F472501

General Info

Members Datasets Scaffolds Average Seq Length
650 430 529 347

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100098820|Ga0070697_1000988202
Length 401
Sequence MFIIEQASFANATARQGDCSIRLIQKRASAMFRCNSTETEYALRVVDKVMEAAVPSRSESKVAVVGASGYAGEELVRLLLGHPQANLVAATSRQFAGKTLAQIFPRFSHDEKARQLRVAESEPTQLARMAEIIFLALPHGVSAEIARSLVDLGVRVIDLSADFRIRDPNVYKEFYGIDHRAPELLGEAVYGLPEIYREKIRAAKLVACPGCYPTSILLPLLPLIRGRIVESRSIIATSLSGVTGAGRKVEADYLFAECNESVRAYGVPKHRHLSEIEQELTILAGEKITVQFTPHLVPVNRGILSTIYVDLNRNNDPGVIDSFYEKAYRDEPFVRLLGEQRLPDTKEVIGTNFIDIAWRIDHRTRRLIVMSAIDNLIKGTSGQAIQCFNLMRDYPETTGLL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2643221651 Afipia sp. Root123D2 Isolate Unclassified
13 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
14 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
15 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
16 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
28 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
29 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
30 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
31 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
32 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
33 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
34 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
35 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
36 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
37 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
38 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
39 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
40 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
41 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
42 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
43 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
48 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
49 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
50 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
51 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
52 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
53 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
54 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
55 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
56 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
57 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
58 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
59 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
60 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
61 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
62 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
63 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
64 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
65 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
66 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
67 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
68 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
69 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
70 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
71 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
72 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
73 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
74 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
75 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
76 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
77 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
78 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
79 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
80 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
81 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
82 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
83 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
84 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
85 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
86 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
87 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
88 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
89 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
90 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
91 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
92 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
93 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
94 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
95 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
96 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
97 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
98 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
99 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
100 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
101 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
102 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
103 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
104 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
105 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
106 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
109 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
110 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
111 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
112 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
113 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
122 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
123 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
128 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
129 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
130 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
131 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
140 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
144 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
149 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
150 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
154 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
155 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
156 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
157 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
161 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
162 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
163 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
164 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
165 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
166 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
167 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
168 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
169 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
171 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
172 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
177 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
178 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
179 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
180 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
181 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
182 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
183 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
184 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
232 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
256 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
271 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
272 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
276 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
394 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
397 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
398 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
399 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
400 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
401 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
402 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
403 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
404 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
405 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
406 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
407 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
410 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
412 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
416 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
417 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
418 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
419 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
420 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
421 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
422 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
423 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
424 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
425 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
426 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
427 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
428 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
429 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
