria | 2935847175 | 2935847503 | 344 |
| 254 | iso_pu_bacteria | 2935855204 | 2935861159 | 344 |
| 255 | iso_pu_bacteria | 2935864058 | 2935865697 | 344 |
| 256 | iso_pu_bacteria | 2935873716 | 2935878198 | 344 |
| 257 | iso_pu_bacteria | 2935908558 | 2935909229 | 344 |
| 258 | iso_pu_bacteria | 2935916978 | 2935919950 | 344 |
| 259 | iso_pu_bacteria | 2935926038 | 2935926197 | 344 |
| 260 | iso_pu_bacteria | 2935934488 | 2935934647 | 344 |
| 261 | iso_pu_bacteria | 2935942939 | 2935943097 | 344 |
| 262 | iso_pu_bacteria | 2935951376 | 2935951535 | 344 |
| 263 | iso_pu_bacteria | 2935967501 | 2935967660 | 344 |
| 264 | iso_pu_bacteria | 2935984226 | 2935988303 | 344 |
| 265 | iso_pu_bacteria | 2935992306 | 2935994509 | 344 |
| 266 | iso_pu_bacteria | 2936002035 | 2936007693 | 344 |
| 267 | iso_pu_bacteria | 2936011229 | 2936012605 | 344 |
| 268 | iso_pu_bacteria | 2936019824 | 2936021169 | 344 |
| 269 | iso_pu_bacteria | 2936028420 | 2936029898 | 344 |
| 270 | iso_pu_bacteria | 2936037263 | 2936040159 | 344 |
| 271 | iso_pu_bacteria | 2936046547 | 2936047363 | 344 |
| 272 | iso_pu_bacteria | 2936055302 | 2936057479 | 344 |
| 273 | iso_pu_bacteria | 2940556831 | 2940565010 | 344 |
| 274 | iso_pu_bacteria | 2941507105 | 2941513113 | 344 |
| 275 | iso_pu_bacteria | 2941515067 | 2941520983 | 344 |
| 276 | iso_pu_bacteria | 2941523033 | 2941526153 | 344 |
| 277 | iso_pu_bacteria | 2941538514 | 2941538724 | 344 |
| 278 | iso_pu_bacteria | 3005474847 | 3005480099 | 344 |
| 279 | iso_pu_bacteria | 8006984368 | 8006993444 | 344 |
| 280 | iso_pu_bacteria | 8016511872 | 8016513353 | 344 |
| 281 | iso_pu_bacteria | 8016630954 | 8016640492 | 344 |
| 282 | iso_pu_bacteria | 8017057580 | 8017063077 | 344 |
| 283 | iso_pu_bacteria | 8019576017 | 8019582512 | 344 |
| 284 | iso_pu_bacteria | 8019586578 | 8019590295 | 344 |
| 285 | iso_pu_bacteria | 8019597564 | 8019601051 | 344 |
| 286 | iso_pu_bacteria | 8019687851 | 8019689940 | 344 |
| 287 | iso_pu_bacteria | 8055742211 | 8055746488 | 344 |
| 288 | iso_pu_bacteria | 2508501128 | 2509150381 | 345 |
| 289 | iso_pu_bacteria | 2513237094 | 2513639106 | 345 |
| 290 | iso_pu_bacteria | 2643221651 | 2644288651 | 345 |
| 291 | iso_pu_bacteria | 2671180139 | 2671692744 | 345 |
| 292 | iso_pu_bacteria | 2721755755 | 2723845217 | 345 |
| 293 | iso_pu_bacteria | 2837678835 | 2837679953 | 345 |
| 294 | iso_pu_bacteria | 2876808645 | 2876809023 | 345 |
| 295 | iso_pu_bacteria | 2879110137 | 2879115400 | 345 |
| 296 | iso_pu_bacteria | 2922361189 | 2922365231 | 345 |
| 297 | iso_pu_bacteria | 2935694250 | 2935700938 | 345 |
| 298 | iso_pu_bacteria | 2935959822 | 2935966357 | 345 |
| 299 | iso_pu_bacteria | 8006994254 | 8006998861 | 345 |
| 300 | iso_pu_bacteria | 8019648815 | 8019658255 | 345 |
| 301 | iso_pu_bacteria | 8045864390 | 8045865815 | 345 |
| 302 | 3300049823 | Ga0501044_0137022 | Ga0501044_0137022_1234_2280 | 346 |
| 303 | iso_pu_bacteria | 2513237101 | 2513692392 | 346 |
| 304 | iso_pu_bacteria | 2791355199 | 2793083573 | 346 |
| 305 | iso_pu_bacteria | 2874604998 | 2874605069 | 346 |
| 306 | iso_pu_bacteria | 2889033259 | 2889039973 | 346 |
| 307 | iso_pu_bacteria | 8006964411 | 8006965608 | 346 |
| 308 | iso_pu_bacteria | 8056673599 | 8056673993 | 346 |
| 309 | 3300009545 | Ga0105237_10080055 | Ga0105237_100800553 | 347 |
| 310 | 3300013105 | Ga0157369_10003699 | Ga0157369_100036998 | 347 |
| 311 | 3300046462 | Ga0495651_0073151 | Ga0495651_0073151_1477_2523 | 347 |
| 312 | 3300046679 | Ga0495623_0085754 | Ga0495623_0085754_862_1908 | 347 |
| 313 | 3300046809 | Ga0495600_0223757 | Ga0495600_0223757_55_1101 | 347 |
| 314 | 3300049571 | Ga0501034_0148900 | Ga0501034_0148900_493_1539 | 347 |
| 315 | 3300049589 | Ga0501073_0115904 | Ga0501073_0115904_629_1675 | 347 |
| 316 | 3300003322 | rootL2_10176537 | rootL2_101765373 | 348 |
| 317 | 3300005262 | Ga0065165_1011557 | Ga0065165_10115573 | 348 |
| 318 | 3300005347 | Ga0070668_100105438 | Ga0070668_1001054381 | 348 |
| 319 | 3300005356 | Ga0070674_100116470 | Ga0070674_1001164702 | 348 |
| 320 | 3300005356 | Ga0070674_100281720 | Ga0070674_1002817201 | 348 |
| 321 | 3300005434 | Ga0070709_10290993 | Ga0070709_102909931 | 348 |
| 322 | 3300005455 | Ga0070663_100087202 | Ga0070663_1000872023 | 348 |
| 323 | 3300005457 | Ga0070662_100047195 | Ga0070662_1000471953 | 348 |
| 324 | 3300005458 | Ga0070681_10031723 | Ga0070681_100317235 | 348 |
| 325 | 3300005518 | Ga0070699_100189133 | Ga0070699_1001891332 | 348 |
| 326 | 3300005535 | Ga0070684_100013256 | Ga0070684_1000132565 | 348 |
| 327 | 3300005539 | Ga0068853_100244337 | Ga0068853_1002443372 | 348 |
| 328 | 3300005563 | Ga0068855_100146738 | Ga0068855_1001467383 | 348 |
| 329 | 3300005564 | Ga0070664_100298735 | Ga0070664_1002987352 | 348 |
| 330 | 3300005577 | Ga0068857_100006858 | Ga0068857_10000685811 | 348 |
| 331 | 3300006038 | Ga0075365_10053206 | Ga0075365_100532063 | 348 |
| 332 | 3300006177 | Ga0075362_10106912 | Ga0075362_101069121 | 348 |
| 333 | 3300006178 | Ga0075367_10076377 | Ga0075367_100763772 | 348 |
| 334 | 3300006186 | Ga0075369_10084131 | Ga0075369_100841312 | 348 |
| 335 | 3300006353 | Ga0075370_10039630 | Ga0075370_100396303 | 348 |
| 336 | 3300006353 | Ga0075370_10143693 | Ga0075370_101436931 | 348 |
| 337 | 3300009545 | Ga0105237_10270496 | Ga0105237_102704962 | 348 |
| 338 | 3300009551 | Ga0105238_10014128 | Ga0105238_100141289 | 348 |
| 339 | 3300010375 | Ga0105239_10112781 | Ga0105239_101127814 | 348 |
| 340 | 3300013105 | Ga0157369_10016823 | Ga0157369_100168237 | 348 |
| 341 | 3300013297 | Ga0157378_10338349 | Ga0157378_103383491 | 348 |
| 342 | 3300014325 | Ga0163163_10109104 | Ga0163163_101091043 | 348 |
| 343 | 3300014968 | Ga0157379_10124007 | Ga0157379_101240072 | 348 |
| 344 | 3300025230 | Ga0209563_101672 | Ga0209563_1016725 | 348 |
| 345 | 3300025253 | Ga0209677_102352 | Ga0209677_1023525 | 348 |
| 346 | 3300025297 | Ga0209758_1002500 | Ga0209758_100250014 | 348 |
| 347 | 3300025302 | Ga0207426_1007061 | Ga0207426_10070615 | 348 |
| 348 | 3300025901 | Ga0207688_10032942 | Ga0207688_100329423 | 348 |
| 349 | 3300025912 | Ga0207707_10015990 | Ga0207707_100159904 | 348 |
| 350 | 3300025912 | Ga0207707_10092324 | Ga0207707_100923242 | 348 |
| 351 | 3300025920 | Ga0207649_10110600 | Ga0207649_101106002 | 348 |
| 352 | 3300025923 | Ga0207681_10200228 | Ga0207681_102002282 | 348 |
| 353 | 3300025926 | Ga0207659_10268644 | Ga0207659_102686441 | 348 |
| 354 | 3300025933 | Ga0207706_10221862 | Ga0207706_102218622 | 348 |
| 355 | 3300025940 | Ga0207691_10287467 | Ga0207691_102874672 | 348 |
| 356 | 3300025945 | Ga0207679_10282194 | Ga0207679_102821942 | 348 |
| 357 | 3300025949 | Ga0207667_10154237 | Ga0207667_101542371 | 348 |
| 358 | 3300025949 | Ga0207667_10394908 | Ga0207667_103949082 | 348 |
| 359 | 3300025972 | Ga0207668_10297558 | Ga0207668_102975582 | 348 |
| 360 | 3300026023 | Ga0207677_10270995 | Ga0207677_102709951 | 348 |
| 361 | 3300026035 | Ga0207703_10039350 | Ga0207703_100393503 | 348 |
| 362 | 3300026041 | Ga0207639_10053911 | Ga0207639_100539113 | 348 |
| 363 | 3300026041 | Ga0207639_10073292 | Ga0207639_100732922 | 348 |
| 364 | 3300026041 | Ga0207639_10108702 | Ga0207639_101087023 | 348 |
| 365 | 3300026041 | Ga0207639_10130893 | Ga0207639_101308932 | 348 |
| 366 | 3300026067 | Ga0207678_10062685 | Ga0207678_100626854 | 348 |
| 367 | 3300027296 | Ga0209389_1000969 | Ga0209389_100096916 | 348 |
| 368 | 3300027361 | Ga0209489_108549 | Ga0209489_1085494 | 348 |