430 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.76
Metatranscriptomes 0
Isolates 18.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 14.77
Rhizoplane 3.23
Rhizosphere 62
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002928 3300003215 Bacteria 9662
2 JGI25153J46596_10022590 3300003215 Bacteria 2313
3 rootL2_10176537 3300003322 Bacteria 2043
4 rootH1_10021139 3300003323 Bacteria 16333
5 Ga0065165_1011557 3300005262 Bacteria 3665
6 Ga0070658_10167908 3300005327 Bacteria 1843
7 Ga0070658_10188276 3300005327 Bacteria 1739
8 Ga0070683_100005606 3300005329 Bacteria 10489
9 Ga0070683_100006772 3300005329 Bacteria 9631
10 Ga0070680_100015488 3300005336 Bacteria 5980
11 Ga0070680_100149426 3300005336 Bacteria 1961
12 Ga0070668_100105438 3300005347 Bacteria 2238
13 Ga0070669_100078653 3300005353 Bacteria 2452
14 Ga0070669_100107058 3300005353 Bacteria 2117
15 Ga0070675_100043941 3300005354 Bacteria 3654
16 Ga0070675_100046550 3300005354 Bacteria 3552
17 Ga0070671_100003024 3300005355 Bacteria 13093
18 Ga0070674_100116470 3300005356 Bacteria 1971
19 Ga0070674_100141033 3300005356 Bacteria 1809
20 Ga0070674_100243525 3300005356 Unclassified 1409
21 Ga0070674_100281720 3300005356 Bacteria 1318
22 Ga0070667_100247234 3300005367 Bacteria 1594
23 Ga0070709_10058345 3300005434 Bacteria 2447
24 Ga0070709_10290993 3300005434 Bacteria 1190
25 Ga0070714_100166333 3300005435 Bacteria 1999
26 Ga0070714_100181389 3300005435 Bacteria 1916
27 Ga0070714_100306355 3300005435 Bacteria 1482
28 Ga0070713_100065531 3300005436 Bacteria 3052
29 Ga0070713_100141477 3300005436 Bacteria 2132
30 Ga0070713_100363358 3300005436 Bacteria 1345
31 Ga0070710_10011469 3300005437 Bacteria 4378
32 Ga0070711_100001071 3300005439 Bacteria 14608
33 Ga0070711_100091166 3300005439 Bacteria 2196
34 Ga0070694_100097086 3300005444 Bacteria 2078
35 Ga0070708_100072247 3300005445 Archaea 3108
36 Ga0070663_100087202 3300005455 Bacteria 2306
37 Ga0070678_100174146 3300005456 Bacteria 1755
38 Ga0070662_100047195 3300005457 Bacteria 3097
39 Ga0070681_10031723 3300005458 Bacteria 5304
40 Ga0070706_100001050 3300005467 Bacteria 30004
41 Ga0070706_100011938 3300005467 Bacteria 8064
42 Ga0070706_100075386 3300005467 Unclassified 3122
43 Ga0070706_100131320 3300005467 Bacteria 2337
44 Ga0070706_100144196 3300005467 Bacteria 2224
45 Ga0070707_100000860 3300005468 Bacteria 30160
46 Ga0070707_100048766 3300005468 Bacteria 4057
47 Ga0070707_100117122 3300005468 Bacteria 2586
48 Ga0070698_100008009 3300005471 Bacteria 11428
49 Ga0070698_100009276 3300005471 Bacteria 10556
50 Ga0070698_100137684 3300005471 Bacteria 2395
51 Ga0070698_100245755 3300005471 Unclassified 1722
52 Ga0070699_100014792 3300005518 Bacteria 6709
53 Ga0070699_100022962 3300005518 Bacteria 5373
54 Ga0070699_100041455 3300005518 Bacteria 3985
55 Ga0070699_100091212 3300005518 Bacteria 2664
56 Ga0070699_100189133 3300005518 Bacteria 1828
57 Ga0070699_100228284 3300005518 Bacteria 1660
58 Ga0070679_100026603 3300005530 Bacteria 5687
59 Ga0070684_100013256 3300005535 Bacteria 6641
60 Ga0070684_100037335 3300005535 Bacteria 4167
61 Ga0070697_100002620 3300005536 Bacteria 13850
62 Ga0070697_100031761 3300005536 Bacteria 4248
63 Ga0070697_100081430 3300005536 Bacteria 2668
64 Ga0070697_100098820 3300005536 Bacteria 2422
65 Ga0070697_100142484 3300005536 Bacteria 2016
66 Ga0070697_100233143 3300005536 Bacteria 1570
67 Ga0068853_100000053 3300005539 Bacteria 85446
68 Ga0068853_100244337 3300005539 Bacteria 1646
69 Ga0070672_100339646 3300005543 Bacteria 1279
70 Ga0070665_100028730 3300005548 Bacteria 5599
71 Ga0070665_100053942 3300005548 Bacteria 4032
72 Ga0070665_100090499 3300005548 Bacteria 3065
73 Ga0070665_100098748 3300005548 Bacteria 2924
74 Ga0068855_100146738 3300005563 Bacteria 2685
75 Ga0068855_100353362 3300005563 Bacteria 1619
76 Ga0070664_100298735 3300005564 Bacteria 1455
77 Ga0068857_100006858 3300005577 Bacteria 9800
78 Ga0068856_100390875 3300005614 Bacteria 1411
79 Ga0068852_100077937 3300005616 Bacteria 2931
80 Ga0068852_100123090 3300005616 Bacteria 2378
81 Ga0068859_100468478 3300005617 Bacteria 1355
82 Ga0068859_100505080 3300005617 Unclassified 1304
83 Ga0068866_10106922 3300005718 Bacteria 1554
84 Ga0068863_100205416 3300005841 Bacteria 1896
85 Ga0068860_100008418 3300005843 Bacteria 10274
86 Ga0068862_100078173 3300005844 Bacteria 2866
87 Ga0081538_10016160 3300005981 Bacteria 5738
88 Ga0081540_1000020 3300005983 Bacteria 163043
89 Ga0081540_1003158 3300005983 Bacteria 13152
90 Ga0081540_1021269 3300005983 Bacteria 3871
91 Ga0070717_10033478 3300006028 Bacteria 4146
92 Ga0070717_10064845 3300006028 Unclassified 3035
93 Ga0070717_10065514 3300006028 Bacteria 3020
94 Ga0070717_10068533 3300006028 Bacteria 2953
95 Ga0070717_10366217 3300006028 Unclassified 1291
96 Ga0075365_10053206 3300006038 Bacteria 2680
97 Ga0075365_10230250 3300006038 Bacteria 1301
98 Ga0075368_10002969 3300006042 Bacteria 5601
99 Ga0075368_10016302 3300006042 Bacteria 2769
100 Ga0075363_100147580 3300006048 Bacteria 1326
101 Ga0070715_10016848 3300006163 Bacteria 2755
102 Ga0070716_100132079 3300006173 Bacteria 1580
103 Ga0070712_100238027 3300006175 Unclassified 1449
104 Ga0075362_10073845 3300006177 Bacteria 1562
105 Ga0075362_10106912 3300006177 Bacteria 1314
106 Ga0075367_10076377 3300006178 Bacteria 2021
107 Ga0075367_10111756 3300006178 Bacteria 1678
108 Ga0075367_10121551 3300006178 Bacteria 1609
109 Ga0075369_10084131 3300006186 Bacteria 1414
110 Ga0075366_10001495 3300006195 Bacteria 11673
111 Ga0075366_10015523 3300006195 Bacteria 4368
112 Ga0075370_10039630 3300006353 Bacteria 2655
113 Ga0075370_10069162 3300006353 Bacteria 2017
114 Ga0075370_10143693 3300006353 Bacteria 1395
115 Ga0075428_100041368 3300006844 Bacteria 5069
116 Ga0075428_100055937 3300006844 Bacteria 4322
117 Ga0075428_100502522 3300006844 Bacteria 1297
118 Ga0075430_100040236 3300006846 Bacteria 3957
119 Ga0075430_100372347 3300006846 Bacteria 1179
120 Ga0075431_100036260 3300006847 Bacteria 5079
121 Ga0075433_10036576 3300006852 Bacteria 4230
122 Ga0075434_100140232 3300006871 Bacteria 2437
123 Ga0075429_100015588 3300006880 Bacteria 6587
124 Ga0075436_100027892 3300006914 Bacteria 3887
125 Ga0075436_100085016 3300006914 Bacteria 2196
126 Ga0097620_100468487 3300006931 Bacteria 1355
127 Ga0097620_100505016 3300006931 Unclassified 1304
128 Ga0075435_100070822 3300007076 Bacteria 2847
129 Ga0099794_10029452 3300007265 Bacteria 2558
130 Ga0099795_10007449 3300007788 Bacteria 3057
131 Ga0111539_10014710 3300009094 Bacteria 9762
132 Ga0111539_10042364 3300009094 Bacteria 5467
133 Ga0105245_10324473 3300009098 Bacteria 1518
134 Ga0114129_10002219 3300009147 Bacteria 26787
135 Ga0114129_10060268 3300009147 Bacteria 5306
136 Ga0105243_10001455 3300009148 Bacteria 20801
137 Ga0105248_10040070 3300009177 Bacteria 5250
138 Ga0105237_10080055 3300009545 Bacteria 3257
139 Ga0105237_10270496 3300009545 Bacteria 1702
140 Ga0105238_10014128 3300009551 Bacteria 8075
141 Ga0105249_10173207 3300009553 Bacteria 2094
142 Ga0105239_10112781 3300010375 Bacteria 3015
143 Ga0157369_10003699 3300013105 Bacteria 18177
144 Ga0157369_10016823 3300013105 Bacteria 8219
145 Ga0157374_10053155 3300013296 Bacteria 3775
146 Ga0157374_10092239 3300013296 Bacteria 2890
147 Ga0157378_10023465 3300013297 Bacteria 5428
148 Ga0157378_10225964 3300013297 Unclassified 1781
149 Ga0157378_10338349 3300013297 Bacteria 1467
150 Ga0157378_10594832 3300013297 Bacteria 1117
151 Ga0157372_10053685 3300013307 Bacteria 4493
152 Ga0157372_10136377 3300013307 Unclassified 2826
153 Ga0163163_10109104 3300014325 Bacteria 2795
154 Ga0157380_10214935 3300014326 Bacteria 1716
155 Ga0157379_10124007 3300014968 Bacteria 2324
156 Ga0157376_10047669 3300014969 Unclassified 3539
157 Ga0157376_10467884 3300014969 Bacteria 1233
158 Ga0157376_10550684 3300014969 Bacteria 1142
159 Ga0209563_101672 3300025230 Bacteria 5636
160 Ga0209677_102352 3300025253 Bacteria 7239
161 Ga0209758_1002215 3300025297 Bacteria 20262
162 Ga0209758_1002500 3300025297 Bacteria 18668
163 Ga0209758_1003196 3300025297 Bacteria 15292
164 Ga0209758_1024907 3300025297 Bacteria 2647
165 Ga0207426_1007061 3300025302 Bacteria 4757
166 Ga0207426_1007558 3300025302 Bacteria 4529
167 Ga0209257_1034669 3300025304 Bacteria 1571
168 Ga0207692_10129454 3300025898 Bacteria 1423
169 Ga0207642_10208440 3300025899 Bacteria 1084
170 Ga0207688_10032942 3300025901 Bacteria 2864
171 Ga0207685_10055546 3300025905 Bacteria 1546
172 Ga0207699_10089032 3300025906 Bacteria 1933
173 Ga0207699_10255215 3300025906 Bacteria 1210
174 Ga0207643_10116528 3300025908 Bacteria 1578
175 Ga0207684_10001226 3300025910 Bacteria 28469
176 Ga0207684_10059683 3300025910 Bacteria 3239
177 Ga0207684_10087388 3300025910 Bacteria 2656
178 Ga0207684_10138337 3300025910 Unclassified 2092
179 Ga0207707_10015990 3300025912 Bacteria 6544
180 Ga0207707_10092324 3300025912 Bacteria 2645
181 Ga0207695_10280825 3300025913 Bacteria 1559
182 Ga0207671_10013859 3300025914 Bacteria 6402
183 Ga0207660_10272761 3300025917 Bacteria 1340
184 Ga0207649_10110600 3300025920 Bacteria 1835
185 Ga0207646_10000972 3300025922 Bacteria 36941
186 Ga0207646_10001722 3300025922 Bacteria 26594
187 Ga0207646_10010284 3300025922 Bacteria 9157
188 Ga0207646_10097940 3300025922 Bacteria 2628