| 369 | 3300027363 | Ga0209700_100036 | Ga0209700_100036142 | 348 |
| 370 | 3300028379 | Ga0268266_10054352 | Ga0268266_100543521 | 348 |
| 371 | 3300031249 | Ga0265339_10019806 | Ga0265339_100198063 | 348 |
| 372 | 3300031250 | Ga0265331_10070824 | Ga0265331_100708242 | 348 |
| 373 | 3300031712 | Ga0265342_10002731 | Ga0265342_1000273111 | 348 |
| 374 | 3300031995 | Ga0307409_100090269 | Ga0307409_1000902692 | 348 |
| 375 | 3300032126 | Ga0307415_100052195 | Ga0307415_1000521952 | 348 |
| 376 | 3300033180 | Ga0307510_10010241 | Ga0307510_100102417 | 348 |
| 377 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001265 | 348 |
| 378 | 3300035089 | Ga0373944_0005144 | Ga0373944_0005144_289_1335 | 348 |
| 379 | 3300035116 | Ga0373945_0008018 | Ga0373945_0008018_710_1756 | 348 |
| 380 | 3300035170 | Ga0373943_0049080 | Ga0373943_0049080_343_1389 | 348 |
| 381 | 3300035410 | Ga0373924_0006263 | Ga0373924_0006263_1546_2592 | 348 |
| 382 | 3300035691 | Ga0373931_0037237 | Ga0373931_0037237_114_1172 | 348 |
| 383 | 3300035695 | Ga0373927_0183294 | Ga0373927_0183294_315_1361 | 348 |
| 384 | 3300035724 | Ga0373933_0031946 | Ga0373933_0031946_999_2045 | 348 |
| 385 | 3300035725 | Ga0373947_0007586 | Ga0373947_0007586_1977_3023 | 348 |
| 386 | 3300035725 | Ga0373947_0160666 | Ga0373947_0160666_321_1367 | 348 |
| 387 | 3300036401 | Ga0373937_0026658 | Ga0373937_0026658_3336_4382 | 348 |
| 388 | 3300037068 | Ga0373925_0054102 | Ga0373925_0054102_1457_2503 | 348 |
| 389 | 3300039437 | Ga0436365_1401961 | Ga0436365_1401961_569_1621 | 348 |
| 390 | 3300041452 | Ga0451793_1479997 | Ga0451793_1479997_98_1144 | 348 |
| 391 | 3300046454 | Ga0495592_0047468 | Ga0495592_0047468_1462_2508 | 348 |
| 392 | 3300046454 | Ga0495592_0125968 | Ga0495592_0125968_394_1440 | 348 |
| 393 | 3300046455 | Ga0495603_0046198 | Ga0495603_0046198_1229_2275 | 348 |
| 394 | 3300046455 | Ga0495603_0110991 | Ga0495603_0110991_500_1546 | 348 |
| 395 | 3300046459 | Ga0495629_0046573 | Ga0495629_0046573_1880_2926 | 348 |
| 396 | 3300046459 | Ga0495629_0128970 | Ga0495629_0128970_613_1659 | 348 |
| 397 | 3300046460 | Ga0495638_0052409 | Ga0495638_0052409_873_1919 | 348 |
| 398 | 3300046472 | Ga0495580_0171641 | Ga0495580_0171641_415_1461 | 348 |
| 399 | 3300046473 | Ga0495582_0019184 | Ga0495582_0019184_2642_3688 | 348 |
| 400 | 3300046477 | Ga0495664_0097184 | Ga0495664_0097184_255_1301 | 348 |
| 401 | 3300046491 | Ga0495584_0025083 | Ga0495584_0025083_1630_2676 | 348 |
| 402 | 3300046507 | Ga0495606_0045016 | Ga0495606_0045016_292_1338 | 348 |
| 403 | 3300046514 | Ga0495618_0061407 | Ga0495618_0061407_1173_2219 | 348 |
| 404 | 3300046517 | Ga0495630_0044087 | Ga0495630_0044087_1082_2128 | 348 |
| 405 | 3300046519 | Ga0495632_0040857 | Ga0495632_0040857_955_2001 | 348 |
| 406 | 3300046522 | Ga0495643_0142019 | Ga0495643_0142019_20_1066 | 348 |
| 407 | 3300046523 | Ga0495644_0062393 | Ga0495644_0062393_340_1386 | 348 |
| 408 | 3300046524 | Ga0495648_0153077 | Ga0495648_0153077_90_1136 | 348 |
| 409 | 3300046526 | Ga0495666_0034184 | Ga0495666_0034184_698_1744 | 348 |
| 410 | 3300046538 | Ga0495609_0025737 | Ga0495609_0025737_485_1531 | 348 |
| 411 | 3300046557 | Ga0495622_0026866 | Ga0495622_0026866_729_1775 | 348 |
| 412 | 3300046559 | Ga0495667_0046148 | Ga0495667_0046148_1572_2618 | 348 |
| 413 | 3300046674 | Ga0495588_0010035 | Ga0495588_0010035_584_1630 | 348 |
| 414 | 3300046674 | Ga0495588_0046936 | Ga0495588_0046936_650_1696 | 348 |
| 415 | 3300046683 | Ga0495658_0117760 | Ga0495658_0117760_435_1481 | 348 |
| 416 | 3300046694 | Ga0495649_0106080 | Ga0495649_0106080_383_1429 | 348 |
| 417 | 3300046694 | Ga0495649_0110719 | Ga0495649_0110719_99_1145 | 348 |
| 418 | 3300047315 | Ga0495581_0023393 | Ga0495581_0023393_888_1934 | 348 |
| 419 | 3300047319 | Ga0495674_0077886 | Ga0495674_0077886_1115_2161 | 348 |
| 420 | 3300047471 | Ga0495684_0035362 | Ga0495684_0035362_1230_2276 | 348 |
| 421 | 3300047472 | Ga0495686_0140430 | Ga0495686_0140430_129_1175 | 348 |
| 422 | 3300048904 | Ga0496101_0045055 | Ga0496101_0045055_1335_2381 | 348 |
| 423 | 3300048906 | Ga0496103_0182648 | Ga0496103_0182648_217_1263 | 348 |
| 424 | 3300048907 | Ga0496104_0070744 | Ga0496104_0070744_1633_2679 | 348 |
| 425 | 3300048908 | Ga0496105_0065322 | Ga0496105_0065322_755_1801 | 348 |
| 426 | 3300048909 | Ga0496106_0085862 | Ga0496106_0085862_1023_2069 | 348 |
| 427 | 3300048913 | Ga0496110_0071103 | Ga0496110_0071103_301_1347 | 348 |
| 428 | 3300048914 | Ga0496111_0071461 | Ga0496111_0071461_1121_2167 | 348 |
| 429 | 3300048915 | Ga0496112_0034260 | Ga0496112_0034260_813_1859 | 348 |
| 430 | 3300048917 | Ga0496114_0105958 | Ga0496114_0105958_970_2016 | 348 |
| 431 | 3300048918 | Ga0496115_0196810 | Ga0496115_0196810_242_1288 | 348 |
| 432 | 3300048919 | Ga0496116_0049722 | Ga0496116_0049722_1392_2438 | 348 |
| 433 | 3300048920 | Ga0496117_0130733 | Ga0496117_0130733_239_1285 | 348 |
| 434 | 3300048921 | Ga0496118_0075771 | Ga0496118_0075771_1094_2140 | 348 |
| 435 | 3300048922 | Ga0496119_0074812 | Ga0496119_0074812_78_1124 | 348 |
| 436 | 3300048924 | Ga0496121_0118231 | Ga0496121_0118231_183_1229 | 348 |
| 437 | 3300048924 | Ga0496121_0157177 | Ga0496121_0157177_489_1550 | 348 |
| 438 | 3300048929 | Ga0496126_0004782 | Ga0496126_0004782_6942_7988 | 348 |
| 439 | 3300048929 | Ga0496126_0042307 | Ga0496126_0042307_258_1304 | 348 |
| 440 | 3300049460 | Ga0495682_0041561 | Ga0495682_0041561_557_1603 | 348 |
| 441 | 3300050516 | nmdc:mga0sz30_35016_c1 | nmdc:mga0sz30_35016_c1_168_1214 | 348 |
| 442 | 3300053078 | Ga0495612_0027346 | Ga0495612_0027346_218_1264 | 348 |
| 443 | 3300053093 | Ga0500651_0042489 | Ga0500651_0042489_951_1997 | 348 |
| 444 | 3300053094 | Ga0500566_0001358 | Ga0500566_0001358_6679_7725 | 348 |
| 445 | 3300053096 | Ga0500641_0017411 | Ga0500641_0017411_81_1127 | 348 |
| 446 | 3300053109 | Ga0500569_054745 | Ga0500569_054745_84_1130 | 348 |
| 447 | 3300053119 | Ga0500595_002414 | Ga0500595_002414_6966_8012 | 348 |
| 448 | 3300053130 | Ga0500642_0052489 | Ga0500642_0052489_742_1788 | 348 |
| 449 | 3300053161 | Ga0500634_0037633 | Ga0500634_0037633_105_1151 | 348 |
| 450 | 3300005327 | Ga0070658_10167908 | Ga0070658_101679082 | 349 |
| 451 | 3300005336 | Ga0070680_100149426 | Ga0070680_1001494262 | 349 |
| 452 | 3300005353 | Ga0070669_100078653 | Ga0070669_1000786532 | 349 |
| 453 | 3300005434 | Ga0070709_10058345 | Ga0070709_100583452 | 349 |
| 454 | 3300005435 | Ga0070714_100181389 | Ga0070714_1001813892 | 349 |
| 455 | 3300005435 | Ga0070714_100306355 | Ga0070714_1003063552 | 349 |
| 456 | 3300005436 | Ga0070713_100065531 | Ga0070713_1000655312 | 349 |
| 457 | 3300005436 | Ga0070713_100141477 | Ga0070713_1001414773 | 349 |
| 458 | 3300005436 | Ga0070713_100363358 | Ga0070713_1003633581 | 349 |
| 459 | 3300005437 | Ga0070710_10011469 | Ga0070710_100114693 | 349 |
| 460 | 3300005439 | Ga0070711_100091166 | Ga0070711_1000911661 | 349 |
| 461 | 3300005518 | Ga0070699_100014792 | Ga0070699_1000147926 | 349 |
| 462 | 3300005518 | Ga0070699_100228284 | Ga0070699_1002282842 | 349 |
| 463 | 3300005543 | Ga0070672_100339646 | Ga0070672_1003396462 | 349 |
| 464 | 3300005548 | Ga0070665_100090499 | Ga0070665_1000904992 | 349 |
| 465 | 3300005563 | Ga0068855_100353362 | Ga0068855_1003533622 | 349 |
| 466 | 3300005614 | Ga0068856_100390875 | Ga0068856_1003908751 | 349 |
| 467 | 3300005616 | Ga0068852_100077937 | Ga0068852_1000779373 | 349 |
| 468 | 3300005616 | Ga0068852_100123090 | Ga0068852_1001230903 | 349 |