189 Ga0207681_10200228 3300025923 Bacteria 1533
190 Ga0207681_10355008 3300025923 Bacteria 1174
191 Ga0207681_10385995 3300025923 Bacteria 1128
192 Ga0207659_10088096 3300025926 Bacteria 2312
193 Ga0207659_10094567 3300025926 Bacteria 2239
194 Ga0207659_10268644 3300025926 Bacteria 1390
195 Ga0207700_10021835 3300025928 Bacteria 4380
196 Ga0207700_10120517 3300025928 Bacteria 2126
197 Ga0207664_10149144 3300025929 Unclassified 1985
198 Ga0207664_10241103 3300025929 Bacteria 1574
199 Ga0207706_10221862 3300025933 Bacteria 1655
200 Ga0207709_10001978 3300025935 Bacteria 13364
201 Ga0207665_10033693 3300025939 Bacteria 3397
202 Ga0207691_10287467 3300025940 Bacteria 1414
203 Ga0207691_10380438 3300025940 Bacteria 1205
204 Ga0207689_10023076 3300025942 Bacteria 5225
205 Ga0207661_10003495 3300025944 Bacteria 10912
206 Ga0207661_10079177 3300025944 Bacteria 2708
207 Ga0207661_10100708 3300025944 Bacteria 2425
208 Ga0207661_10209159 3300025944 Bacteria 1719
209 Ga0207679_10007469 3300025945 Bacteria 6937
210 Ga0207679_10282194 3300025945 Bacteria 1425
211 Ga0207667_10154237 3300025949 Bacteria 2364
212 Ga0207667_10394908 3300025949 Bacteria 1408
213 Ga0207651_10004939 3300025960 Bacteria 6807
214 Ga0207651_10247015 3300025960 Bacteria 1458
215 Ga0207668_10297558 3300025972 Bacteria 1330
216 Ga0207658_10321648 3300025986 Bacteria 1339
217 Ga0207677_10270995 3300026023 Bacteria 1389
218 Ga0207703_10039350 3300026035 Bacteria 3779
219 Ga0207703_10200593 3300026035 Bacteria 1773
220 Ga0207639_10000001 3300026041 Bacteria 1431562
221 Ga0207639_10053911 3300026041 Bacteria 3071
222 Ga0207639_10073292 3300026041 Bacteria 2684
223 Ga0207639_10108702 3300026041 Bacteria 2255
224 Ga0207639_10130893 3300026041 Bacteria 2077
225 Ga0207678_10049664 3300026067 Bacteria 3626
226 Ga0207678_10062685 3300026067 Bacteria 3195
227 Ga0207641_10222569 3300026088 Bacteria 1751
228 Ga0207683_10108103 3300026121 Bacteria 2489
229 Ga0207683_10195592 3300026121 Bacteria 1837
230 Ga0207683_10234524 3300026121 Bacteria 1673
231 Ga0209389_1000969 3300027296 Bacteria 18934
232 Ga0209489_108549 3300027361 Bacteria 13807
233 Ga0209700_100036 3300027363 Bacteria 187888
234 Ga0209588_1020310 3300027671 Bacteria 2080
235 Ga0207428_10033516 3300027907 Bacteria 4218
236 Ga0268266_10054352 3300028379 Bacteria 3440
237 Ga0268266_10200038 3300028379 Unclassified 1828
238 Ga0268264_10000043 3300028381 Bacteria 371761
239 Ga0265319_1001566 3300028563 Bacteria 13424
240 Ga0265319_1008064 3300028563 Bacteria 4656
241 Ga0265319_1011763 3300028563 Bacteria 3565
242 Ga0307515_10272445 3300028794 Bacteria 1412
243 Ga0265338_10079347 3300028800 Bacteria 2762
244 Ga0265338_10084077 3300028800 Unclassified 2658
245 Ga0265338_10126950 3300028800 Bacteria 2022
246 Ga0307511_10129144 3300030521 Bacteria 1529
247 Ga0265325_10070043 3300031241 Bacteria 1762
248 Ga0265339_10019806 3300031249 Bacteria 3941
249 Ga0265331_10070824 3300031250 Bacteria 1632
250 Ga0265316_10034216 3300031344 Bacteria 4129
251 Ga0307408_100001553 3300031548 Bacteria 16983
252 Ga0307408_100005094 3300031548 Bacteria 8817
253 Ga0307508_10001059 3300031616 Bacteria 31801
254 Ga0307508_10060565 3300031616 Bacteria 3346
255 Ga0307508_10110406 3300031616 Bacteria 2349
256 Ga0265342_10002731 3300031712 Bacteria 15016
257 Ga0316576_10000938 3300031727 Bacteria 14898
258 Ga0316578_10006890 3300031728 Bacteria 5649
259 Ga0307516_10015493 3300031730 Bacteria 8019
260 Ga0316577_10011046 3300031733 Bacteria 4885
261 Ga0307406_10000620 3300031901 Bacteria 20259
262 Ga0307409_100030172 3300031995 Bacteria 3892
263 Ga0307409_100090269 3300031995 Bacteria 2508
264 Ga0307415_100052195 3300032126 Bacteria 2779
265 Ga0307510_10010241 3300033180 Bacteria 11147
266 Ga0315911_1000001 3300033442 Bacteria 1088602
267 Ga0373944_0005144 3300035089 Bacteria 3437
268 Ga0373945_0008018 3300035116 Bacteria 3430
269 Ga0373945_0021013 3300035116 Bacteria 2239
270 Ga0373943_0049080 3300035170 Bacteria 2070
271 Ga0373946_0003228 3300035171 Bacteria 5789
272 Ga0373955_0035662 3300035172 Bacteria 2635
273 Ga0373924_0006263 3300035410 Bacteria 4256
274 Ga0373924_0017596 3300035410 Bacteria 2744
275 Ga0373931_0037237 3300035691 Bacteria 2540
276 Ga0373931_0190368 3300035691 Bacteria 1220
277 Ga0373935_0000435 3300035692 Bacteria 21766
278 Ga0373927_0002587 3300035695 Bacteria 13194
279 Ga0373927_0008673 3300035695 Bacteria 6833
280 Ga0373927_0183294 3300035695 Bacteria 1374
281 Ga0373933_0031946 3300035724 Bacteria 3057
282 Ga0373933_0178204 3300035724 Bacteria 1355
283 Ga0373947_0007586 3300035725 Bacteria 6278
284 Ga0373947_0012060 3300035725 Bacteria 4949
285 Ga0373947_0036798 3300035725 Bacteria 2903
286 Ga0373947_0160666 3300035725 Bacteria 1453
287 Ga0373937_0026658 3300036401 Bacteria 5221
288 Ga0373937_0357645 3300036401 Bacteria 1383
289 Ga0373925_0001774 3300037068 Bacteria 18013
290 Ga0373925_0039911 3300037068 Bacteria 3474
291 Ga0373925_0054102 3300037068 Bacteria 3001
292 Ga0373925_0103549 3300037068 Bacteria 2191
293 Ga0373925_0113488 3300037068 Bacteria 2096
294 Ga0373925_0336507 3300037068 Bacteria 1224
295 Ga0436364_0699776 3300037853 Bacteria 2850
296 Ga0400490_08718 3300038726 Bacteria 17463
297 Ga0400491_02437 3300038727 Bacteria 3312
298 Ga0400483_206430 3300039062 Bacteria 78978
299 Ga0436365_0417128 3300039437 Bacteria 2498
300 Ga0436365_0584888 3300039437 Bacteria 2364
301 Ga0436365_1401961 3300039437 Bacteria 2404
302 Ga0436363_1347498 3300039450 Bacteria 5320
303 Ga0451793_1479997 3300041452 Bacteria 1221
304 Ga0450923_021562 3300042125 Bacteria 1257
305 Ga0439446_0005273 3300042156 Unclassified 3319
306 Ga0439434_0046397 3300042435 Unclassified 1341
307 Ga0451577_0000011 3300042876 Bacteria 597389
308 Ga0451577_0006289 3300042876 Bacteria 11889
309 Ga0451577_0018580 3300042876 Bacteria 6402
310 Ga0451577_0075704 3300042876 Bacteria 3001
311 Ga0451577_0225061 3300042876 Bacteria 1696
312 Ga0453683_0000007 3300044673 Bacteria 581341
313 Ga0453683_0000043 3300044673 Bacteria 217530
314 Ga0453684_0000224 3300044712 Bacteria 248668
315 Ga0453684_0009668 3300044712 Bacteria 16795
316 Ga0453684_0300983 3300044712 Bacteria 1823
317 Ga0466957_0028272 3300044842 Bacteria 3338
318 Ga0466959_0011001 3300045049 Bacteria 6494
319 Ga0466959_0043000 3300045049 Bacteria 3332
320 Ga0466959_0247568 3300045049 Bacteria 1230
321 Ga0451576_0009359 3300045051 Bacteria 11362
322 Ga0451576_0016026 3300045051 Bacteria 8282
323 Ga0451576_0124221 3300045051 Bacteria 2689
324 Ga0451576_0226593 3300045051 Bacteria 1952
325 Ga0451576_0371263 3300045051 Bacteria 1499
326 Ga0466958_0017952 3300045836 Bacteria 4100
327 Ga0495592_0047468 3300046454 Bacteria 3198
328 Ga0495592_0125968 3300046454 Bacteria 1797
329 Ga0495603_0001446 3300046455 Bacteria 13824
330 Ga0495603_0046198 3300046455 Bacteria 2595
331 Ga0495603_0110991 3300046455 Bacteria 1600
332 Ga0495629_0008069 3300046459 Bacteria 7750
333 Ga0495629_0046573 3300046459 Bacteria 3042
334 Ga0495629_0128970 3300046459 Bacteria 1762
335 Ga0495638_0052409 3300046460 Bacteria 2541
336 Ga0495638_0086536 3300046460 Bacteria 1894
337 Ga0495641_0007242 3300046461 Bacteria 6978
338 Ga0495651_0018417 3300046462 Bacteria 5409
339 Ga0495651_0034663 3300046462 Bacteria 3934
340 Ga0495651_0073151 3300046462 Bacteria 2602
341 Ga0495653_0272292 3300046463 Bacteria 1115
342 Ga0495580_0001310 3300046472 Bacteria 21988
343 Ga0495580_0171641 3300046472 Bacteria 1499
344 Ga0495582_0000545 3300046473 Bacteria 20797
345 Ga0495582_0019184 3300046473 Bacteria 3741
346 Ga0495639_0010592 3300046475 Bacteria 3970
347 Ga0495662_0000429 3300046476 Bacteria 18792
348 Ga0495664_0022116 3300046477 Bacteria 3681
349 Ga0495664_0097184 3300046477 Bacteria 1772
350 Ga0495664_0173577 3300046477 Bacteria 1308
351 Ga0495584_0025083 3300046491 Bacteria 3022
352 Ga0495594_0000020 3300046499 Bacteria 80534
353 Ga0495606_0045016 3300046507 Bacteria 2929
354 Ga0495618_0061407 3300046514 Bacteria 2384
355 Ga0495628_0159369 3300046516 Bacteria 1715
356 Ga0495630_0010792 3300046517 Bacteria 6594
357 Ga0495630_0044087 3300046517 Bacteria 3333
358 Ga0495632_0040857 3300046519 Bacteria 2333
359 Ga0495643_0142019 3300046522 Bacteria 1196
360 Ga0495644_0062393 3300046523 Bacteria 1400
361 Ga0495648_0153077 3300046524 Bacteria 1201
362 Ga0495666_0034184 3300046526 Bacteria 2481
363 Ga0495652_0111764 3300046529 Bacteria 2196
364 Ga0495665_0000170 3300046531 Bacteria 32921
365 Ga0495665_0107724 3300046531 Bacteria 1462
366 Ga0495640_0002547 3300046533 Bacteria 14649
367 Ga0495586_0111222 3300046535 Bacteria 1525
368 Ga0495587_0060059 3300046536 Bacteria 2230
369 Ga0495609_0025737 3300046538 Bacteria 2696
370 Ga0495622_0002079 3300046557 Bacteria 9785
371 Ga0495622_0026866 3300046557 Bacteria 2686
372 Ga0495633_0058257 3300046558 Bacteria 1813
373 Ga0495667_0046148 3300046559 Bacteria 2882
374 Ga0495656_0012948 3300046615 Bacteria 3092
375 Ga0495634_0000998 3300046642 Bacteria 26678
376 Ga0495634_0104132 3300046642 Bacteria 1831
377 Ga0495635_0030879 3300046663 Bacteria 3722
378 Ga0495635_0240549 3300046663 Bacteria 1221
379 Ga0495588_0010035 3300046674 Bacteria 4389
380 Ga0495588_0015435 3300046674 Bacteria 3676
381 Ga0495588_0046936 3300046674 Bacteria 2216
382 Ga0495599_0006305 3300046678 Bacteria 7147
383 Ga0495599_0049469 3300046678 Bacteria 2635
384 Ga0495599_0049581 3300046678 Bacteria 2632