| 469 | 3300005617 | Ga0068859_100468478 | Ga0068859_1004684782 | 349 |
| 470 | 3300005718 | Ga0068866_10106922 | Ga0068866_101069222 | 349 |
| 471 | 3300005841 | Ga0068863_100205416 | Ga0068863_1002054161 | 349 |
| 472 | 3300005843 | Ga0068860_100008418 | Ga0068860_1000084189 | 349 |
| 473 | 3300005844 | Ga0068862_100078173 | Ga0068862_1000781732 | 349 |
| 474 | 3300005983 | Ga0081540_1003158 | Ga0081540_100315811 | 349 |
| 475 | 3300006028 | Ga0070717_10065514 | Ga0070717_100655142 | 349 |
| 476 | 3300006038 | Ga0075365_10230250 | Ga0075365_102302501 | 349 |
| 477 | 3300006048 | Ga0075363_100147580 | Ga0075363_1001475801 | 349 |
| 478 | 3300006163 | Ga0070715_10016848 | Ga0070715_100168483 | 349 |
| 479 | 3300006173 | Ga0070716_100132079 | Ga0070716_1001320792 | 349 |
| 480 | 3300006177 | Ga0075362_10073845 | Ga0075362_100738452 | 349 |
| 481 | 3300006178 | Ga0075367_10111756 | Ga0075367_101117562 | 349 |
| 482 | 3300006353 | Ga0075370_10069162 | Ga0075370_100691622 | 349 |
| 483 | 3300006844 | Ga0075428_100041368 | Ga0075428_1000413683 | 349 |
| 484 | 3300006844 | Ga0075428_100055937 | Ga0075428_1000559373 | 349 |
| 485 | 3300006846 | Ga0075430_100040236 | Ga0075430_1000402363 | 349 |
| 486 | 3300006847 | Ga0075431_100036260 | Ga0075431_1000362603 | 349 |
| 487 | 3300006880 | Ga0075429_100015588 | Ga0075429_1000155883 | 349 |
| 488 | 3300006931 | Ga0097620_100468487 | Ga0097620_1004684872 | 349 |
| 489 | 3300007265 | Ga0099794_10029452 | Ga0099794_100294522 | 349 |
| 490 | 3300009094 | Ga0111539_10014710 | Ga0111539_100147109 | 349 |
| 491 | 3300009094 | Ga0111539_10042364 | Ga0111539_100423643 | 349 |
| 492 | 3300009147 | Ga0114129_10060268 | Ga0114129_100602683 | 349 |
| 493 | 3300009553 | Ga0105249_10173207 | Ga0105249_101732072 | 349 |
| 494 | 3300025297 | Ga0209758_1002215 | Ga0209758_10022154 | 349 |
| 495 | 3300025297 | Ga0209758_1003196 | Ga0209758_10031966 | 349 |
| 496 | 3300025302 | Ga0207426_1007558 | Ga0207426_10075585 | 349 |
| 497 | 3300025304 | Ga0209257_1034669 | Ga0209257_10346692 | 349 |
| 498 | 3300025898 | Ga0207692_10129454 | Ga0207692_101294542 | 349 |
| 499 | 3300025899 | Ga0207642_10208440 | Ga0207642_102084401 | 349 |
| 500 | 3300025905 | Ga0207685_10055546 | Ga0207685_100555462 | 349 |
| 501 | 3300025906 | Ga0207699_10089032 | Ga0207699_100890321 | 349 |
| 502 | 3300025906 | Ga0207699_10255215 | Ga0207699_102552151 | 349 |
| 503 | 3300025908 | Ga0207643_10116528 | Ga0207643_101165282 | 349 |
| 504 | 3300025913 | Ga0207695_10280825 | Ga0207695_102808251 | 349 |
| 505 | 3300025914 | Ga0207671_10013859 | Ga0207671_100138593 | 349 |
| 506 | 3300025917 | Ga0207660_10272761 | Ga0207660_102727612 | 349 |
| 507 | 3300025922 | Ga0207646_10097940 | Ga0207646_100979403 | 349 |
| 508 | 3300025923 | Ga0207681_10355008 | Ga0207681_103550081 | 349 |
| 509 | 3300025923 | Ga0207681_10385995 | Ga0207681_103859951 | 349 |
| 510 | 3300025928 | Ga0207700_10021835 | Ga0207700_100218355 | 349 |
| 511 | 3300025928 | Ga0207700_10120517 | Ga0207700_101205172 | 349 |
| 512 | 3300025929 | Ga0207664_10241103 | Ga0207664_102411032 | 349 |
| 513 | 3300025942 | Ga0207689_10023076 | Ga0207689_100230763 | 349 |
| 514 | 3300025944 | Ga0207661_10003495 | Ga0207661_100034958 | 349 |
| 515 | 3300025960 | Ga0207651_10247015 | Ga0207651_102470152 | 349 |
| 516 | 3300026035 | Ga0207703_10200593 | Ga0207703_102005933 | 349 |
| 517 | 3300026088 | Ga0207641_10222569 | Ga0207641_102225691 | 349 |
| 518 | 3300026121 | Ga0207683_10195592 | Ga0207683_101955922 | 349 |
| 519 | 3300026121 | Ga0207683_10234524 | Ga0207683_102345242 | 349 |
| 520 | 3300027671 | Ga0209588_1020310 | Ga0209588_10203102 | 349 |
| 521 | 3300027907 | Ga0207428_10033516 | Ga0207428_100335162 | 349 |
| 522 | 3300028381 | Ga0268264_10000043 | Ga0268264_10000043122 | 349 |
| 523 | 3300028794 | Ga0307515_10272445 | Ga0307515_102724452 | 349 |
| 524 | 3300031616 | Ga0307508_10001059 | Ga0307508_1000105920 | 349 |
| 525 | 3300031616 | Ga0307508_10060565 | Ga0307508_100605654 | 349 |
| 526 | 3300031616 | Ga0307508_10110406 | Ga0307508_101104062 | 349 |
| 527 | 3300031730 | Ga0307516_10015493 | Ga0307516_100154936 | 349 |
| 528 | 3300035116 | Ga0373945_0021013 | Ga0373945_0021013_220_1269 | 349 |
| 529 | 3300035171 | Ga0373946_0003228 | Ga0373946_0003228_2608_3657 | 349 |
| 530 | 3300035172 | Ga0373955_0035662 | Ga0373955_0035662_1499_2548 | 349 |
| 531 | 3300035410 | Ga0373924_0017596 | Ga0373924_0017596_1044_2093 | 349 |
| 532 | 3300035691 | Ga0373931_0190368 | Ga0373931_0190368_34_1083 | 349 |
| 533 | 3300035692 | Ga0373935_0000435 | Ga0373935_0000435_3332_4381 | 349 |
| 534 | 3300035695 | Ga0373927_0002587 | Ga0373927_0002587_9028_10077 | 349 |
| 535 | 3300035695 | Ga0373927_0008673 | Ga0373927_0008673_2244_3293 | 349 |
| 536 | 3300035725 | Ga0373947_0012060 | Ga0373947_0012060_1410_2459 | 349 |
| 537 | 3300035725 | Ga0373947_0036798 | Ga0373947_0036798_725_1774 | 349 |
| 538 | 3300036401 | Ga0373937_0357645 | Ga0373937_0357645_205_1254 | 349 |
| 539 | 3300037068 | Ga0373925_0001774 | Ga0373925_0001774_4445_5494 | 349 |
| 540 | 3300037068 | Ga0373925_0113488 | Ga0373925_0113488_776_1825 | 349 |
| 541 | 3300039437 | Ga0436365_0417128 | Ga0436365_0417128_559_1629 | 349 |
| 542 | 3300039450 | Ga0436363_1347498 | Ga0436363_1347498_407_1456 | 349 |
| 543 | 3300044842 | Ga0466957_0028272 | Ga0466957_0028272_732_1781 | 349 |
| 544 | 3300045049 | Ga0466959_0011001 | Ga0466959_0011001_3771_4820 | 349 |
| 545 | 3300045049 | Ga0466959_0043000 | Ga0466959_0043000_1281_2366 | 349 |
| 546 | 3300045836 | Ga0466958_0017952 | Ga0466958_0017952_677_1726 | 349 |
| 547 | 3300046455 | Ga0495603_0001446 | Ga0495603_0001446_10506_11555 | 349 |
| 548 | 3300046459 | Ga0495629_0008069 | Ga0495629_0008069_2756_3805 | 349 |
| 549 | 3300046460 | Ga0495638_0086536 | Ga0495638_0086536_86_1135 | 349 |
| 550 | 3300046461 | Ga0495641_0007242 | Ga0495641_0007242_3176_4225 | 349 |
| 551 | 3300046462 | Ga0495651_0018417 | Ga0495651_0018417_87_1136 | 349 |
| 552 | 3300046462 | Ga0495651_0034663 | Ga0495651_0034663_1205_2329 | 349 |
| 553 | 3300046472 | Ga0495580_0001310 | Ga0495580_0001310_3552_4601 | 349 |
| 554 | 3300046473 | Ga0495582_0000545 | Ga0495582_0000545_4643_5692 | 349 |
| 555 | 3300046475 | Ga0495639_0010592 | Ga0495639_0010592_526_1575 | 349 |
| 556 | 3300046476 | Ga0495662_0000429 | Ga0495662_0000429_353_1402 | 349 |
| 557 | 3300046477 | Ga0495664_0022116 | Ga0495664_0022116_468_1517 | 349 |
| 558 | 3300046477 | Ga0495664_0173577 | Ga0495664_0173577_169_1218 | 349 |
| 559 | 3300046499 | Ga0495594_0000020 | Ga0495594_0000020_76274_77323 | 349 |
| 560 | 3300046516 | Ga0495628_0159369 | Ga0495628_0159369_71_1120 | 349 |
| 561 | 3300046517 | Ga0495630_0010792 | Ga0495630_0010792_4698_5747 | 349 |
| 562 | 3300046529 | Ga0495652_0111764 | Ga0495652_0111764_653_1702 | 349 |
| 563 | 3300046531 | Ga0495665_0000170 | Ga0495665_0000170_526_1575 | 349 |
| 564 | 3300046531 | Ga0495665_0107724 | Ga0495665_0107724_208_1257 | 349 |
| 565 | 3300046533 | Ga0495640_0002547 | Ga0495640_0002547_12854_13903 | 349 |
| 566 | 3300046536 | Ga0495587_0060059 | Ga0495587_0060059_312_1361 | 349 |
| 567 | 3300046557 | Ga0495622_0002079 | Ga0495622_0002079_912_1961 | 349 |
| 568 | 3300046615 | Ga0495656_0012948 | Ga0495656_0012948_1864_2913 | 349 |
| 569 | 3300046642 | Ga0495634_0000998 | Ga0495634_0000998_4929_5978 | 349 |
| 570 | 3300046663 | Ga0495635_0030879 | Ga0495635_0030879_1622_2671 | 349 |
| 571 | 3300046663 | Ga0495635_0240549 | Ga0495635_0240549_92_1141 | 349 |