385 Ga0495599_0107295 3300046678 Bacteria 1740
386 Ga0495623_0085754 3300046679 Bacteria 1942
387 Ga0495646_0040056 3300046680 Bacteria 2887
388 Ga0495646_0095903 3300046680 Bacteria 1706
389 Ga0495647_0001303 3300046681 Bacteria 7665
390 Ga0495658_0002344 3300046683 Bacteria 9568
391 Ga0495658_0117760 3300046683 Bacteria 1603
392 Ga0495613_0017244 3300046689 Bacteria 5380
393 Ga0495624_0009089 3300046690 Bacteria 6894
394 Ga0495649_0106080 3300046694 Bacteria 1491
395 Ga0495649_0110719 3300046694 Bacteria 1456
396 Ga0495600_0179951 3300046809 Bacteria 1363
397 Ga0495600_0223757 3300046809 Bacteria 1203
398 Ga0495581_0003140 3300047315 Bacteria 9453
399 Ga0495581_0023393 3300047315 Bacteria 3580
400 Ga0495674_0000600 3300047319 Bacteria 33795
401 Ga0495674_0077886 3300047319 Bacteria 2850
402 Ga0495676_0037688 3300047321 Bacteria 4021
403 Ga0495676_0049266 3300047321 Bacteria 3389
404 Ga0495676_0196207 3300047321 Bacteria 1405
405 Ga0495685_029342 3300047447 Bacteria 1891
406 Ga0495684_0035362 3300047471 Bacteria 3831
407 Ga0495684_0041506 3300047471 Bacteria 3526
408 Ga0495684_0067514 3300047471 Bacteria 2719
409 Ga0495686_0140430 3300047472 Bacteria 1426
410 Ga0495593_0005773 3300047673 Bacteria 7300
411 Ga0495602_0290638 3300048088 Bacteria 1200
412 Ga0495614_0028553 3300048089 Bacteria 2403
413 Ga0496101_0045055 3300048904 Bacteria 3158
414 Ga0496102_0790019 3300048905 Bacteria 872
415 Ga0496103_0182648 3300048906 Bacteria 1348
416 Ga0496104_0070744 3300048907 Bacteria 3317
417 Ga0496105_0065322 3300048908 Bacteria 3003
418 Ga0496105_0124932 3300048908 Bacteria 2121
419 Ga0496106_0008202 3300048909 Bacteria 7720
420 Ga0496106_0085862 3300048909 Bacteria 2423
421 Ga0496106_0251821 3300048909 Bacteria 1412
422 Ga0496107_0050312 3300048910 Bacteria 3004
423 Ga0496108_0096675 3300048911 Bacteria 2516
424 Ga0496110_0071103 3300048913 Bacteria 3084
425 Ga0496111_0071461 3300048914 Bacteria 2526
426 Ga0496111_0085614 3300048914 Bacteria 2305
427 Ga0496111_0160899 3300048914 Bacteria 1667
428 Ga0496112_0034260 3300048915 Bacteria 4940
429 Ga0496112_0386985 3300048915 Bacteria 1339
430 Ga0496114_0105958 3300048917 Bacteria 2405
431 Ga0496115_0038527 3300048918 Bacteria 3793
432 Ga0496115_0196810 3300048918 Bacteria 1665
433 Ga0496116_0049722 3300048919 Bacteria 2800
434 Ga0496116_0080543 3300048919 Bacteria 2022
435 Ga0496117_0012161 3300048920 Bacteria 7622
436 Ga0496117_0130733 3300048920 Bacteria 1522
437 Ga0496118_0001670 3300048921 Bacteria 32550
438 Ga0496118_0075771 3300048921 Bacteria 2397
439 Ga0496119_0074812 3300048922 Bacteria 1971
440 Ga0496121_0000183 3300048924 Bacteria 139168
441 Ga0496121_0072999 3300048924 Bacteria 2752
442 Ga0496121_0118231 3300048924 Bacteria 2007
443 Ga0496121_0157177 3300048924 Bacteria 1667
444 Ga0496124_0001382 3300048927 Bacteria 36359
445 Ga0496124_0033784 3300048927 Bacteria 4496
446 Ga0496125_0048308 3300048928 Bacteria 3550
447 Ga0496126_0004782 3300048929 Bacteria 15924
448 Ga0496126_0008321 3300048929 Bacteria 11202
449 Ga0496126_0013413 3300048929 Bacteria 8338
450 Ga0496126_0042307 3300048929 Bacteria 4208
451 Ga0496126_0061727 3300048929 Bacteria 3366
452 Ga0496126_0093975 3300048929 Bacteria 2632
453 Ga0495682_0041561 3300049460 Bacteria 1685
454 Ga0501034_0148900 3300049571 Bacteria 2317
455 Ga0501047_0014124 3300049581 Bacteria 7588
456 Ga0501048_0308176 3300049582 Bacteria 1127
457 Ga0501070_0148579 3300049586 Bacteria 1934
458 Ga0501070_0204740 3300049586 Bacteria 1620
459 Ga0501071_0025032 3300049587 Bacteria 4179
460 Ga0501073_0037221 3300049589 Bacteria 3456
461 Ga0501073_0062010 3300049589 Bacteria 2608
462 Ga0501073_0115904 3300049589 Bacteria 1857
463 Ga0501075_0118924 3300049591 Bacteria 2010
464 Ga0501075_0148936 3300049591 Unclassified 1784
465 Ga0501079_0074514 3300049741 Bacteria 2624
466 Ga0501080_0142049 3300049742 Bacteria 2219
467 Ga0501035_0210772 3300049822 Bacteria 1662
468 Ga0501044_0070718 3300049823 Bacteria 3549
469 Ga0501044_0137022 3300049823 Bacteria 2439
470 Ga0501045_0060948 3300049824 Bacteria 2767
471 nmdc:mga03683_118025_c1 3300050489 Bacteria 1177
472 nmdc:mga03n38_10058_c1 3300050490 Bacteria 3465
473 nmdc:mga0k408_14943_c1 3300050493 Bacteria 4288
474 nmdc:mga0k408_16841_c1 3300050493 Bacteria 4063
475 nmdc:mga0k408_18216_c1 3300050493 Bacteria 3918
476 nmdc:mga06z11_50511_c1 3300050494 Bacteria 2126
477 nmdc:mga06z11_94845_c1 3300050494 Bacteria 1627
478 nmdc:mga07m45_28463_c1 3300050496 Bacteria 3084
479 nmdc:mga05p37_386_c1 3300050507 Bacteria 47260
480 nmdc:mga05p37_49134_c1 3300050507 Bacteria 5189
481 nmdc:mga09592_21012_c1 3300050508 Bacteria 5375
482 nmdc:mga0qj67_23455_c1 3300050509 Bacteria 4748
483 nmdc:mga06r32_3877_c1 3300050510 Bacteria 13395
484 nmdc:mga08y16_114740_c1 3300050511 Bacteria 2804
485 nmdc:mga08y16_4487_c1 3300050511 Bacteria 14585
486 nmdc:mga0n895_36005_c1 3300050512 Bacteria 4776
487 nmdc:mga0rr50_5199_c1 3300050513 Bacteria 7738
488 nmdc:mga0a205_44880_c1 3300050515 Bacteria 4262
489 nmdc:mga0sz30_35016_c1 3300050516 Bacteria 2093
490 Ga0495601_0035091 3300053077 Unclassified 3130
491 Ga0495601_0135335 3300053077 Bacteria 1606
492 Ga0495612_0027346 3300053078 Bacteria 2293
493 Ga0495612_0060219 3300053078 Bacteria 1571
494 Ga0495619_0137558 3300053085 Bacteria 1680
495 Ga0495619_0227812 3300053085 Unclassified 1291
496 Ga0500583_0099368 3300053092 Bacteria 1424
497 Ga0500651_0042489 3300053093 Bacteria 2864
498 Ga0500566_0001358 3300053094 Bacteria 14315
499 Ga0500640_046339 3300053095 Bacteria 1906
500 Ga0500641_0017411 3300053096 Bacteria 2687
501 Ga0500641_0034704 3300053096 Bacteria 2009
502 Ga0500555_000354 3300053103 Bacteria 19470
503 Ga0500557_000071 3300053105 Bacteria 39461
504 Ga0500569_054745 3300053109 Bacteria 1215
505 Ga0500594_0042173 3300053118 Bacteria 1253
506 Ga0500595_002414 3300053119 Bacteria 9324
507 Ga0500595_017347 3300053119 Bacteria 2659
508 Ga0500642_0000132 3300053130 Bacteria 33714
509 Ga0500642_0052489 3300053130 Bacteria 1805
510 Ga0500642_0080193 3300053130 Bacteria 1498
511 Ga0500573_0034401 3300053140 Bacteria 2923
512 Ga0500616_0001441 3300053153 Bacteria 22831
513 Ga0500620_002592 3300053155 Bacteria 3682
514 Ga0500620_053111 3300053155 Bacteria 1364
515 Ga0500634_0037633 3300053161 Bacteria 2631
516 Ga0500636_0000206 3300053177 Bacteria 31849
517 Ga0500636_0044375 3300053177 Bacteria 2622
518 Ga0500625_002939 3300053729 Bacteria 6573
519 Ga0500645_000232 3300053730 Bacteria 42429
520 Ga0500645_009547 3300053730 Bacteria 3255
521 Ga0500645_021447 3300053730 Unclassified 1994
522 Ga0500596_003022 3300053735 Bacteria 3246
523 Ga0590071_000105 3300059421 Bacteria 24044
524 Ga0590074_001380 3300059423 Bacteria 3888
525 Ga0590075_001105 3300059424 Bacteria 6954
526 Ga0590075_028523 3300059424 Bacteria 1410
527 Ga0501082_0055092 3300060353 Bacteria 3427
528 Ga0466962_0035597 3300061719 Bacteria 2383
529 Ga0530510_0300863 3300061734 Bacteria 1200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0371263 Ga0451576_0371263_386_1210 270
2 3300048905 Ga0496102_0790019 Ga0496102_0790019_19_843 270
3 3300048909 Ga0496106_0251821 Ga0496106_0251821_157_981 270
4 3300030521 Ga0307511_10129144 Ga0307511_101291442 305
5 3300046463 Ga0495653_0272292 Ga0495653_0272292_178_1095 305
6 3300046535 Ga0495586_0111222 Ga0495586_0111222_61_978 305
7 3300046558 Ga0495633_0058257 Ga0495633_0058257_11_928 305
8 3300046642 Ga0495634_0104132 Ga0495634_0104132_849_1766 305
9 3300047321 Ga0495676_0196207 Ga0495676_0196207_11_928 305
10 3300009147 Ga0114129_10002219 Ga0114129_1000221916 306
11 3300050507 nmdc:mga05p37_386_c1 nmdc:mga05p37_386_c1_41603_42535 306
12 3300006042 Ga0075368_10016302 Ga0075368_100163023 309
13 3300013297 Ga0157378_10594832 Ga0157378_105948321 312
14 3300006844 Ga0075428_100502522 Ga0075428_1005025221 318
15 3300038726 Ga0400490_08718 Ga0400490_08718_6645_7682 319
16 3300038727 Ga0400491_02437 Ga0400491_02437_460_1497 319
17 3300013296 Ga0157374_10053155 Ga0157374_100531552 320
18 3300013307 Ga0157372_10053685 Ga0157372_100536852 320
19 3300028563 Ga0265319_1001566 Ga0265319_10015664 321
20 3300028563 Ga0265319_1011763 Ga0265319_10117633 321
21 3300025922 Ga0207646_10010284 Ga0207646_100102845 322
22 3300025944 Ga0207661_10209159 Ga0207661_102091591 322
23 3300053153 Ga0500616_0001441 Ga0500616_0001441_13115_14101 322
24 3300059424 Ga0590075_028523 Ga0590075_028523_356_1345 322
25 3300045051 Ga0451576_0009359 Ga0451576_0009359_4277_5266 324
26 3300005548 Ga0070665_100098748 Ga0070665_1000987482 325
27 3300006852 Ga0075433_10036576 Ga0075433_100365762 325
28 3300009177 Ga0105248_10040070 Ga0105248_100400705 325
29 3300014969 Ga0157376_10550684 Ga0157376_105506841 325
30 3300049582 Ga0501048_0308176 Ga0501048_0308176_35_1027 325
31 3300049589 Ga0501073_0037221 Ga0501073_0037221_1392_2387 325
32 3300049591 Ga0501075_0118924 Ga0501075_0118924_828_1823 325
33 3300049741 Ga0501079_0074514 Ga0501079_0074514_136_1131 325
34 3300049824 Ga0501045_0060948 Ga0501045_0060948_1411_2403 325
35 3300050515 nmdc:mga0a205_44880_c1 nmdc:mga0a205_44880_c1_2744_3739 325
36 3300060353 Ga0501082_0055092 Ga0501082_0055092_1626_2621 325
37 3300005354 Ga0070675_100043941 Ga0070675_1000439411 327
38 3300005354 Ga0070675_100046550 Ga0070675_1000465503 327
39 3300005355 Ga0070671_100003024 Ga0070671_10000302414 327
40 3300005356 Ga0070674_100141033 Ga0070674_1001410331 327
41 3300005367 Ga0070667_100247234 Ga0070667_1002472342 327
42 3300005456 Ga0070678_100174146 Ga0070678_1001741462 327
43 3300005548 Ga0070665_100053942 Ga0070665_1000539423 327
44 3300006042 Ga0075368_10002969 Ga0075368_100029694 327
45 3300006178 Ga0075367_10121551 Ga0075367_101215512 327
46 3300006195 Ga0075366_10001495 Ga0075366_1000149513 327
47 3300006195 Ga0075366_10015523 Ga0075366_100155234 327
48 3300014326 Ga0157380_10214935 Ga0157380_102149352 327
49 3300025926 Ga0207659_10088096 Ga0207659_100880962 327
50 3300025926 Ga0207659_10094567 Ga0207659_100945673 327
51 3300025940 Ga0207691_10380438 Ga0207691_103804381 327
52 3300025945 Ga0207679_10007469 Ga0207679_100074697 327
53 3300025960 Ga0207651_10004939 Ga0207651_100049396 327
54 3300025986 Ga0207658_10321648 Ga0207658_103216481 327
55 3300026067 Ga0207678_10049664 Ga0207678_100496644 327
56 3300026121 Ga0207683_10108103 Ga0207683_101081033 327
57 3300042125 Ga0450923_021562 Ga0450923_021562_125_1132 327
58 3300042156 Ga0439446_0005273 Ga0439446_0005273_573_1592 327
59 3300042435 Ga0439434_0046397 Ga0439434_0046397_198_1217 327
60 3300049587 Ga0501071_0025032 Ga0501071_0025032_2942_3943 327
61 3300049591 Ga0501075_0148936 Ga0501075_0148936_732_1733 327
62 3300050490 nmdc:mga03n38_10058_c1 nmdc:mga03n38_10058_c1_638_1648 327
63 3300050493 nmdc:mga0k408_14943_c1 nmdc:mga0k408_14943_c1_2420_3427 327
64 3300050493 nmdc:mga0k408_18216_c1 nmdc:mga0k408_18216_c1_154_1164 327
65 3300050494 nmdc:mga06z11_50511_c1 nmdc:mga06z11_50511_c1_298_1308 327
66 3300050494 nmdc:mga06z11_94845_c1 nmdc:mga06z11_94845_c1_309_1316 327
67 3300050496 nmdc:mga07m45_28463_c1 nmdc:mga07m45_28463_c1_749_1759 327
68 3300053103 Ga0500555_000354 Ga0500555_000354_2734_3738 327
69 3300053730 Ga0500645_000232 Ga0500645_000232_24560_25564 327
70 3300059421 Ga0590071_000105 Ga0590071_000105_17663_18673 327
71 3300059423 Ga0590074_001380 Ga0590074_001380_593_1603 327
72 3300059424 Ga0590075_001105 Ga0590075_001105_2589_3599 327
73 3300005617 Ga0068859_100505080 Ga0068859_1005050801 328
74 3300006931 Ga0097620_100505016 Ga0097620_1005050161 328
75 3300053085 Ga0495619_0227812 Ga0495619_0227812_269_1276 328
76 3300003215 JGI25153J46596_10022590 JGI25153J46596_100225902 329
77 3300005467 Ga0070706_100001050 Ga0070706_10000105017 329
78 3300025910 Ga0207684_10001226 Ga0207684_1000122612 329
79 iso_pu_bacteria 2738541276 2738716964 331
80 3300031727 Ga0316576_10000938 Ga0316576_1000093811 332
81 3300031728 Ga0316578_10006890 Ga0316578_100068904 332
82 3300031733 Ga0316577_10011046 Ga0316577_100110464 332
83 3300003323 rootH1_10021139 rootH1_100211397 333
84 3300028800 Ga0265338_10126950 Ga0265338_101269502 333
85 3300031548 Ga0307408_100005094 Ga0307408_1000050942 333
86 3300039062 Ga0400483_206430 Ga0400483_206430_7654_8700 333
87 3300039437 Ga0436365_0584888 Ga0436365_0584888_261_1271 333
88 3300061734 Ga0530510_0300863 Ga0530510_0300863_136_1164 333
89 3300005536 Ga0070697_100031761 Ga0070697_1000317612 334
90 3300037068 Ga0373925_0103549 Ga0373925_0103549_634_1650 334
91 3300053730 Ga0500645_009547 Ga0500645_009547_939_1967 334
92 3300045051 Ga0451576_0016026 Ga0451576_0016026_4811_5839 335
93 3300005329 Ga0070683_100006772 Ga0070683_1000067721 336
94 3300005535 Ga0070684_100037335 Ga0070684_1000373353 336
95 3300025929 Ga0207664_10149144 Ga0207664_101491442 336
96 3300025944 Ga0207661_10079177 Ga0207661_100791771 336
97 3300035724 Ga0373933_0178204 Ga0373933_0178204_55_1095 336
98 3300048915 Ga0496112_0386985 Ga0496112_0386985_284_1324 336
99 3300053077 Ga0495601_0035091 Ga0495601_0035091_1930_2967 336
100 iso_pu_bacteria 2718217752 2718716300 336
101 3300006175 Ga0070712_100238027 Ga0070712_1002380271 337
102 3300005439 Ga0070711_100001071 Ga0070711_1000010719 338
103 3300005467 Ga0070706_100144196 Ga0070706_1001441961 338
104 3300005539 Ga0068853_100000053 Ga0068853_10000005319 338
105 3300006028 Ga0070717_10033478 Ga0070717_100334782 338
106 3300007076 Ga0075435_100070822 Ga0075435_1000708222 338
107 3300009148 Ga0105243_10001455 Ga0105243_100014553 338
108 3300014969 Ga0157376_10467884 Ga0157376_104678841 338
109 3300025935 Ga0207709_10001978 Ga0207709_100019783 338
110 3300026041 Ga0207639_10000001 Ga0207639_10000001297 338
111 3300031548 Ga0307408_100001553 Ga0307408_1000015537 338
112 3300031901 Ga0307406_10000620 Ga0307406_1000062018 338
113 3300042876 Ga0451577_0225061 Ga0451577_0225061_473_1510 338
114 3300045051 Ga0451576_0124221 Ga0451576_0124221_828_1862 338
115 3300050513 nmdc:mga0rr50_5199_c1 nmdc:mga0rr50_5199_c1_1466_2503 338
116 3300053118 Ga0500594_0042173 Ga0500594_0042173_39_1076 338
117 3300005468 Ga0070707_100000860 Ga0070707_10000086021 339
118 3300005518 Ga0070699_100022962 Ga0070699_1000229622 339
119 3300005518 Ga0070699_100041455 Ga0070699_1000414554 339
120 3300005536 Ga0070697_100081430 Ga0070697_1000814303 339
121 3300006028 Ga0070717_10366217 Ga0070717_103662172 339
122 3300006846 Ga0075430_100372347 Ga0075430_1003723471 339
123 3300006914 Ga0075436_100085016 Ga0075436_1000850162 339
124 3300013297 Ga0157378_10225964 Ga0157378_102259642 339
125 3300014969 Ga0157376_10047669 Ga0157376_100476694 339
126 3300025910 Ga0207684_10087388 Ga0207684_100873882 339
127 3300025922 Ga0207646_10001722 Ga0207646_100017228 339
128 3300028563 Ga0265319_1008064 Ga0265319_10080644 339
129 3300028800 Ga0265338_10079347 Ga0265338_100793472 339
130 3300028800 Ga0265338_10084077 Ga0265338_100840772 339
131 3300031241 Ga0265325_10070043 Ga0265325_100700433 339
132 3300031344 Ga0265316_10034216 Ga0265316_100342162 339
133 3300031995 Ga0307409_100030172 Ga0307409_1000301722 339
134 3300037068 Ga0373925_0336507 Ga0373925_0336507_71_1108 339
135 3300042876 Ga0451577_0000011 Ga0451577_0000011_575735_576775 339
136 3300042876 Ga0451577_0018580 Ga0451577_0018580_1200_2261 339
137 3300042876 Ga0451577_0075704 Ga0451577_0075704_113_1153 339
138 3300044673 Ga0453683_0000007 Ga0453683_0000007_80736_81776 339
139 3300044673 Ga0453683_0000043 Ga0453683_0000043_20291_21331 339
140 3300044712 Ga0453684_0000224 Ga0453684_0000224_227664_228704 339
141 3300044712 Ga0453684_0009668 Ga0453684_0009668_6552_7592 339
142 3300044712 Ga0453684_0300983 Ga0453684_0300983_213_1274 339
143 3300045051 Ga0451576_0226593 Ga0451576_0226593_288_1328 339
144 3300005327 Ga0070658_10188276 Ga0070658_101882762 340
145 3300005444 Ga0070694_100097086 Ga0070694_1000970862 340
146 3300005467 Ga0070706_100131320 Ga0070706_1001313201 340
147 3300006871 Ga0075434_100140232 Ga0075434_1001402323 340
148 3300009098 Ga0105245_10324473 Ga0105245_103244731 340
149 3300045049 Ga0466959_0247568 Ga0466959_0247568_28_1077 340
150 3300048088 Ga0495602_0290638 Ga0495602_0290638_105_1154 340
151 3300048924 Ga0496121_0072999 Ga0496121_0072999_316_1359 340
152 3300050512 nmdc:mga0n895_36005_c1 nmdc:mga0n895_36005_c1_2602_3654 340
153 3300053730 Ga0500645_021447 Ga0500645_021447_91_1140 340
154 3300005329 Ga0070683_100005606 Ga0070683_1000056067 341
155 3300005336 Ga0070680_100015488 Ga0070680_1000154882 341
156 3300005353 Ga0070669_100107058 Ga0070669_1001070582 341
157 3300005356 Ga0070674_100243525 Ga0070674_1002435251 341
158 3300005518 Ga0070699_100091212 Ga0070699_1000912121 341
159 3300005530 Ga0070679_100026603 Ga0070679_1000266034 341
160 3300005536 Ga0070697_100142484 Ga0070697_1001424842 341
161 3300013296 Ga0157374_10092239 Ga0157374_100922393 341
162 3300025944 Ga0207661_10100708 Ga0207661_101007083 341
163 iso_pu_bacteria 2824600985 2824603446 341
164 iso_pu_bacteria 2824609381 2824614725 341
165 iso_pu_bacteria 2824653114 2824654770 341
166 3300005445 Ga0070708_100072247 Ga0070708_1000722473 342
167 3300005467 Ga0070706_100011938 Ga0070706_1000119389 342
168 3300005468 Ga0070707_100048766 Ga0070707_1000487663 342
169 3300005468 Ga0070707_100117122 Ga0070707_1001171222 342
170 3300005471 Ga0070698_100008009 Ga0070698_1000080097 342
171 3300005471 Ga0070698_100009276 Ga0070698_10000927610 342
172 3300005471 Ga0070698_100245755 Ga0070698_1002457552 342
173 3300005536 Ga0070697_100002620 Ga0070697_10000262011 342
174 3300005536 Ga0070697_100098820 Ga0070697_1000988202 342
175 3300005536 Ga0070697_100233143 Ga0070697_1002331432 342
176 3300006028 Ga0070717_10068533 Ga0070717_100685332 342
177 3300006914 Ga0075436_100027892 Ga0075436_1000278925 342
178 3300013297 Ga0157378_10023465 Ga0157378_100234657 342
179 3300013307 Ga0157372_10136377 Ga0157372_101363772 342
180 3300025910 Ga0207684_10059683 Ga0207684_100596832 342
181 3300025922 Ga0207646_10000972 Ga0207646_1000097222 342
182 3300005435 Ga0070714_100166333 Ga0070714_1001663332 344
183 3300005467 Ga0070706_100075386 Ga0070706_1000753862 344
184 3300005471 Ga0070698_100137684 Ga0070698_1001376842 344
185 3300005548 Ga0070665_100028730 Ga0070665_1000287302 344
186 3300005983 Ga0081540_1000020 Ga0081540_100002063 344
187 3300006028 Ga0070717_10064845 Ga0070717_100648452 344
188 3300025910 Ga0207684_10138337 Ga0207684_101383372 344
189 3300025939 Ga0207665_10033693 Ga0207665_100336934 344
190 3300028379 Ga0268266_10200038 Ga0268266_102000381 344
191 3300042876 Ga0451577_0006289 Ga0451577_0006289_6320_7435 344
192 3300048910 Ga0496107_0050312 Ga0496107_0050312_161_1195 344
193 iso_pu_bacteria 2507262055 2507508716 344
194 iso_pu_bacteria 2508501009 2508542809 344
195 iso_pu_bacteria 2508501042 2508691430 344
196 iso_pu_bacteria 2513237092 2513623166 344
197 iso_pu_bacteria 2513237102 2513700536 344
198 iso_pu_bacteria 2513237137 2513860981 344
199 iso_pu_bacteria 2517572143 2517892504 344
200 iso_pu_bacteria 2528768022 2528856554 344
201 iso_pu_bacteria 2791355196 2793062533 344
202 iso_pu_bacteria 2791355197 2793068671 344
203 iso_pu_bacteria 2824617872 2824622433 344
204 iso_pu_bacteria 2824626560 2824631558 344
205 iso_pu_bacteria 2824635225 2824640124 344
206 iso_pu_bacteria 2824644064 2824647631 344
207 iso_pu_bacteria 2824661429 2824664620 344
208 iso_pu_bacteria 2824714736 2824717589 344
209 iso_pu_bacteria 2824723954 2824727804 344
210 iso_pu_bacteria 2842038055 2842039199 344
211 iso_pu_bacteria 2842045827 2842047854 344
212 iso_pu_bacteria 2847930680 2847936089 344
213 iso_pu_bacteria 2849076700 2849079440 344
214 iso_pu_bacteria 2879083081 2879090067 344
215 iso_pu_bacteria 2879099564 2879103413 344
216 iso_pu_bacteria 2881364244 2881367063 344
217 iso_pu_bacteria 2885374607 2885375312 344
218 iso_pu_bacteria 2888388044 2888393933 344
219 iso_pu_bacteria 2903748898 2903759306 344
220 iso_pu_bacteria 2906610324 2906618504 344
221 iso_pu_bacteria 2906635258 2906640923 344
222 iso_pu_bacteria 2906660503 2906664200 344
223 iso_pu_bacteria 2908739725 2908742825 344
224 iso_pu_bacteria 2922368715 2922374242 344
225 iso_pu_bacteria 2929615660 2929617922 344
226 iso_pu_bacteria 2929624759 2929627603 344
227 iso_pu_bacteria 2932784394 2932788301 344
228 iso_pu_bacteria 2932809354 2932810553 344
229 iso_pu_bacteria 2932818245 2932821304 344
230 iso_pu_bacteria 2932828146 2932831296 344
231 iso_pu_bacteria 2933577622 2933579851 344
232 iso_pu_bacteria 2935608549 2935608760 344
233 iso_pu_bacteria 2935616580 2935622911 344
234 iso_pu_bacteria 2935630451 2935631772 344
235 iso_pu_bacteria 2935638405 2935642269 344
236 iso_pu_bacteria 2935648319 2935649912 344
237 iso_pu_bacteria 2935656913 2935661936 344
238 iso_pu_bacteria 2935665750 2935668427 344
239 iso_pu_bacteria 2935675223 2935680643 344
240 iso_pu_bacteria 2935684952 2935692768 344
241 iso_pu_bacteria 2935703347 2935706286 344
242 iso_pu_bacteria 2935713505 2935721507 344
243 iso_pu_bacteria 2935722832 2935730425 344
244 iso_pu_bacteria 2935732158 2935740438 344
245 iso_pu_bacteria 2935741537 2935749702 344
246 iso_pu_bacteria 2935750917 2935758985 344
247 iso_pu_bacteria 2935760218 2935762683 344
248 iso_pu_bacteria 2935801545 2935803282 344
249 iso_pu_bacteria 2935810662 2935814602 344
250 iso_pu_bacteria 2935819856 2935821921 344
251 iso_pu_bacteria 2935827899 2935831740 344
252 iso_pu_bacteria 2935837841 2935838608 344
253 iso_pu_bacteria 2935847175 2935847503 344
254 iso_pu_bacteria 2935855204 2935861159 344
255 iso_pu_bacteria 2935864058 2935865697 344
256 iso_pu_bacteria 2935873716 2935878198 344
257 iso_pu_bacteria 2935908558 2935909229 344
258 iso_pu_bacteria 2935916978 2935919950 344
259 iso_pu_bacteria 2935926038 2935926197 344
260 iso_pu_bacteria 2935934488 2935934647 344
261 iso_pu_bacteria 2935942939 2935943097 344
262 iso_pu_bacteria 2935951376 2935951535 344
263 iso_pu_bacteria 2935967501 2935967660 344
264 iso_pu_bacteria 2935984226 2935988303 344
265 iso_pu_bacteria 2935992306 2935994509 344
266 iso_pu_bacteria 2936002035 2936007693 344
267 iso_pu_bacteria 2936011229 2936012605 344
268 iso_pu_bacteria 2936019824 2936021169 344
269 iso_pu_bacteria 2936028420 2936029898 344
270 iso_pu_bacteria 2936037263 2936040159 344
271 iso_pu_bacteria 2936046547 2936047363 344
272 iso_pu_bacteria 2936055302 2936057479 344
273 iso_pu_bacteria 2940556831 2940565010 344
274 iso_pu_bacteria 2941507105 2941513113 344
275 iso_pu_bacteria 2941515067 2941520983 344
276 iso_pu_bacteria 2941523033 2941526153 344
277 iso_pu_bacteria 2941538514 2941538724 344
278 iso_pu_bacteria 3005474847 3005480099 344
279 iso_pu_bacteria 8006984368 8006993444 344
280 iso_pu_bacteria 8016511872 8016513353 344
281 iso_pu_bacteria 8016630954 8016640492 344
282 iso_pu_bacteria 8017057580 8017063077 344
283 iso_pu_bacteria 8019576017 8019582512 344
284 iso_pu_bacteria 8019586578 8019590295 344
285 iso_pu_bacteria 8019597564 8019601051 344
286 iso_pu_bacteria 8019687851 8019689940 344
287 iso_pu_bacteria 8055742211 8055746488 344
288 iso_pu_bacteria 2508501128 2509150381 345
289 iso_pu_bacteria 2513237094 2513639106 345
290 iso_pu_bacteria 2643221651 2644288651 345
291 iso_pu_bacteria 2671180139 2671692744 345
292 iso_pu_bacteria 2721755755 2723845217 345
293 iso_pu_bacteria 2837678835 2837679953 345
294 iso_pu_bacteria 2876808645 2876809023 345
295 iso_pu_bacteria 2879110137 2879115400 345
296 iso_pu_bacteria 2922361189 2922365231 345
297 iso_pu_bacteria 2935694250 2935700938 345
298 iso_pu_bacteria 2935959822 2935966357 345
299 iso_pu_bacteria 8006994254 8006998861 345
300 iso_pu_bacteria 8019648815 8019658255 345
301 iso_pu_bacteria 8045864390 8045865815 345
302 3300049823 Ga0501044_0137022 Ga0501044_0137022_1234_2280 346
303 iso_pu_bacteria 2513237101 2513692392 346
304 iso_pu_bacteria 2791355199 2793083573 346
305 iso_pu_bacteria 2874604998 2874605069 346
306 iso_pu_bacteria 2889033259 2889039973 346
307 iso_pu_bacteria 8006964411 8006965608 346
308 iso_pu_bacteria 8056673599 8056673993 346
309 3300009545 Ga0105237_10080055 Ga0105237_100800553 347
310 3300013105 Ga0157369_10003699 Ga0157369_100036998 347
311 3300046462 Ga0495651_0073151 Ga0495651_0073151_1477_2523 347
312 3300046679 Ga0495623_0085754 Ga0495623_0085754_862_1908 347
313 3300046809 Ga0495600_0223757 Ga0495600_0223757_55_1101 347
314 3300049571 Ga0501034_0148900 Ga0501034_0148900_493_1539 347
315 3300049589 Ga0501073_0115904 Ga0501073_0115904_629_1675 347
316 3300003322 rootL2_10176537 rootL2_101765373 348
317 3300005262 Ga0065165_1011557 Ga0065165_10115573 348
318 3300005347 Ga0070668_100105438 Ga0070668_1001054381 348
319 3300005356 Ga0070674_100116470 Ga0070674_1001164702 348
320 3300005356 Ga0070674_100281720 Ga0070674_1002817201 348
321 3300005434 Ga0070709_10290993 Ga0070709_102909931 348
322 3300005455 Ga0070663_100087202 Ga0070663_1000872023 348
323 3300005457 Ga0070662_100047195 Ga0070662_1000471953 348
324 3300005458 Ga0070681_10031723 Ga0070681_100317235 348
325 3300005518 Ga0070699_100189133 Ga0070699_1001891332 348
326 3300005535 Ga0070684_100013256 Ga0070684_1000132565 348
327 3300005539 Ga0068853_100244337 Ga0068853_1002443372 348
328 3300005563 Ga0068855_100146738 Ga0068855_1001467383 348
329 3300005564 Ga0070664_100298735 Ga0070664_1002987352 348
330 3300005577 Ga0068857_100006858 Ga0068857_10000685811 348
331 3300006038 Ga0075365_10053206 Ga0075365_100532063 348
332 3300006177 Ga0075362_10106912 Ga0075362_101069121 348
333 3300006178 Ga0075367_10076377 Ga0075367_100763772 348
334 3300006186 Ga0075369_10084131 Ga0075369_100841312 348
335 3300006353 Ga0075370_10039630 Ga0075370_100396303 348
336 3300006353 Ga0075370_10143693 Ga0075370_101436931 348
337 3300009545 Ga0105237_10270496 Ga0105237_102704962 348
338 3300009551 Ga0105238_10014128 Ga0105238_100141289 348
339 3300010375 Ga0105239_10112781 Ga0105239_101127814 348
340 3300013105 Ga0157369_10016823 Ga0157369_100168237 348
341 3300013297 Ga0157378_10338349 Ga0157378_103383491 348
342 3300014325 Ga0163163_10109104 Ga0163163_101091043 348
343 3300014968 Ga0157379_10124007 Ga0157379_101240072 348
344 3300025230 Ga0209563_101672 Ga0209563_1016725 348
345 3300025253 Ga0209677_102352 Ga0209677_1023525 348
346 3300025297 Ga0209758_1002500 Ga0209758_100250014 348
347 3300025302 Ga0207426_1007061 Ga0207426_10070615 348
348 3300025901 Ga0207688_10032942 Ga0207688_100329423 348
349 3300025912 Ga0207707_10015990 Ga0207707_100159904 348
350 3300025912 Ga0207707_10092324 Ga0207707_100923242 348
351 3300025920 Ga0207649_10110600 Ga0207649_101106002 348
352 3300025923 Ga0207681_10200228 Ga0207681_102002282 348
353 3300025926 Ga0207659_10268644 Ga0207659_102686441 348
354 3300025933 Ga0207706_10221862 Ga0207706_102218622 348
355 3300025940 Ga0207691_10287467 Ga0207691_102874672 348
356 3300025945 Ga0207679_10282194 Ga0207679_102821942 348
357 3300025949 Ga0207667_10154237 Ga0207667_101542371 348
358 3300025949 Ga0207667_10394908 Ga0207667_103949082 348
359 3300025972 Ga0207668_10297558 Ga0207668_102975582 348
360 3300026023 Ga0207677_10270995 Ga0207677_102709951 348
361 3300026035 Ga0207703_10039350 Ga0207703_100393503 348
362 3300026041 Ga0207639_10053911 Ga0207639_100539113 348
363 3300026041 Ga0207639_10073292 Ga0207639_100732922 348
364 3300026041 Ga0207639_10108702 Ga0207639_101087023 348
365 3300026041 Ga0207639_10130893 Ga0207639_101308932 348
366 3300026067 Ga0207678_10062685 Ga0207678_100626854 348
367 3300027296 Ga0209389_1000969 Ga0209389_100096916 348
368 3300027361 Ga0209489_108549 Ga0209489_1085494 348
369 3300027363 Ga0209700_100036 Ga0209700_100036142 348
370 3300028379 Ga0268266_10054352 Ga0268266_100543521 348
371 3300031249 Ga0265339_10019806 Ga0265339_100198063 348
372 3300031250 Ga0265331_10070824 Ga0265331_100708242 348
373 3300031712 Ga0265342_10002731 Ga0265342_1000273111 348
374 3300031995 Ga0307409_100090269 Ga0307409_1000902692 348
375 3300032126 Ga0307415_100052195 Ga0307415_1000521952 348
376 3300033180 Ga0307510_10010241 Ga0307510_100102417 348
377 3300033442 Ga0315911_1000001 Ga0315911_1000001265 348
378 3300035089 Ga0373944_0005144 Ga0373944_0005144_289_1335 348
379 3300035116 Ga0373945_0008018 Ga0373945_0008018_710_1756 348
380 3300035170 Ga0373943_0049080 Ga0373943_0049080_343_1389 348
381 3300035410 Ga0373924_0006263 Ga0373924_0006263_1546_2592 348
382 3300035691 Ga0373931_0037237 Ga0373931_0037237_114_1172 348
383 3300035695 Ga0373927_0183294 Ga0373927_0183294_315_1361 348
384 3300035724 Ga0373933_0031946 Ga0373933_0031946_999_2045 348
385 3300035725 Ga0373947_0007586 Ga0373947_0007586_1977_3023 348
386 3300035725 Ga0373947_0160666 Ga0373947_0160666_321_1367 348
387 3300036401 Ga0373937_0026658 Ga0373937_0026658_3336_4382 348
388 3300037068 Ga0373925_0054102 Ga0373925_0054102_1457_2503 348
389 3300039437 Ga0436365_1401961 Ga0436365_1401961_569_1621 348
390 3300041452 Ga0451793_1479997 Ga0451793_1479997_98_1144 348
391 3300046454 Ga0495592_0047468 Ga0495592_0047468_1462_2508 348
392 3300046454 Ga0495592_0125968 Ga0495592_0125968_394_1440 348
393 3300046455 Ga0495603_0046198 Ga0495603_0046198_1229_2275 348
394 3300046455 Ga0495603_0110991 Ga0495603_0110991_500_1546 348
395 3300046459 Ga0495629_0046573 Ga0495629_0046573_1880_2926 348
396 3300046459 Ga0495629_0128970 Ga0495629_0128970_613_1659 348
397 3300046460 Ga0495638_0052409 Ga0495638_0052409_873_1919 348
398 3300046472 Ga0495580_0171641 Ga0495580_0171641_415_1461 348
399 3300046473 Ga0495582_0019184 Ga0495582_0019184_2642_3688 348
400 3300046477 Ga0495664_0097184 Ga0495664_0097184_255_1301 348
401 3300046491 Ga0495584_0025083 Ga0495584_0025083_1630_2676 348
402 3300046507 Ga0495606_0045016 Ga0495606_0045016_292_1338 348
403 3300046514 Ga0495618_0061407 Ga0495618_0061407_1173_2219 348
404 3300046517 Ga0495630_0044087 Ga0495630_0044087_1082_2128 348
405 3300046519 Ga0495632_0040857 Ga0495632_0040857_955_2001 348
406 3300046522 Ga0495643_0142019 Ga0495643_0142019_20_1066 348
407 3300046523 Ga0495644_0062393 Ga0495644_0062393_340_1386 348
408 3300046524 Ga0495648_0153077 Ga0495648_0153077_90_1136 348
409 3300046526 Ga0495666_0034184 Ga0495666_0034184_698_1744 348
410 3300046538 Ga0495609_0025737 Ga0495609_0025737_485_1531 348
411 3300046557 Ga0495622_0026866 Ga0495622_0026866_729_1775 348
412 3300046559 Ga0495667_0046148 Ga0495667_0046148_1572_2618 348
413 3300046674 Ga0495588_0010035 Ga0495588_0010035_584_1630 348
414 3300046674 Ga0495588_0046936 Ga0495588_0046936_650_1696 348
415 3300046683 Ga0495658_0117760 Ga0495658_0117760_435_1481 348
416 3300046694 Ga0495649_0106080 Ga0495649_0106080_383_1429 348
417 3300046694 Ga0495649_0110719 Ga0495649_0110719_99_1145 348
418 3300047315 Ga0495581_0023393 Ga0495581_0023393_888_1934 348
419 3300047319 Ga0495674_0077886 Ga0495674_0077886_1115_2161 348
420 3300047471 Ga0495684_0035362 Ga0495684_0035362_1230_2276 348
421 3300047472 Ga0495686_0140430 Ga0495686_0140430_129_1175 348
422 3300048904 Ga0496101_0045055 Ga0496101_0045055_1335_2381 348
423 3300048906 Ga0496103_0182648 Ga0496103_0182648_217_1263 348
424 3300048907 Ga0496104_0070744 Ga0496104_0070744_1633_2679 348
425 3300048908 Ga0496105_0065322 Ga0496105_0065322_755_1801 348
426 3300048909 Ga0496106_0085862 Ga0496106_0085862_1023_2069 348
427 3300048913 Ga0496110_0071103 Ga0496110_0071103_301_1347 348
428 3300048914 Ga0496111_0071461 Ga0496111_0071461_1121_2167 348
429 3300048915 Ga0496112_0034260 Ga0496112_0034260_813_1859 348
430 3300048917 Ga0496114_0105958 Ga0496114_0105958_970_2016 348
431 3300048918 Ga0496115_0196810 Ga0496115_0196810_242_1288 348
432 3300048919 Ga0496116_0049722 Ga0496116_0049722_1392_2438 348
433 3300048920 Ga0496117_0130733 Ga0496117_0130733_239_1285 348
434 3300048921 Ga0496118_0075771 Ga0496118_0075771_1094_2140 348
435 3300048922 Ga0496119_0074812 Ga0496119_0074812_78_1124 348
436 3300048924 Ga0496121_0118231 Ga0496121_0118231_183_1229 348
437 3300048924 Ga0496121_0157177 Ga0496121_0157177_489_1550 348
438 3300048929 Ga0496126_0004782 Ga0496126_0004782_6942_7988 348
439 3300048929 Ga0496126_0042307 Ga0496126_0042307_258_1304 348
440 3300049460 Ga0495682_0041561 Ga0495682_0041561_557_1603 348
441 3300050516 nmdc:mga0sz30_35016_c1 nmdc:mga0sz30_35016_c1_168_1214 348
442 3300053078 Ga0495612_0027346 Ga0495612_0027346_218_1264 348
443 3300053093 Ga0500651_0042489 Ga0500651_0042489_951_1997 348
444 3300053094 Ga0500566_0001358 Ga0500566_0001358_6679_7725 348
445 3300053096 Ga0500641_0017411 Ga0500641_0017411_81_1127 348
446 3300053109 Ga0500569_054745 Ga0500569_054745_84_1130 348
447 3300053119 Ga0500595_002414 Ga0500595_002414_6966_8012 348
448 3300053130 Ga0500642_0052489 Ga0500642_0052489_742_1788 348
449 3300053161 Ga0500634_0037633 Ga0500634_0037633_105_1151 348
450 3300005327 Ga0070658_10167908 Ga0070658_101679082 349
451 3300005336 Ga0070680_100149426 Ga0070680_1001494262 349
452 3300005353 Ga0070669_100078653 Ga0070669_1000786532 349
453 3300005434 Ga0070709_10058345 Ga0070709_100583452 349
454 3300005435 Ga0070714_100181389 Ga0070714_1001813892 349
455 3300005435 Ga0070714_100306355 Ga0070714_1003063552 349
456 3300005436 Ga0070713_100065531 Ga0070713_1000655312 349
457 3300005436 Ga0070713_100141477 Ga0070713_1001414773 349
458 3300005436 Ga0070713_100363358 Ga0070713_1003633581 349
459 3300005437 Ga0070710_10011469 Ga0070710_100114693 349
460 3300005439 Ga0070711_100091166 Ga0070711_1000911661 349
461 3300005518 Ga0070699_100014792 Ga0070699_1000147926 349
462 3300005518 Ga0070699_100228284 Ga0070699_1002282842 349
463 3300005543 Ga0070672_100339646 Ga0070672_1003396462 349
464 3300005548 Ga0070665_100090499 Ga0070665_1000904992 349
465 3300005563 Ga0068855_100353362 Ga0068855_1003533622 349
466 3300005614 Ga0068856_100390875 Ga0068856_1003908751 349
467 3300005616 Ga0068852_100077937 Ga0068852_1000779373 349
468 3300005616 Ga0068852_100123090 Ga0068852_1001230903 349
469 3300005617 Ga0068859_100468478 Ga0068859_1004684782 349
470 3300005718 Ga0068866_10106922 Ga0068866_101069222 349
471 3300005841 Ga0068863_100205416 Ga0068863_1002054161 349
472 3300005843 Ga0068860_100008418 Ga0068860_1000084189 349
473 3300005844 Ga0068862_100078173 Ga0068862_1000781732 349
474 3300005983 Ga0081540_1003158 Ga0081540_100315811 349
475 3300006028 Ga0070717_10065514 Ga0070717_100655142 349
476 3300006038 Ga0075365_10230250 Ga0075365_102302501 349
477 3300006048 Ga0075363_100147580 Ga0075363_1001475801 349
478 3300006163 Ga0070715_10016848 Ga0070715_100168483 349
479 3300006173 Ga0070716_100132079 Ga0070716_1001320792 349
480 3300006177 Ga0075362_10073845 Ga0075362_100738452 349
481 3300006178 Ga0075367_10111756 Ga0075367_101117562 349
482 3300006353 Ga0075370_10069162 Ga0075370_100691622 349
483 3300006844 Ga0075428_100041368 Ga0075428_1000413683 349
484 3300006844 Ga0075428_100055937 Ga0075428_1000559373 349
485 3300006846 Ga0075430_100040236 Ga0075430_1000402363 349
486 3300006847 Ga0075431_100036260 Ga0075431_1000362603 349
487 3300006880 Ga0075429_100015588 Ga0075429_1000155883 349
488 3300006931 Ga0097620_100468487 Ga0097620_1004684872 349
489 3300007265 Ga0099794_10029452 Ga0099794_100294522 349
490 3300009094 Ga0111539_10014710 Ga0111539_100147109 349
491 3300009094 Ga0111539_10042364 Ga0111539_100423643 349
492 3300009147 Ga0114129_10060268 Ga0114129_100602683 349
493 3300009553 Ga0105249_10173207 Ga0105249_101732072 349
494 3300025297 Ga0209758_1002215 Ga0209758_10022154 349
495 3300025297 Ga0209758_1003196 Ga0209758_10031966 349
496 3300025302 Ga0207426_1007558 Ga0207426_10075585 349
497 3300025304 Ga0209257_1034669 Ga0209257_10346692 349
498 3300025898 Ga0207692_10129454 Ga0207692_101294542 349
499 3300025899 Ga0207642_10208440 Ga0207642_102084401 349
500 3300025905 Ga0207685_10055546 Ga0207685_100555462 349
501 3300025906 Ga0207699_10089032 Ga0207699_100890321 349
502 3300025906 Ga0207699_10255215 Ga0207699_102552151 349
503 3300025908 Ga0207643_10116528 Ga0207643_101165282 349
504 3300025913 Ga0207695_10280825 Ga0207695_102808251 349
505 3300025914 Ga0207671_10013859 Ga0207671_100138593 349
506 3300025917 Ga0207660_10272761 Ga0207660_102727612 349
507 3300025922 Ga0207646_10097940 Ga0207646_100979403 349
508 3300025923 Ga0207681_10355008 Ga0207681_103550081 349
509 3300025923 Ga0207681_10385995 Ga0207681_103859951 349
510 3300025928 Ga0207700_10021835 Ga0207700_100218355 349
511 3300025928 Ga0207700_10120517 Ga0207700_101205172 349
512 3300025929 Ga0207664_10241103 Ga0207664_102411032 349
513 3300025942 Ga0207689_10023076 Ga0207689_100230763 349
514 3300025944 Ga0207661_10003495 Ga0207661_100034958 349
515 3300025960 Ga0207651_10247015 Ga0207651_102470152 349
516 3300026035 Ga0207703_10200593 Ga0207703_102005933 349
517 3300026088 Ga0207641_10222569 Ga0207641_102225691 349
518 3300026121 Ga0207683_10195592 Ga0207683_101955922 349
519 3300026121 Ga0207683_10234524 Ga0207683_102345242 349
520 3300027671 Ga0209588_1020310 Ga0209588_10203102 349
521 3300027907 Ga0207428_10033516 Ga0207428_100335162 349
522 3300028381 Ga0268264_10000043 Ga0268264_10000043122 349
523 3300028794 Ga0307515_10272445 Ga0307515_102724452 349
524 3300031616 Ga0307508_10001059 Ga0307508_1000105920 349
525 3300031616 Ga0307508_10060565 Ga0307508_100605654 349
526 3300031616 Ga0307508_10110406 Ga0307508_101104062 349
527 3300031730 Ga0307516_10015493 Ga0307516_100154936 349
528 3300035116 Ga0373945_0021013 Ga0373945_0021013_220_1269 349
529 3300035171 Ga0373946_0003228 Ga0373946_0003228_2608_3657 349
530 3300035172 Ga0373955_0035662 Ga0373955_0035662_1499_2548 349
531 3300035410 Ga0373924_0017596 Ga0373924_0017596_1044_2093 349
532 3300035691 Ga0373931_0190368 Ga0373931_0190368_34_1083 349
533 3300035692 Ga0373935_0000435 Ga0373935_0000435_3332_4381 349
534 3300035695 Ga0373927_0002587 Ga0373927_0002587_9028_10077 349
535 3300035695 Ga0373927_0008673 Ga0373927_0008673_2244_3293 349
536 3300035725 Ga0373947_0012060 Ga0373947_0012060_1410_2459 349
537 3300035725 Ga0373947_0036798 Ga0373947_0036798_725_1774 349
538 3300036401 Ga0373937_0357645 Ga0373937_0357645_205_1254 349
539 3300037068 Ga0373925_0001774 Ga0373925_0001774_4445_5494 349
540 3300037068 Ga0373925_0113488 Ga0373925_0113488_776_1825 349
541 3300039437 Ga0436365_0417128 Ga0436365_0417128_559_1629 349
542 3300039450 Ga0436363_1347498 Ga0436363_1347498_407_1456 349
543 3300044842 Ga0466957_0028272 Ga0466957_0028272_732_1781 349
544 3300045049 Ga0466959_0011001 Ga0466959_0011001_3771_4820 349
545 3300045049 Ga0466959_0043000 Ga0466959_0043000_1281_2366 349
546 3300045836 Ga0466958_0017952 Ga0466958_0017952_677_1726 349
547 3300046455 Ga0495603_0001446 Ga0495603_0001446_10506_11555 349
548 3300046459 Ga0495629_0008069 Ga0495629_0008069_2756_3805 349
549 3300046460 Ga0495638_0086536 Ga0495638_0086536_86_1135 349
550 3300046461 Ga0495641_0007242 Ga0495641_0007242_3176_4225 349
551 3300046462 Ga0495651_0018417 Ga0495651_0018417_87_1136 349
552 3300046462 Ga0495651_0034663 Ga0495651_0034663_1205_2329 349
553 3300046472 Ga0495580_0001310 Ga0495580_0001310_3552_4601 349
554 3300046473 Ga0495582_0000545 Ga0495582_0000545_4643_5692 349
555 3300046475 Ga0495639_0010592 Ga0495639_0010592_526_1575 349
556 3300046476 Ga0495662_0000429 Ga0495662_0000429_353_1402 349
557 3300046477 Ga0495664_0022116 Ga0495664_0022116_468_1517 349
558 3300046477 Ga0495664_0173577 Ga0495664_0173577_169_1218 349
559 3300046499 Ga0495594_0000020 Ga0495594_0000020_76274_77323 349
560 3300046516 Ga0495628_0159369 Ga0495628_0159369_71_1120 349
561 3300046517 Ga0495630_0010792 Ga0495630_0010792_4698_5747 349
562 3300046529 Ga0495652_0111764 Ga0495652_0111764_653_1702 349
563 3300046531 Ga0495665_0000170 Ga0495665_0000170_526_1575 349
564 3300046531 Ga0495665_0107724 Ga0495665_0107724_208_1257 349
565 3300046533 Ga0495640_0002547 Ga0495640_0002547_12854_13903 349
566 3300046536 Ga0495587_0060059 Ga0495587_0060059_312_1361 349
567 3300046557 Ga0495622_0002079 Ga0495622_0002079_912_1961 349
568 3300046615 Ga0495656_0012948 Ga0495656_0012948_1864_2913 349
569 3300046642 Ga0495634_0000998 Ga0495634_0000998_4929_5978 349
570 3300046663 Ga0495635_0030879 Ga0495635_0030879_1622_2671 349
571 3300046663 Ga0495635_0240549 Ga0495635_0240549_92_1141 349
572 3300046674 Ga0495588_0015435 Ga0495588_0015435_2140_3189 349
573 3300046678 Ga0495599_0006305 Ga0495599_0006305_1408_2457 349
574 3300046678 Ga0495599_0049469 Ga0495599_0049469_1235_2284 349
575 3300046678 Ga0495599_0049581 Ga0495599_0049581_661_1710 349
576 3300046678 Ga0495599_0107295 Ga0495599_0107295_553_1602 349
577 3300046680 Ga0495646_0040056 Ga0495646_0040056_941_1990 349
578 3300046680 Ga0495646_0095903 Ga0495646_0095903_392_1441 349
579 3300046681 Ga0495647_0001303 Ga0495647_0001303_3153_4202 349
580 3300046683 Ga0495658_0002344 Ga0495658_0002344_1284_2333 349
581 3300046689 Ga0495613_0017244 Ga0495613_0017244_1693_2742 349
582 3300046690 Ga0495624_0009089 Ga0495624_0009089_2197_3246 349
583 3300046809 Ga0495600_0179951 Ga0495600_0179951_254_1303 349
584 3300047315 Ga0495581_0003140 Ga0495581_0003140_526_1575 349
585 3300047319 Ga0495674_0000600 Ga0495674_0000600_5731_6780 349
586 3300047321 Ga0495676_0037688 Ga0495676_0037688_1476_2525 349
587 3300047321 Ga0495676_0049266 Ga0495676_0049266_1962_3011 349
588 3300047447 Ga0495685_029342 Ga0495685_029342_256_1305 349
589 3300047471 Ga0495684_0041506 Ga0495684_0041506_1607_2656 349
590 3300047471 Ga0495684_0067514 Ga0495684_0067514_426_1475 349
591 3300047673 Ga0495593_0005773 Ga0495593_0005773_1530_2579 349
592 3300048089 Ga0495614_0028553 Ga0495614_0028553_628_1677 349
593 3300048908 Ga0496105_0124932 Ga0496105_0124932_1042_2091 349
594 3300048909 Ga0496106_0008202 Ga0496106_0008202_1726_2847 349
595 3300048911 Ga0496108_0096675 Ga0496108_0096675_1282_2331 349
596 3300048914 Ga0496111_0085614 Ga0496111_0085614_333_1382 349
597 3300048914 Ga0496111_0160899 Ga0496111_0160899_255_1304 349
598 3300048918 Ga0496115_0038527 Ga0496115_0038527_441_1490 349
599 3300048919 Ga0496116_0080543 Ga0496116_0080543_27_1148 349
600 3300048920 Ga0496117_0012161 Ga0496117_0012161_6486_7607 349
601 3300048921 Ga0496118_0001670 Ga0496118_0001670_17096_18217 349
602 3300048924 Ga0496121_0000183 Ga0496121_0000183_37575_38696 349
603 3300048927 Ga0496124_0001382 Ga0496124_0001382_19163_20284 349
604 3300048927 Ga0496124_0033784 Ga0496124_0033784_2071_3120 349
605 3300048928 Ga0496125_0048308 Ga0496125_0048308_1017_2138 349
606 3300048929 Ga0496126_0008321 Ga0496126_0008321_9279_10400 349
607 3300048929 Ga0496126_0013413 Ga0496126_0013413_7048_8097 349
608 3300048929 Ga0496126_0061727 Ga0496126_0061727_684_1754 349
609 3300048929 Ga0496126_0093975 Ga0496126_0093975_1006_2055 349
610 3300049581 Ga0501047_0014124 Ga0501047_0014124_327_1376 349
611 3300049586 Ga0501070_0148579 Ga0501070_0148579_642_1691 349
612 3300049586 Ga0501070_0204740 Ga0501070_0204740_313_1362 349
613 3300049589 Ga0501073_0062010 Ga0501073_0062010_990_2039 349
614 3300049742 Ga0501080_0142049 Ga0501080_0142049_499_1548 349
615 3300049822 Ga0501035_0210772 Ga0501035_0210772_283_1332 349
616 3300049823 Ga0501044_0070718 Ga0501044_0070718_162_1211 349
617 3300050489 nmdc:mga03683_118025_c1 nmdc:mga03683_118025_c1_51_1115 349
618 3300050493 nmdc:mga0k408_16841_c1 nmdc:mga0k408_16841_c1_231_1295 349
619 3300050507 nmdc:mga05p37_49134_c1 nmdc:mga05p37_49134_c1_2552_3601 349
620 3300050508 nmdc:mga09592_21012_c1 nmdc:mga09592_21012_c1_2546_3595 349
621 3300050509 nmdc:mga0qj67_23455_c1 nmdc:mga0qj67_23455_c1_2871_3920 349
622 3300050510 nmdc:mga06r32_3877_c1 nmdc:mga06r32_3877_c1_9794_10843 349
623 3300050511 nmdc:mga08y16_114740_c1 nmdc:mga08y16_114740_c1_1306_2355 349
624 3300050511 nmdc:mga08y16_4487_c1 nmdc:mga08y16_4487_c1_1707_2756 349
625 3300053077 Ga0495601_0135335 Ga0495601_0135335_26_1075 349
626 3300053078 Ga0495612_0060219 Ga0495612_0060219_122_1171 349
627 3300053085 Ga0495619_0137558 Ga0495619_0137558_320_1369 349
628 3300053092 Ga0500583_0099368 Ga0500583_0099368_311_1360 349
629 3300053095 Ga0500640_046339 Ga0500640_046339_234_1283 349
630 3300053096 Ga0500641_0034704 Ga0500641_0034704_234_1283 349
631 3300053105 Ga0500557_000071 Ga0500557_000071_16309_17358 349
632 3300053119 Ga0500595_017347 Ga0500595_017347_1050_2099 349
633 3300053130 Ga0500642_0000132 Ga0500642_0000132_21929_22978 349
634 3300053130 Ga0500642_0080193 Ga0500642_0080193_324_1373 349
635 3300053140 Ga0500573_0034401 Ga0500573_0034401_1765_2814 349
636 3300053155 Ga0500620_002592 Ga0500620_002592_818_1867 349
637 3300053155 Ga0500620_053111 Ga0500620_053111_64_1140 349
638 3300053177 Ga0500636_0000206 Ga0500636_0000206_26218_27267 349
639 3300053177 Ga0500636_0044375 Ga0500636_0044375_473_1522 349
640 3300053729 Ga0500625_002939 Ga0500625_002939_3413_4462 349
641 3300053735 Ga0500596_003022 Ga0500596_003022_1698_2747 349
642 3300061719 Ga0466962_0035597 Ga0466962_0035597_1152_2201 349
643 iso_pu_bacteria 8019608314 8019617492 349
644 3300003215 JGI25153J46596_10002928 JGI25153J46596_100029287 350
645 3300005981 Ga0081538_10016160 Ga0081538_100161604 350
646 3300005983 Ga0081540_1021269 Ga0081540_10212694 350
647 3300007788 Ga0099795_10007449 Ga0099795_100074491 350
648 3300025297 Ga0209758_1024907 Ga0209758_10249073 350
649 3300037068 Ga0373925_0039911 Ga0373925_0039911_1306_2364 350
650 3300037853 Ga0436364_0699776 Ga0436364_0699776_540_1616 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

211

375

1

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

61

203

0.97

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

220

378

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9772 1 346
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.977 3 346
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9744 1 346
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9714 3 346
1vkn-assembly1.cif.gz_C crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9517 4 346
ID Description Score Start End Superfamily
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9922 149 315 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9864 149 315 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9669 150 315 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9612 150 315 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9606 150 316 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2P2MPN0-F1-model_v4 Uncharacterized protein MANES_15G144000 0.9962 204 346
AF-R7UBN4-F1-model_v4 Uncharacterized protein 0.996 232 346
AF-A0A850IUM2-F1-model_v4 deleted 0.9956 3 346
AF-A0A484LE06-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 0.9954 244 346
AF-A0A699IMB6-F1-model_v4 Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic 0.9942 200 346

Feature Viewer

pLDDT pTM Quality
96.22 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map