| 572 | 3300046674 | Ga0495588_0015435 | Ga0495588_0015435_2140_3189 | 349 |
| 573 | 3300046678 | Ga0495599_0006305 | Ga0495599_0006305_1408_2457 | 349 |
| 574 | 3300046678 | Ga0495599_0049469 | Ga0495599_0049469_1235_2284 | 349 |
| 575 | 3300046678 | Ga0495599_0049581 | Ga0495599_0049581_661_1710 | 349 |
| 576 | 3300046678 | Ga0495599_0107295 | Ga0495599_0107295_553_1602 | 349 |
| 577 | 3300046680 | Ga0495646_0040056 | Ga0495646_0040056_941_1990 | 349 |
| 578 | 3300046680 | Ga0495646_0095903 | Ga0495646_0095903_392_1441 | 349 |
| 579 | 3300046681 | Ga0495647_0001303 | Ga0495647_0001303_3153_4202 | 349 |
| 580 | 3300046683 | Ga0495658_0002344 | Ga0495658_0002344_1284_2333 | 349 |
| 581 | 3300046689 | Ga0495613_0017244 | Ga0495613_0017244_1693_2742 | 349 |
| 582 | 3300046690 | Ga0495624_0009089 | Ga0495624_0009089_2197_3246 | 349 |
| 583 | 3300046809 | Ga0495600_0179951 | Ga0495600_0179951_254_1303 | 349 |
| 584 | 3300047315 | Ga0495581_0003140 | Ga0495581_0003140_526_1575 | 349 |
| 585 | 3300047319 | Ga0495674_0000600 | Ga0495674_0000600_5731_6780 | 349 |
| 586 | 3300047321 | Ga0495676_0037688 | Ga0495676_0037688_1476_2525 | 349 |
| 587 | 3300047321 | Ga0495676_0049266 | Ga0495676_0049266_1962_3011 | 349 |
| 588 | 3300047447 | Ga0495685_029342 | Ga0495685_029342_256_1305 | 349 |
| 589 | 3300047471 | Ga0495684_0041506 | Ga0495684_0041506_1607_2656 | 349 |
| 590 | 3300047471 | Ga0495684_0067514 | Ga0495684_0067514_426_1475 | 349 |
| 591 | 3300047673 | Ga0495593_0005773 | Ga0495593_0005773_1530_2579 | 349 |
| 592 | 3300048089 | Ga0495614_0028553 | Ga0495614_0028553_628_1677 | 349 |
| 593 | 3300048908 | Ga0496105_0124932 | Ga0496105_0124932_1042_2091 | 349 |
| 594 | 3300048909 | Ga0496106_0008202 | Ga0496106_0008202_1726_2847 | 349 |
| 595 | 3300048911 | Ga0496108_0096675 | Ga0496108_0096675_1282_2331 | 349 |
| 596 | 3300048914 | Ga0496111_0085614 | Ga0496111_0085614_333_1382 | 349 |
| 597 | 3300048914 | Ga0496111_0160899 | Ga0496111_0160899_255_1304 | 349 |
| 598 | 3300048918 | Ga0496115_0038527 | Ga0496115_0038527_441_1490 | 349 |
| 599 | 3300048919 | Ga0496116_0080543 | Ga0496116_0080543_27_1148 | 349 |
| 600 | 3300048920 | Ga0496117_0012161 | Ga0496117_0012161_6486_7607 | 349 |
| 601 | 3300048921 | Ga0496118_0001670 | Ga0496118_0001670_17096_18217 | 349 |
| 602 | 3300048924 | Ga0496121_0000183 | Ga0496121_0000183_37575_38696 | 349 |
| 603 | 3300048927 | Ga0496124_0001382 | Ga0496124_0001382_19163_20284 | 349 |
| 604 | 3300048927 | Ga0496124_0033784 | Ga0496124_0033784_2071_3120 | 349 |
| 605 | 3300048928 | Ga0496125_0048308 | Ga0496125_0048308_1017_2138 | 349 |
| 606 | 3300048929 | Ga0496126_0008321 | Ga0496126_0008321_9279_10400 | 349 |
| 607 | 3300048929 | Ga0496126_0013413 | Ga0496126_0013413_7048_8097 | 349 |
| 608 | 3300048929 | Ga0496126_0061727 | Ga0496126_0061727_684_1754 | 349 |
| 609 | 3300048929 | Ga0496126_0093975 | Ga0496126_0093975_1006_2055 | 349 |
| 610 | 3300049581 | Ga0501047_0014124 | Ga0501047_0014124_327_1376 | 349 |
| 611 | 3300049586 | Ga0501070_0148579 | Ga0501070_0148579_642_1691 | 349 |
| 612 | 3300049586 | Ga0501070_0204740 | Ga0501070_0204740_313_1362 | 349 |
| 613 | 3300049589 | Ga0501073_0062010 | Ga0501073_0062010_990_2039 | 349 |
| 614 | 3300049742 | Ga0501080_0142049 | Ga0501080_0142049_499_1548 | 349 |
| 615 | 3300049822 | Ga0501035_0210772 | Ga0501035_0210772_283_1332 | 349 |
| 616 | 3300049823 | Ga0501044_0070718 | Ga0501044_0070718_162_1211 | 349 |
| 617 | 3300050489 | nmdc:mga03683_118025_c1 | nmdc:mga03683_118025_c1_51_1115 | 349 |
| 618 | 3300050493 | nmdc:mga0k408_16841_c1 | nmdc:mga0k408_16841_c1_231_1295 | 349 |
| 619 | 3300050507 | nmdc:mga05p37_49134_c1 | nmdc:mga05p37_49134_c1_2552_3601 | 349 |
| 620 | 3300050508 | nmdc:mga09592_21012_c1 | nmdc:mga09592_21012_c1_2546_3595 | 349 |
| 621 | 3300050509 | nmdc:mga0qj67_23455_c1 | nmdc:mga0qj67_23455_c1_2871_3920 | 349 |
| 622 | 3300050510 | nmdc:mga06r32_3877_c1 | nmdc:mga06r32_3877_c1_9794_10843 | 349 |
| 623 | 3300050511 | nmdc:mga08y16_114740_c1 | nmdc:mga08y16_114740_c1_1306_2355 | 349 |
| 624 | 3300050511 | nmdc:mga08y16_4487_c1 | nmdc:mga08y16_4487_c1_1707_2756 | 349 |
| 625 | 3300053077 | Ga0495601_0135335 | Ga0495601_0135335_26_1075 | 349 |
| 626 | 3300053078 | Ga0495612_0060219 | Ga0495612_0060219_122_1171 | 349 |
| 627 | 3300053085 | Ga0495619_0137558 | Ga0495619_0137558_320_1369 | 349 |
| 628 | 3300053092 | Ga0500583_0099368 | Ga0500583_0099368_311_1360 | 349 |
| 629 | 3300053095 | Ga0500640_046339 | Ga0500640_046339_234_1283 | 349 |
| 630 | 3300053096 | Ga0500641_0034704 | Ga0500641_0034704_234_1283 | 349 |
| 631 | 3300053105 | Ga0500557_000071 | Ga0500557_000071_16309_17358 | 349 |
| 632 | 3300053119 | Ga0500595_017347 | Ga0500595_017347_1050_2099 | 349 |
| 633 | 3300053130 | Ga0500642_0000132 | Ga0500642_0000132_21929_22978 | 349 |
| 634 | 3300053130 | Ga0500642_0080193 | Ga0500642_0080193_324_1373 | 349 |
| 635 | 3300053140 | Ga0500573_0034401 | Ga0500573_0034401_1765_2814 | 349 |
| 636 | 3300053155 | Ga0500620_002592 | Ga0500620_002592_818_1867 | 349 |
| 637 | 3300053155 | Ga0500620_053111 | Ga0500620_053111_64_1140 | 349 |
| 638 | 3300053177 | Ga0500636_0000206 | Ga0500636_0000206_26218_27267 | 349 |
| 639 | 3300053177 | Ga0500636_0044375 | Ga0500636_0044375_473_1522 | 349 |
| 640 | 3300053729 | Ga0500625_002939 | Ga0500625_002939_3413_4462 | 349 |
| 641 | 3300053735 | Ga0500596_003022 | Ga0500596_003022_1698_2747 | 349 |
| 642 | 3300061719 | Ga0466962_0035597 | Ga0466962_0035597_1152_2201 | 349 |
| 643 | iso_pu_bacteria | 8019608314 | 8019617492 | 349 |
| 644 | 3300003215 | JGI25153J46596_10002928 | JGI25153J46596_100029287 | 350 |
| 645 | 3300005981 | Ga0081538_10016160 | Ga0081538_100161604 | 350 |
| 646 | 3300005983 | Ga0081540_1021269 | Ga0081540_10212694 | 350 |
| 647 | 3300007788 | Ga0099795_10007449 | Ga0099795_100074491 | 350 |
| 648 | 3300025297 | Ga0209758_1024907 | Ga0209758_10249073 | 350 |
| 649 | 3300037068 | Ga0373925_0039911 | Ga0373925_0039911_1306_2364 | 350 |
| 650 | 3300037853 | Ga0436364_0699776 | Ga0436364_0699776_540_1616 | 350 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9772 | 1 | 346 |
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.977 | 3 | 346 |
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9744 | 1 | 346 |
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.9714 | 3 | 346 |
| 1vkn-assembly1.cif.gz_C | crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution | 0.9517 | 4 | 346 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9922 | 149 | 315 | 3.30.360.10 |
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9864 | 149 | 315 | 3.30.360.10 |
| af_Q2G1H4_146_311_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9669 | 150 | 315 | 3.30.360.10 |
| af_Q2G1H4_146_311_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9612 | 150 | 315 | 3.30.360.10 |
| 3dr3A02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9606 | 150 | 316 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P2MPN0-F1-model_v4 | Uncharacterized protein MANES_15G144000 | 0.9962 | 204 | 346 |
|
| AF-R7UBN4-F1-model_v4 | Uncharacterized protein | 0.996 | 232 | 346 |
|
| AF-A0A850IUM2-F1-model_v4 | deleted | 0.9956 | 3 | 346 |
|
| AF-A0A484LE06-F1-model_v4 | Semialdehyde dehydrogenase dimerisation domain-containing protein | 0.9954 | 244 | 346 |
|
| AF-A0A699IMB6-F1-model_v4 | Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic | 0.9942 | 200 | 346 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar