F472500

General Info

Members Datasets Scaffolds Average Seq Length
650 264 1300 128

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100421580|Ga0070698_1004215802
Length 146
Sequence MLKYRVCFGSRFFVRVTVKQIIATDHAPRAIGPYSQAVRAGNLVFASGQIPIDPATGEFVVGGVAEQTEQVLRNLTSVFAAAGVELNQIVKTTVFLADMEDFTAMNEVYGRFFGAQPPARATVQAARLPRDAKVEIEAIAVTEPER

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
256 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
264 2849139964 Bacillus sp. R-71875 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 2.62
Rhizosphere 95.08
Stem 0
Stem Tuber 0
Unclassified 25.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100421580 3300005471 Unclassified 1269
2 MBSR1b_contig_14112676 2162886012 Bacteria 2176
3 Ga0065712_10126815 3300005290 Bacteria 1597
4 Ga0065715_10001530 3300005293 Bacteria 6501
5 Ga0065715_10193867 3300005293 Bacteria 1399
6 Ga0065715_10457555 3300005293 Bacteria 819
7 Ga0065707_10001055 3300005295 Bacteria 16264
8 Ga0065707_10091990 3300005295 Bacteria 3831
9 Ga0065707_10266409 3300005295 Bacteria 1083
10 Ga0065707_10473844 3300005295 Bacteria 779
11 Ga0070676_11352733 3300005328 Unclassified 545
12 Ga0070683_100231192 3300005329 Bacteria 1758
13 Ga0070690_100115614 3300005330 Unclassified 1795
14 Ga0070690_100448845 3300005330 Bacteria 956
15 Ga0070670_100041932 3300005331 Bacteria 3933
16 Ga0070670_100729469 3300005331 Unclassified 892
17 Ga0070677_10069934 3300005333 Bacteria 1474
18 Ga0070677_10307985 3300005333 Bacteria 807
19 Ga0068869_101384518 3300005334 Unclassified 622
20 Ga0070666_11177001 3300005335 Bacteria 571
21 Ga0070680_100219135 3300005336 Bacteria 1606
22 Ga0070680_100292289 3300005336 Bacteria 1381
23 Ga0070680_100381017 3300005336 Bacteria 1201
24 Ga0070682_100021719 3300005337 Bacteria 3792
25 Ga0068868_100077291 3300005338 Unclassified 2663
26 Ga0068868_101785640 3300005338 Bacteria 581
27 Ga0070660_101244816 3300005339 Bacteria 631
28 Ga0070660_101905020 3300005339 Unclassified 507
29 Ga0070689_100047516 3300005340 Bacteria 3310
30 Ga0070689_100122556 3300005340 Unclassified 2077
31 Ga0070689_101063223 3300005340 Bacteria 722
32 Ga0070691_10137651 3300005341 Bacteria 1242
33 Ga0070687_100039007 3300005343 Bacteria 2384
34 Ga0070687_100279723 3300005343 Bacteria 1050
35 Ga0070687_100846806 3300005343 Bacteria 652
36 Ga0070687_100934465 3300005343 Unclassified 624
37 Ga0070692_10023766 3300005345 Unclassified 3006
38 Ga0070669_101501803 3300005353 Bacteria 586
39 Ga0070669_101583674 3300005353 Bacteria 570
40 Ga0070675_100101002 3300005354 Bacteria 2430
41 Ga0070675_100211900 3300005354 Unclassified 1684
42 Ga0070671_100125497 3300005355 Unclassified 2161
43 Ga0070674_100038828 3300005356 Unclassified 3211
44 Ga0070674_101097138 3300005356 Unclassified 703
45 Ga0070674_102090977 3300005356 Bacteria 516
46 Ga0070673_100346465 3300005364 Bacteria 1317
47 Ga0070673_100374084 3300005364 Bacteria 1269
48 Ga0070673_101759404 3300005364 Bacteria 587
49 Ga0070667_100620798 3300005367 Unclassified 997
50 Ga0070703_10000149 3300005406 Bacteria 35837
51 Ga0070703_10013309 3300005406 Unclassified 2336
52 Ga0070703_10034325 3300005406 Bacteria 1548
53 Ga0070701_11021409 3300005438 Bacteria 578
54 Ga0070705_100160883 3300005440 Bacteria 1501
55 Ga0070705_100245359 3300005440 Bacteria 1254
56 Ga0070705_100366583 3300005440 Unclassified 1056
57 Ga0070705_101380123 3300005440 Bacteria 587
58 Ga0070700_100011253 3300005441 Bacteria 4954
59 Ga0070700_100018655 3300005441 Bacteria 3992
60 Ga0070700_100028767 3300005441 Bacteria 3309
61 Ga0070700_100333033 3300005441 Unclassified 1119
62 Ga0070700_101270949 3300005441 Unclassified 617
63 Ga0070694_100005693 3300005444 Bacteria 7555
64 Ga0070694_100007317 3300005444 Bacteria 6728
65 Ga0070694_100053948 3300005444 Unclassified 2722
66 Ga0070694_100120617 3300005444 Bacteria 1881
67 Ga0070694_100272576 3300005444 Bacteria 1287
68 Ga0070694_100679963 3300005444 Unclassified 835
69 Ga0070694_101833450 3300005444 Bacteria 517
70 Ga0070708_100030979 3300005445 Bacteria 4627
71 Ga0070708_100107285 3300005445 Bacteria 2564
72 Ga0070708_100146168 3300005445 Bacteria 2196
73 Ga0070708_100192721 3300005445 Bacteria 1906
74 Ga0070708_100448580 3300005445 Bacteria 1217
75 Ga0070662_101354295 3300005457 Unclassified 613
76 Ga0070681_10000210 3300005458 Bacteria 45431
77 Ga0070681_11056375 3300005458 Bacteria 733
78 Ga0068867_100229724 3300005459 Bacteria 1499
79 Ga0068867_100335049 3300005459 Bacteria 1258
80 Ga0068867_100439425 3300005459 Bacteria 1109
81 Ga0068867_100592533 3300005459 Unclassified 966
82 Ga0068867_101571568 3300005459 Bacteria 614
83 Ga0068867_101849853 3300005459 Bacteria 568
84 Ga0070685_10192379 3300005466 Unclassified 1321
85 Ga0070706_100026396 3300005467 Bacteria 5344
86 Ga0070706_100031000 3300005467 Bacteria 4930
87 Ga0070706_100093488 3300005467 Bacteria 2790
88 Ga0070706_100509871 3300005467 Bacteria 1119
89 Ga0070706_100531580 3300005467 Bacteria 1094
90 Ga0070706_100586155 3300005467 Bacteria 1036
91 Ga0070706_101827285 3300005467 Unclassified 552
92 Ga0070707_100075809 3300005468 Bacteria 3244
93 Ga0070707_100089018 3300005468 Unclassified 2986
94 Ga0070707_100147515 3300005468 Bacteria 2289
95 Ga0070707_100258141 3300005468 Bacteria 1695
96 Ga0070707_100383760 3300005468 Unclassified 1365
97 Ga0070707_100405672 3300005468 Unclassified 1323
98 Ga0070707_100601568 3300005468 Bacteria 1062
99 Ga0070707_100951445 3300005468 Bacteria 824
100 Ga0070707_101947369 3300005468 Bacteria 555
101 Ga0070698_100007556 3300005471 Bacteria 11756
102 Ga0070698_100540823 3300005471 Bacteria 1104
103 Ga0070698_100772945 3300005471 Bacteria 904
104 Ga0070698_101638041 3300005471 Bacteria 596
105 Ga0070698_101838871 3300005471 Unclassified 558
106 Ga0070699_100013903 3300005518 Bacteria 6923
107 Ga0070699_100245859 3300005518 Bacteria 1598
108 Ga0070699_100302880 3300005518 Unclassified 1434
109 Ga0070699_100415641 3300005518 Bacteria 1217
110 Ga0070699_101114872 3300005518 Bacteria 724
111 Ga0070679_100000055 3300005530 Bacteria 84504
112 Ga0070679_100061751 3300005530 Bacteria 3735
113 Ga0070684_100266708 3300005535 Bacteria 1567
114 Ga0070697_100003858 3300005536 Bacteria 11513
115 Ga0070697_100122868 3300005536 Unclassified 2173
116 Ga0070697_101508953 3300005536 Unclassified 601
117 Ga0068853_100064257 3300005539 Bacteria 3181
118 Ga0070672_100049262 3300005543 Unclassified 3277
119 Ga0070686_100035997 3300005544 Bacteria 3061
120 Ga0070686_100101264 3300005544 Bacteria 1947
121 Ga0070686_100580089 3300005544 Bacteria 881
122 Ga0070695_100014861 3300005545 Bacteria 4697
123 Ga0070695_100024073 3300005545 Bacteria 3749
124 Ga0070695_100029228 3300005545 Bacteria 3423
125 Ga0070695_100032230 3300005545 Bacteria 3275
126 Ga0070695_100130921 3300005545 Bacteria 1729
127 Ga0070695_100152328 3300005545 Bacteria 1615
128 Ga0070695_100209627 3300005545 Bacteria 1398
129 Ga0070695_100379480 3300005545 Bacteria 1066
130 Ga0070696_100158047 3300005546 Bacteria 1668
131 Ga0070696_100202122 3300005546 Bacteria 1484
132 Ga0070696_100279157 3300005546 Bacteria 1273
133 Ga0070696_101430389 3300005546 Unclassified 590
134 Ga0070696_101815051 3300005546 Unclassified 527
135 Ga0070693_100019979 3300005547 Unclassified 3524
136 Ga0070693_100088768 3300005547 Bacteria 1859
137 Ga0070693_100522185 3300005547 Unclassified 845
138 Ga0070693_100777855 3300005547 Bacteria 708
139 Ga0070704_100021208 3300005549 Bacteria 4207
140 Ga0070704_101309756 3300005549 Bacteria 663
141 Ga0070704_101941154 3300005549 Bacteria 546
142 Ga0068855_100670527 3300005563 Bacteria 1112
143 Ga0070664_100066895 3300005564 Bacteria 3070
144 Ga0068857_100483746 3300005577 Unclassified 1160
145 Ga0068857_100976381 3300005577 Unclassified 815
146 Ga0068857_101005943 3300005577 Bacteria 802
147 Ga0068857_101640463 3300005577 Unclassified 628
148 Ga0068857_101917958 3300005577 Bacteria 580
149 Ga0068854_100062673 3300005578 Bacteria 2697
150 Ga0068854_100064566 3300005578 Bacteria 2660
151 Ga0068854_100388175 3300005578 Bacteria 1152
152 Ga0068856_100026884 3300005614 Bacteria 5612
153 Ga0070702_100007395 3300005615 Bacteria 5257
154 Ga0070702_100007476 3300005615 Bacteria 5235
155 Ga0070702_100009930 3300005615 Bacteria 4673
156 Ga0070702_100228840 3300005615 Bacteria 1248
157 Ga0070702_100778779 3300005615 Unclassified 737
158 Ga0070702_101893476 3300005615 Bacteria 500
159 Ga0068852_100229342 3300005616 Unclassified 1770
160 Ga0068859_100002807 3300005617 Bacteria 17650
161 Ga0068859_100017183 3300005617 Bacteria 7264
162 Ga0068859_100043444 3300005617 Bacteria 4516
163 Ga0068859_100680941 3300005617 Bacteria 1120
164 Ga0068859_101162397 3300005617 Bacteria 849
165 Ga0068859_101258398 3300005617 Unclassified 815
166 Ga0068859_101364976 3300005617 Unclassified 781
167 Ga0068859_101586928 3300005617 Bacteria 723
168 Ga0068864_100048330 3300005618 Bacteria 3657
169 Ga0068864_100051467 3300005618 Unclassified 3548
170 Ga0068864_100305508 3300005618 Bacteria 1490
171 Ga0068864_100723914 3300005618 Bacteria 973
172 Ga0068864_101405440 3300005618 Bacteria 700
173 Ga0068864_101838048 3300005618 Unclassified 611
174 Ga0068861_100017929 3300005719 Bacteria 5033
175 Ga0068861_100022508 3300005719 Bacteria 4542
176 Ga0068861_100231711 3300005719 Bacteria 1567
177 Ga0068861_101345323 3300005719 Bacteria 696
178 Ga0068851_10006917 3300005834 Bacteria 5200
179 Ga0068870_10009850 3300005840 Bacteria 4363
180 Ga0068863_100115628 3300005841 Bacteria 2556
181 Ga0068863_100413437 3300005841 Bacteria 1321
182 Ga0068863_100561631 3300005841 Unclassified 1127
183 Ga0068863_102363719 3300005841 Bacteria 541
184 Ga0068858_100038960 3300005842 Bacteria 4408
185 Ga0068858_100124125 3300005842 Bacteria 2417
186 Ga0068858_100978215 3300005842 Bacteria 829
187 Ga0068858_101231529 3300005842 Unclassified 736
188 Ga0068858_101297038 3300005842 Unclassified 717
189 Ga0068860_100019676 3300005843 Bacteria 6545
190 Ga0068860_100153762 3300005843 Unclassified 2217
191 Ga0068860_101297659 3300005843 Bacteria 749
192 Ga0068860_101471845 3300005843 Bacteria 702
193 Ga0068860_101903475 3300005843 Unclassified 616
194 Ga0068862_100005852 3300005844 Bacteria 10243
195 Ga0068862_100067036 3300005844 Bacteria 3093
196 Ga0068862_100113107 3300005844 Bacteria 2385
197 Ga0068862_100180204 3300005844 Unclassified 1896
198 Ga0068862_101252015 3300005844 Unclassified 742
199 Ga0075432_10110371 3300006058 Bacteria 1024
200 Ga0070715_10000032 3300006163 Bacteria 83594
201 Ga0070716_100000014 3300006173 Bacteria 92762
202 Ga0070716_100292785 3300006173 Bacteria 1129
203 Ga0070712_101460538 3300006175 Bacteria 597
204 Ga0097621_100000830 3300006237 Bacteria 21817
205 Ga0097621_100048386 3300006237 Bacteria 3449
206 Ga0097621_101934066 3300006237 Unclassified 563
207 Ga0068871_100008257 3300006358 Bacteria 7485
208 Ga0068871_100207649 3300006358 Bacteria 1693
209 Ga0075428_100000708 3300006844 Bacteria 34485
210 Ga0075428_100043460 3300006844 Bacteria 4939
211 Ga0075428_100789867 3300006844 Bacteria 1009
212 Ga0075428_102063391 3300006844 Bacteria 590
213 Ga0075430_100054112 3300006846 Bacteria 3377
214 Ga0075430_100218259 3300006846 Unclassified 1582
215 Ga0075430_100250211 3300006846 Unclassified 1469
216 Ga0075431_100055081 3300006847 Bacteria 4102
217 Ga0075431_100181375 3300006847 Unclassified 2161
218 Ga0075431_100244277 3300006847 Unclassified 1825
219 Ga0075431_100541447 3300006847 Bacteria 1152
220 Ga0075431_101391757 3300006847 Unclassified 661
221 Ga0075433_10002827 3300006852 Bacteria 13280
222 Ga0075433_10029899 3300006852 Bacteria 4644
223 Ga0075433_10064102 3300006852 Bacteria 3221
224 Ga0075433_10142596 3300006852 Bacteria 2129
225 Ga0075433_10214434 3300006852 Bacteria 1710
226 Ga0075433_10250066 3300006852 Bacteria 1573
227 Ga0075433_10330284 3300006852 Bacteria 1348
228 Ga0075433_10342331 3300006852 Bacteria 1322
229 Ga0075433_10545745 3300006852 Unclassified 1019
230 Ga0075433_11111718 3300006852 Unclassified 687
231 Ga0075434_100002824 3300006871 Bacteria 15381
232 Ga0075434_100116535 3300006871 Bacteria 2684
233 Ga0075434_100523562 3300006871 Bacteria 1206
234 Ga0075434_100581196 3300006871 Bacteria 1139
235 Ga0075434_100613719 3300006871 Unclassified 1107
236 Ga0075434_100735242 3300006871 Bacteria 1004
237 Ga0075434_101098493 3300006871 Unclassified 809
238 Ga0075434_101880589 3300006871 Unclassified 605
239 Ga0075429_100037817 3300006880 Bacteria 4200
240 Ga0075429_100061007 3300006880 Bacteria 3285
241 Ga0075429_101017543 3300006880 Unclassified 724
242 Ga0075429_101477726 3300006880 Unclassified 591
243 Ga0068865_100252752 3300006881 Unclassified 1392
244 Ga0068865_100808816 3300006881 Unclassified 809
245 Ga0075436_100000006 3300006914 Bacteria 306066
246 Ga0075436_100091773 3300006914 Bacteria 2111
247 Ga0075436_100125290 3300006914 Bacteria 1799
248 Ga0075436_100355184 3300006914 Bacteria 1057
249 Ga0097620_100002807 3300006931 Bacteria 17650
250 Ga0097620_100017183 3300006931 Bacteria 7264
251 Ga0097620_100043444 3300006931 Bacteria 4516
252 Ga0097620_100680972 3300006931 Bacteria 1120
253 Ga0097620_101162357 3300006931 Bacteria 849
254 Ga0097620_101258663 3300006931 Unclassified 815
255 Ga0097620_101364944 3300006931 Unclassified 781
256 Ga0097620_101586957 3300006931 Bacteria 723
257 Ga0075435_100002364 3300007076 Bacteria 12509
258 Ga0075435_100104899 3300007076 Bacteria 2345
259 Ga0075435_100249413 3300007076 Bacteria 1511
260 Ga0075435_100941430 3300007076 Unclassified 754
261 Ga0099795_10041227 3300007788 Unclassified 1643
262 Ga0105240_10505086 3300009093 Bacteria 1344
263 Ga0111539_10000010 3300009094 Bacteria 366246
264 Ga0111539_10002867 3300009094 Bacteria 22888
265 Ga0111539_10048975 3300009094 Bacteria 5043
266 Ga0111539_11893819 3300009094 Unclassified 691
267 Ga0111539_13137104 3300009094 Bacteria 533
268 Ga0105245_10000219 3300009098 Bacteria 54553
269 Ga0105245_10014320 3300009098 Bacteria 6910
270 Ga0105245_10784694 3300009098 Bacteria 990
271 Ga0105245_11084271 3300009098 Unclassified 847
272 Ga0105247_10043835 3300009101 Bacteria 2741
273 Ga0105247_10105826 3300009101 Bacteria 1804
274 Ga0114129_10006498 3300009147 Bacteria 16579
275 Ga0114129_10019363 3300009147 Bacteria 9693
276 Ga0114129_10061527 3300009147 Bacteria 5247
277 Ga0114129_10588757 3300009147 Bacteria 1443
278 Ga0114129_11215669 3300009147 Bacteria 938
279 Ga0114129_12508631 3300009147 Unclassified 616
280 Ga0105243_10000211 3300009148 Bacteria 67960
281 Ga0105243_10009599 3300009148 Bacteria 7368
282 Ga0105243_10851034 3300009148 Unclassified 903
283 Ga0105243_11600397 3300009148 Bacteria 678
284 Ga0105243_11721394 3300009148 Unclassified 656
285 Ga0105243_12862726 3300009148 Bacteria 523
286 Ga0105241_10116009 3300009174 Bacteria 2150
287 Ga0105241_10343281 3300009174 Bacteria 1294
288 Ga0105241_10394350 3300009174 Bacteria 1213
289 Ga0105241_10477876 3300009174 Bacteria 1107
290 Ga0105241_11862377 3300009174 Bacteria 589
291 Ga0105242_10000644 3300009176 Bacteria 27298
292 Ga0105242_10269574 3300009176 Bacteria 1541
293 Ga0105242_10427876 3300009176 Unclassified 1242
294 Ga0105242_10507080 3300009176 Bacteria 1149
295 Ga0105242_12403117 3300009176 Bacteria 574
296 Ga0105248_10003263 3300009177 Bacteria 17988
297 Ga0105248_10095290 3300009177 Bacteria 3351
298 Ga0105248_10101318 3300009177 Bacteria 3246
299 Ga0105248_11045955 3300009177 Unclassified 922
300 Ga0105248_11748929 3300009177 Unclassified 705
301 Ga0105248_12403566 3300009177 Unclassified 600
302 Ga0105248_12577691 3300009177 Unclassified 580
303 Ga0105237_10001880 3300009545 Bacteria 26792
304 Ga0105237_10020644 3300009545 Bacteria 6786
305 Ga0105237_10653896 3300009545 Bacteria 1058
306 Ga0105238_10003824 3300009551 Bacteria 14956
307 Ga0105249_10034400 3300009553 Bacteria 4593
308 Ga0105249_10058269 3300009553 Bacteria 3540
309 Ga0105249_10089076 3300009553 Bacteria 2883
310 Ga0105249_10111927 3300009553 Bacteria 2581
311 Ga0105249_10763269 3300009553 Bacteria 1030
312 Ga0105249_10802989 3300009553 Bacteria 1005
313 Ga0105249_11067887 3300009553 Bacteria 877
314 Ga0105249_12128131 3300009553 Bacteria 634
315 Ga0105249_12758994 3300009553 Unclassified 563
316 Ga0105239_10101613 3300010375 Bacteria 3181
317 Ga0105239_10307134 3300010375 Bacteria 1787
318 Ga0105239_11165027 3300010375 Bacteria 888
319 Ga0105239_11400006 3300010375 Bacteria 807
320 Ga0105239_11997986 3300010375 Bacteria 673
321 Ga0105239_12970243 3300010375 Bacteria 553
322 Ga0105246_10167104 3300011119 Bacteria 1681
323 Ga0105246_10177454 3300011119 Bacteria 1637
324 Ga0105246_10329413 3300011119 Bacteria 1244
325 Ga0157374_11870366 3300013296 Bacteria 626
326 Ga0157378_10015788 3300013297 Bacteria 6614
327 Ga0157378_10052847 3300013297 Bacteria 3615
328 Ga0157378_10067064 3300013297 Bacteria 3215
329 Ga0157378_10067967 3300013297 Unclassified 3194
330 Ga0157378_10077681 3300013297 Bacteria 2993
331 Ga0157378_10388663 3300013297 Bacteria 1372
332 Ga0157378_10452032 3300013297 Bacteria 1275
333 Ga0157378_10545018 3300013297 Bacteria 1164
334 Ga0157378_10967703 3300013297 Bacteria 884
335 Ga0157378_11527774 3300013297 Unclassified 713
336 Ga0157378_12846649 3300013297 Unclassified 536
337 Ga0163162_10022049 3300013306 Bacteria 6275
338 Ga0163162_10054162 3300013306 Bacteria 4035
339 Ga0163162_11163152 3300013306 Bacteria 875
340 Ga0163162_11794808 3300013306 Unclassified 701
341 Ga0157372_10272093 3300013307 Unclassified 1969
342 Ga0157372_12803068 3300013307 Bacteria 559
343 Ga0157375_10430853 3300013308 Bacteria 1485
344 Ga0157375_10514929 3300013308 Bacteria 1360
345 Ga0157375_10931847 3300013308 Bacteria 1011
346 Ga0163163_10047164 3300014325 Bacteria 4234
347 Ga0163163_11084277 3300014325 Unclassified 864
348 Ga0163163_11899334 3300014325 Unclassified 655
349 Ga0157380_10050615 3300014326 Bacteria 3282
350 Ga0157380_10404435 3300014326 Bacteria 1296
351 Ga0157380_10939238 3300014326 Unclassified 894
352 Ga0157380_11145027 3300014326 Bacteria 819
353 Ga0157380_11631953 3300014326 Unclassified 701
354 Ga0157380_11901449 3300014326 Bacteria 656
355 Ga0157377_10096817 3300014745 Unclassified 1751
356 Ga0157379_10086902 3300014968 Bacteria 2804
357 Ga0157376_10201642 3300014969 Bacteria 1831
358 Ga0157376_10508444 3300014969 Unclassified 1185
359 Ga0182007_10278354 3300015262 Bacteria 608
360 Ga0163161_10037468 3300017792 Bacteria 3477
361 Ga0163161_10210227 3300017792 Bacteria 1503
362 Ga0163161_10589628 3300017792 Bacteria 915
363 Ga0213874_10012565 3300021377 Unclassified 2174
364 Ga0207697_10495553 3300025315 Bacteria 540
365 Ga0207713_1072196 3300025735 Bacteria 1271
366 Ga0207653_10000121 3300025885 Bacteria 55532
367 Ga0207653_10002223 3300025885 Bacteria 6184
368 Ga0207653_10108879 3300025885 Unclassified 987
369 Ga0207682_10069691 3300025893 Bacteria 1488
370 Ga0207682_10090853 3300025893 Bacteria 1323
371 Ga0207710_10164547 3300025900 Bacteria 1082
372 Ga0207688_10016809 3300025901 Bacteria 3972
373 Ga0207688_10215543 3300025901 Unclassified 1155
374 Ga0207647_10020517 3300025904 Bacteria 4429
375 Ga0207647_10046470 3300025904 Bacteria 2705
376 Ga0207685_10000016 3300025905 Bacteria 151990
377 Ga0207643_10001161 3300025908 Bacteria 15657
378 Ga0207643_10054529 3300025908 Unclassified 2272
379 Ga0207684_10006192 3300025910 Bacteria 10928
380 Ga0207684_10973350 3300025910 Bacteria 711
381 Ga0207684_10983230 3300025910 Bacteria 707
382 Ga0207654_11164324 3300025911 Bacteria 562
383 Ga0207654_11321839 3300025911 Unclassified 526
384 Ga0207707_10000003 3300025912 Bacteria 642592
385 Ga0207707_10182556 3300025912 Bacteria 1831
386 Ga0207671_10012698 3300025914 Bacteria 6757
387 Ga0207660_10224697 3300025917 Bacteria 1475
388 Ga0207662_10158556 3300025918 Bacteria 1444
389 Ga0207662_10264683 3300025918 Unclassified 1133
390 Ga0207662_10326660 3300025918 Bacteria 1025
391 Ga0207662_10974444 3300025918 Bacteria 602
392 Ga0207649_10574763 3300025920 Bacteria 865
393 Ga0207649_10681467 3300025920 Unclassified 796
394 Ga0207652_10000297 3300025921 Bacteria 51413
395 Ga0207652_10032216 3300025921 Bacteria 4404
396 Ga0207652_10247080 3300025921 Bacteria 1609
397 Ga0207646_10121494 3300025922 Bacteria 2347
398 Ga0207646_10178734 3300025922 Bacteria 1916
399 Ga0207646_10238871 3300025922 Bacteria 1641
400 Ga0207646_10326686 3300025922 Unclassified 1386
401 Ga0207646_10512592 3300025922 Bacteria 1080
402 Ga0207646_10517654 3300025922 Bacteria 1074
403 Ga0207646_10680460 3300025922 Bacteria 921
404 Ga0207646_11620937 3300025922 Bacteria 558
405 Ga0207681_11256324 3300025923 Bacteria 622
406 Ga0207694_10064493 3300025924 Unclassified 2855
407 Ga0207650_10096478 3300025925 Unclassified 2268
408 Ga0207650_11588899 3300025925 Bacteria 555
409 Ga0207659_10209397 3300025926 Bacteria 1562
410 Ga0207687_10000074 3300025927 Bacteria 73639
411 Ga0207687_10926344 3300025927 Unclassified 746
412 Ga0207644_10000129 3300025931 Bacteria 54482
413 Ga0207644_10130283 3300025931 Unclassified 1925
414 Ga0207644_10253102 3300025931 Bacteria 1406
415 Ga0207706_10930762 3300025933 Unclassified 733
416 Ga0207686_10000054 3300025934 Bacteria 107699
417 Ga0207686_10336570 3300025934 Bacteria 1132
418 Ga0207709_10003915 3300025935 Bacteria 8699
419 Ga0207709_11265091 3300025935 Unclassified 609
420 Ga0207670_10047245 3300025936 Unclassified 2865
421 Ga0207669_10417905 3300025937 Unclassified 1055
422 Ga0207669_11134799 3300025937 Unclassified 661
423 Ga0207665_10000029 3300025939 Bacteria 95174
424 Ga0207665_10202663 3300025939 Bacteria 1446
425 Ga0207665_10268866 3300025939 Bacteria 1265
426 Ga0207665_10392369 3300025939 Unclassified 1055
427 Ga0207691_10071028 3300025940 Unclassified 3143
428 Ga0207711_10049873 3300025941 Bacteria 3584
429 Ga0207711_10231645 3300025941 Bacteria 1692
430 Ga0207711_11631000 3300025941 Unclassified 588
431 Ga0207689_10187480 3300025942 Unclassified 1706
432 Ga0207689_10303244 3300025942 Unclassified 1324
433 Ga0207679_10023461 3300025945 Bacteria 4220
434 Ga0207679_11595195 3300025945 Unclassified 598
435 Ga0207667_11200620 3300025949 Bacteria 738
436 Ga0207651_10235338 3300025960 Bacteria 1490
437 Ga0207651_11641085 3300025960 Bacteria 579
438 Ga0207712_10067217 3300025961 Unclassified 2564
439 Ga0207712_10388397 3300025961 Bacteria 1170
440 Ga0207712_10713263 3300025961 Bacteria 876
441 Ga0207712_10715708 3300025961 Unclassified 875
442 Ga0207640_10106812 3300025981 Bacteria 1975
443 Ga0207640_10327906 3300025981 Unclassified 1221
444 Ga0207640_10383529 3300025981 Unclassified 1139
445 Ga0207640_11580424 3300025981 Unclassified 590
446 Ga0207677_10677986 3300026023 Unclassified 912
447 Ga0207703_10019510 3300026035 Bacteria 5299
448 Ga0207703_10077851 3300026035 Bacteria 2754
449 Ga0207703_11335275 3300026035 Bacteria 690
450 Ga0207703_11421806 3300026035 Unclassified 667
451 Ga0207639_10013734 3300026041 Bacteria 5679
452 Ga0207639_10029883 3300026041 Bacteria 3994
453 Ga0207708_10000031 3300026075 Bacteria 155478
454 Ga0207708_10036556 3300026075 Unclassified 3739
455 Ga0207708_10199291 3300026075 Bacteria 1597
456 Ga0207702_10035297 3300026078 Bacteria 4181
457 Ga0207702_10965186 3300026078 Bacteria 845
458 Ga0207641_10096924 3300026088 Bacteria 2591
459 Ga0207641_10738224 3300026088 Unclassified 971
460 Ga0207648_10121647 3300026089 Bacteria 2295
461 Ga0207648_10199749 3300026089 Unclassified 1773
462 Ga0207648_10437948 3300026089 Bacteria 1189
463 Ga0207648_10659692 3300026089 Unclassified 967
464 Ga0207648_11527982 3300026089 Bacteria 628
465 Ga0207676_10004869 3300026095 Bacteria 9506
466 Ga0207676_10046981 3300026095 Bacteria 3343
467 Ga0207676_10083344 3300026095 Unclassified 2604
468 Ga0207676_10385008 3300026095 Bacteria 1306
469 Ga0207676_10695355 3300026095 Bacteria 985
470 Ga0207676_11657759 3300026095 Bacteria 638
471 Ga0207676_11764446 3300026095 Unclassified 617
472 Ga0207674_10019234 3300026116 Bacteria 7404
473 Ga0207674_10084949 3300026116 Bacteria 3162
474 Ga0207674_10224604 3300026116 Bacteria 1826
475 Ga0207674_10531428 3300026116 Bacteria 1136
476 Ga0207674_10781732 3300026116 Unclassified 921
477 Ga0207675_100001533 3300026118 Bacteria 23147
478 Ga0207675_100028534 3300026118 Bacteria 5196
479 Ga0207698_10293856 3300026142 Unclassified 1509
480 Ga0207698_11109881 3300026142 Bacteria 804
481 Ga0207428_10000658 3300027907 Bacteria 40461
482 Ga0207428_10027928 3300027907 Bacteria 4693
483 Ga0207428_10042780 3300027907 Bacteria 3662
484 Ga0268265_10458837 3300028380 Unclassified 1192
485 Ga0268265_10670960 3300028380 Bacteria 998
486 Ga0268264_10109091 3300028381 Unclassified 2421
487 Ga0268264_10367872 3300028381 Bacteria 1373
488 Ga0268264_12091363 3300028381 Unclassified 575
489 Ga0265330_10001263 3300031235 Bacteria 14813
490 Ga0307509_10015250 3300031507 Bacteria 8980
491 Ga0307408_100629269 3300031548 Bacteria 957
492 Ga0316575_10003213 3300031665 Bacteria 5600
493 Ga0316579_10217965 3300031691 Bacteria 923
494 Ga0265314_10494419 3300031711 Bacteria 645
495 Ga0316576_10464098 3300031727 Bacteria 934
496 Ga0316576_10627481 3300031727 Unclassified 783
497 Ga0316578_10093016 3300031728 Bacteria 1803
498 Ga0307516_10076003 3300031730 Bacteria 3212
499 Ga0316577_10190810 3300031733 Bacteria 1158
500 Ga0307413_10986767 3300031824 Unclassified 721
501 Ga0307407_10465891 3300031903 Bacteria 920
502 Ga0307412_10364305 3300031911 Bacteria 1165
503 Ga0307416_100355645 3300032002 Bacteria 1484
504 Ga0307416_101153537 3300032002 Bacteria 880
505 Ga0307411_10154950 3300032005 Bacteria 1708
506 Ga0373940_0208344 3300035088 Unclassified 645
507 Ga0373923_0037096 3300035111 Bacteria 1993
508 Ga0373936_0084043 3300035113 Bacteria 1328
509 Ga0373936_0324749 3300035113 Bacteria 698
510 Ga0373956_0592155 3300035119 Bacteria 529
511 Ga0373955_0067610 3300035172 Bacteria 1990
512 Ga0316574_0015891 3300035398 Bacteria 4374
513 Ga0373933_0244871 3300035724 Bacteria 1154
514 Ga0373947_0539361 3300035725 Bacteria 794
515 Ga0373947_0933881 3300035725 Bacteria 592
516 Ga0373937_0724709 3300036401 Bacteria 941
517 Ga0316582_0210783 3300036647 Bacteria 1327
518 Ga0316584_0110357 3300036712 Bacteria 2059
519 Ga0395905_1461732 3300037471 Unclassified 588
520 Ga0395901_0106432 3300038443 Bacteria 2944
521 Ga0242420_016469 3300038996 Bacteria 1288
522 Ga0242420_028264 3300038996 Bacteria 1031
523 Ga0436365_0691433 3300039437 Unclassified 744
524 Ga0436361_1021026 3300039447 Unclassified 883
525 Ga0436363_1125325 3300039450 Bacteria 14426
526 Ga0439453_0043051 3300041408 Unclassified 891
527 Ga0439453_0052656 3300041408 Unclassified 826
528 Ga0439453_0177702 3300041408 Bacteria 518
529 Ga0451804_0665228 3300041463 Unclassified 585
530 Ga0439443_044727 3300042003 Bacteria 763
531 Ga0439455_0002678 3300042012 Bacteria 3282
532 Ga0450919_007917 3300042121 Bacteria 1236
533 Ga0439458_0001946 3300042157 Bacteria 5123
534 Ga0451577_0320713 3300042876 Bacteria 1405
535 Ga0451577_0543838 3300042876 Unclassified 1054
536 Ga0453683_0034700 3300044673 Bacteria 3180
537 Ga0453683_0043196 3300044673 Bacteria 2829
538 Ga0453683_0045905 3300044673 Bacteria 2739
539 Ga0453683_0335410 3300044673 Bacteria 970
540 Ga0451576_0023513 3300045051 Bacteria 6672
541 Ga0451576_0023569 3300045051 Bacteria 6663
542 Ga0451576_0044464 3300045051 Bacteria 4681
543 Ga0451576_0070499 3300045051 Bacteria 3638
544 Ga0451576_0208158 3300045051 Bacteria 2042
545 Ga0451576_0398642 3300045051 Unclassified 1443
546 Ga0451576_0555182 3300045051 Unclassified 1207
547 Ga0451576_1119006 3300045051 Bacteria 824
548 Ga0451576_1242916 3300045051 Bacteria 777
549 Ga0451576_2694850 3300045051 Unclassified 506
550 Ga0495650_0041305 3300046471 Bacteria 1974
551 Ga0495664_0637778 3300046477 Bacteria 632
552 Ga0495618_0070136 3300046514 Bacteria 2229
553 Ga0495634_0246790 3300046642 Bacteria 1093
554 Ga0495635_0155949 3300046663 Unclassified 1554
555 Ga0495658_0070533 3300046683 Bacteria 2028
556 Ga0495669_0024057 3300046684 Unclassified 2654
557 Ga0495600_0267367 3300046809 Bacteria 1085
558 Ga0495581_0660934 3300047315 Unclassified 604
559 Ga0495636_0174653 3300047318 Bacteria 973
560 Ga0495674_0424254 3300047319 Unclassified 1071
561 Ga0495672_0194130 3300047320 Bacteria 1019
562 Ga0495680_0669661 3300047322 Bacteria 688
563 Ga0495685_263642 3300047447 Unclassified 545
564 Ga0496100_0478369 3300048903 Bacteria 958
565 Ga0496102_0838036 3300048905 Bacteria 842
566 Ga0496103_0138488 3300048906 Bacteria 1556
567 Ga0496104_0533301 3300048907 Bacteria 1085
568 Ga0496106_0350179 3300048909 Bacteria 1186
569 Ga0496106_0397431 3300048909 Bacteria 1108
570 Ga0496106_0819455 3300048909 Bacteria 738
571 Ga0496107_0224007 3300048910 Bacteria 1399
572 Ga0496108_0056069 3300048911 Bacteria 3310
573 Ga0496108_0117707 3300048911 Bacteria 2277
574 Ga0496108_0218982 3300048911 Bacteria 1654
575 Ga0496110_0000448 3300048913 Bacteria 28089
576 Ga0496110_1556858 3300048913 Bacteria 571
577 Ga0496111_0001193 3300048914 Bacteria 14493
578 Ga0496113_0062195 3300048916 Unclassified 2819
579 Ga0496114_0376427 3300048917 Bacteria 1257
580 Ga0496116_0432042 3300048919 Bacteria 571
581 Ga0501031_0265174 3300049568 Bacteria 1116
582 Ga0501038_0125896 3300049574 Bacteria 2109
583 Ga0501040_0043906 3300049576 Bacteria 3047
584 Ga0501041_1130234 3300049577 Bacteria 505
585 Ga0501042_0726154 3300049578 Unclassified 722
586 Ga0501046_0384288 3300049580 Bacteria 1016
587 Ga0501048_0029462 3300049582 Bacteria 3982
588 Ga0501068_0448909 3300049584 Bacteria 834
589 Ga0501070_0672873 3300049586 Bacteria 820
590 Ga0501072_0426385 3300049588 Bacteria 1051
591 Ga0501076_0066372 3300049592 Bacteria 2880
592 Ga0501077_1043668 3300049593 Bacteria 526
593 Ga0501202_043691 3300049652 Bacteria 975
594 Ga0501079_0933253 3300049741 Bacteria 683
595 Ga0501080_0278858 3300049742 Bacteria 1520
596 Ga0501081_0814531 3300049743 Bacteria 703
597 Ga0501045_0061249 3300049824 Bacteria 2761
598 nmdc:mga05p37_151616_c1 3300050507 Bacteria 2835
599 nmdc:mga05p37_19654_c1 3300050507 Bacteria 8171
600 nmdc:mga05p37_293412_c1 3300050507 Bacteria 1935
601 nmdc:mga05p37_387508_c1 3300050507 Bacteria 1635
602 nmdc:mga05p37_491658_c1 3300050507 Bacteria 1410
603 nmdc:mga05p37_852097_c1 3300050507 Bacteria 990
604 nmdc:mga09592_200035_c1 3300050508 Bacteria 1730
605 nmdc:mga09592_49927_c1 3300050508 Bacteria 3528
606 nmdc:mga09592_845630_c1 3300050508 Unclassified 772
607 nmdc:mga0qj67_171678_c1 3300050509 Bacteria 1761
608 nmdc:mga0qj67_201461_c1 3300050509 Unclassified 1617
609 nmdc:mga0qj67_556373_c1 3300050509 Unclassified 920
610 nmdc:mga06r32_1091016_c1 3300050510 Unclassified 748
611 nmdc:mga06r32_140301_c1 3300050510 Bacteria 2392
612 nmdc:mga06r32_536206_c1 3300050510 Bacteria 1145
613 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
614 nmdc:mga08y16_136486_c1 3300050511 Bacteria 2550
615 nmdc:mga08y16_21286_c1 3300050511 Bacteria 6847
616 nmdc:mga0n895_1484_c1 3300050512 Bacteria 17594
617 nmdc:mga0n895_32213_c1 3300050512 Bacteria 5030
618 nmdc:mga0n895_467457_c1 3300050512 Unclassified 1272
619 nmdc:mga0n895_582787_c1 3300050512 Unclassified 1122
620 nmdc:mga0rr50_188886_c1 3300050513 Bacteria 1687
621 nmdc:mga0rr50_226369_c1 3300050513 Bacteria 1546
622 nmdc:mga0rr50_463952_c1 3300050513 Unclassified 1074
623 nmdc:mga0rr50_810858_c1 3300050513 Unclassified 798
624 nmdc:mga0rr50_823_c1 3300050513 Bacteria 16677
625 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
626 nmdc:mga08x19_55178_c1 3300050514 Bacteria 2560
627 nmdc:mga0a205_1376534_c1 3300050515 Unclassified 553
628 nmdc:mga0a205_1388958_c1 3300050515 Unclassified 550
629 nmdc:mga0a205_206850_c1 3300050515 Bacteria 1852
630 nmdc:mga0a205_2185_c1 3300050515 Bacteria 17222
631 nmdc:mga0a205_242410_c1 3300050515 Bacteria 1683
632 nmdc:mga0a205_25380_c1 3300050515 Bacteria 5647
633 nmdc:mga0a205_26561_c1 3300050515 Bacteria 4232
634 nmdc:mga0a205_303571_c1 3300050515 Bacteria 1469
635 nmdc:mga0a205_31895_c1 3300050515 Bacteria 5050
636 nmdc:mga0a205_36162_c1 3300050515 Bacteria 4744
637 nmdc:mga0a205_41913_c1 3300050515 Bacteria 4410
638 nmdc:mga0a205_849516_c1 3300050515 Bacteria 760
639 nmdc:mga0a205_854041_c1 3300050515 Bacteria 757
640 nmdc:mga0a205_992437_c1 3300050515 Unclassified 687
641 Ga0500640_006349 3300053095 Bacteria 4502
642 Ga0500554_001722 3300053102 Bacteria 4214
643 Ga0500572_118125 3300053111 Bacteria 857
644 Ga0500595_000170 3300053119 Bacteria 43405
645 Ga0500614_013250 3300053123 Bacteria 1809
646 Ga0500559_0007084 3300053136 Bacteria 5002
647 Ga0500576_220314 3300053725 Unclassified 623
648 Ga0501082_0076078 3300060353 Bacteria 2893
649 2672334391 2671180330 Bacteria 5521719
650 2849144825 2849139964 Bacteria 5613304
651 Ga0070698_100421580
652 MBSR1b_contig_14112676
653 Ga0065712_10126815
654 Ga0065715_10001530
655 Ga0065715_10193867
656 Ga0065715_10457555
657 Ga0065707_10001055
658 Ga0065707_10091990
659 Ga0065707_10266409
660 Ga0065707_10473844
661 Ga0070676_11352733
662 Ga0070683_100231192
663 Ga0070690_100115614
664 Ga0070690_100448845
665 Ga0070670_100041932
666 Ga0070670_100729469
667 Ga0070677_10069934
668 Ga0070677_10307985
669 Ga0068869_101384518
670 Ga0070666_11177001
671 Ga0070680_100219135
672 Ga0070680_100292289
673 Ga0070680_100381017
674 Ga0070682_100021719
675 Ga0068868_100077291
676 Ga0068868_101785640
677 Ga0070660_101244816
678 Ga0070660_101905020
679 Ga0070689_100047516
680 Ga0070689_100122556
681 Ga0070689_101063223
682 Ga0070691_10137651
683 Ga0070687_100039007
684 Ga0070687_100279723
685 Ga0070687_100846806
686 Ga0070687_100934465
687 Ga0070692_10023766
688 Ga0070669_101501803
689 Ga0070669_101583674
690 Ga0070675_100101002
691 Ga0070675_100211900
692 Ga0070671_100125497
693 Ga0070674_100038828
694 Ga0070674_101097138
695 Ga0070674_102090977
696 Ga0070673_100346465
697 Ga0070673_100374084
698 Ga0070673_101759404
699 Ga0070667_100620798
700 Ga0070703_10000149
701 Ga0070703_10013309
702 Ga0070703_10034325
703 Ga0070701_11021409
704 Ga0070705_100160883
705 Ga0070705_100245359
706 Ga0070705_100366583
707 Ga0070705_101380123
708 Ga0070700_100011253
709 Ga0070700_100018655
710 Ga0070700_100028767
711 Ga0070700_100333033
712 Ga0070700_101270949
713 Ga0070694_100005693
714 Ga0070694_100007317
715 Ga0070694_100053948
716 Ga0070694_100120617
717 Ga0070694_100272576
718 Ga0070694_100679963
719 Ga0070694_101833450
720 Ga0070708_100030979
721 Ga0070708_100107285
722 Ga0070708_100146168
723 Ga0070708_100192721
724 Ga0070708_100448580
725 Ga0070662_101354295
726 Ga0070681_10000210
727 Ga0070681_11056375
728 Ga0068867_100229724
729 Ga0068867_100335049
730 Ga0068867_100439425
731 Ga0068867_100592533
732 Ga0068867_101571568
733 Ga0068867_101849853
734 Ga0070685_10192379
735 Ga0070706_100026396
736 Ga0070706_100031000
737 Ga0070706_100093488
738 Ga0070706_100509871
739 Ga0070706_100531580
740 Ga0070706_100586155
741 Ga0070706_101827285
742 Ga0070707_100075809
743 Ga0070707_100089018
744 Ga0070707_100147515
745 Ga0070707_100258141
746 Ga0070707_100383760
747 Ga0070707_100405672
748 Ga0070707_100601568
749 Ga0070707_100951445
750 Ga0070707_101947369
751 Ga0070698_100007556
752 Ga0070698_100540823
753 Ga0070698_100772945
754 Ga0070698_101638041
755 Ga0070698_101838871
756 Ga0070699_100013903
757 Ga0070699_100245859
758 Ga0070699_100302880
759 Ga0070699_100415641
760 Ga0070699_101114872
761 Ga0070679_100000055
762 Ga0070679_100061751
763 Ga0070684_100266708
764 Ga0070697_100003858
765 Ga0070697_100122868
766 Ga0070697_101508953
767 Ga0068853_100064257
768 Ga0070672_100049262
769 Ga0070686_100035997
770 Ga0070686_100101264
771 Ga0070686_100580089
772 Ga0070695_100014861
773 Ga0070695_100024073
774 Ga0070695_100029228
775 Ga0070695_100032230
776 Ga0070695_100130921
777 Ga0070695_100152328
778 Ga0070695_100209627
779 Ga0070695_100379480
780 Ga0070696_100158047
781 Ga0070696_100202122
782 Ga0070696_100279157
783 Ga0070696_101430389
784 Ga0070696_101815051
785 Ga0070693_100019979
786 Ga0070693_100088768
787 Ga0070693_100522185
788 Ga0070693_100777855
789 Ga0070704_100021208
790 Ga0070704_101309756
791 Ga0070704_101941154
792 Ga0068855_100670527
793 Ga0070664_100066895
794 Ga0068857_100483746
795 Ga0068857_100976381
796 Ga0068857_101005943
797 Ga0068857_101640463
798 Ga0068857_101917958
799 Ga0068854_100062673
800 Ga0068854_100064566
801 Ga0068854_100388175
802 Ga0068856_100026884
803 Ga0070702_100007395
804 Ga0070702_100007476
805 Ga0070702_100009930
806 Ga0070702_100228840
807 Ga0070702_100778779
808 Ga0070702_101893476
809 Ga0068852_100229342
810 Ga0068859_100002807
811 Ga0068859_100017183
812 Ga0068859_100043444
813 Ga0068859_100680941
814 Ga0068859_101162397
815 Ga0068859_101258398
816 Ga0068859_101364976
817 Ga0068859_101586928
818 Ga0068864_100048330
819 Ga0068864_100051467
820 Ga0068864_100305508
821 Ga0068864_100723914
822 Ga0068864_101405440
823 Ga0068864_101838048
824 Ga0068861_100017929
825 Ga0068861_100022508
826 Ga0068861_100231711
827 Ga0068861_101345323
828 Ga0068851_10006917
829 Ga0068870_10009850
830 Ga0068863_100115628
831 Ga0068863_100413437
832 Ga0068863_100561631
833 Ga0068863_102363719
834 Ga0068858_100038960
835 Ga0068858_100124125
836 Ga0068858_100978215
837 Ga0068858_101231529
838 Ga0068858_101297038
839 Ga0068860_100019676
840 Ga0068860_100153762
841 Ga0068860_101297659
842 Ga0068860_101471845
843 Ga0068860_101903475
844 Ga0068862_100005852
845 Ga0068862_100067036
846 Ga0068862_100113107
847 Ga0068862_100180204
848 Ga0068862_101252015
849 Ga0075432_10110371
850 Ga0070715_10000032
851 Ga0070716_100000014
852 Ga0070716_100292785
853 Ga0070712_101460538
854 Ga0097621_100000830
855 Ga0097621_100048386
856 Ga0097621_101934066
857 Ga0068871_100008257
858 Ga0068871_100207649
859 Ga0075428_100000708
860 Ga0075428_100043460
861 Ga0075428_100789867
862 Ga0075428_102063391
863 Ga0075430_100054112
864 Ga0075430_100218259
865 Ga0075430_100250211
866 Ga0075431_100055081
867 Ga0075431_100181375
868 Ga0075431_100244277
869 Ga0075431_100541447
870 Ga0075431_101391757
871 Ga0075433_10002827
872 Ga0075433_10029899
873 Ga0075433_10064102
874 Ga0075433_10142596
875 Ga0075433_10214434
876 Ga0075433_10250066
877 Ga0075433_10330284
878 Ga0075433_10342331
879 Ga0075433_10545745
880 Ga0075433_11111718
881 Ga0075434_100002824
882 Ga0075434_100116535
883 Ga0075434_100523562
884 Ga0075434_100581196
885 Ga0075434_100613719
886 Ga0075434_100735242
887 Ga0075434_101098493
888 Ga0075434_101880589
889 Ga0075429_100037817
890 Ga0075429_100061007
891 Ga0075429_101017543
892 Ga0075429_101477726
893 Ga0068865_100252752
894 Ga0068865_100808816
895 Ga0075436_100000006
896 Ga0075436_100091773
897 Ga0075436_100125290
898 Ga0075436_100355184
899 Ga0097620_100002807
900 Ga0097620_100017183
901 Ga0097620_100043444
902 Ga0097620_100680972
903 Ga0097620_101162357
904 Ga0097620_101258663
905 Ga0097620_101364944
906 Ga0097620_101586957
907 Ga0075435_100002364
908 Ga0075435_100104899
909 Ga0075435_100249413
910 Ga0075435_100941430
911 Ga0099795_10041227
912 Ga0105240_10505086
913 Ga0111539_10000010
914 Ga0111539_10002867
915 Ga0111539_10048975
916 Ga0111539_11893819
917 Ga0111539_13137104
918 Ga0105245_10000219
919 Ga0105245_10014320
920 Ga0105245_10784694
921 Ga0105245_11084271
922 Ga0105247_10043835
923 Ga0105247_10105826
924 Ga0114129_10006498
925 Ga0114129_10019363
926 Ga0114129_10061527
927 Ga0114129_10588757
928 Ga0114129_11215669
929 Ga0114129_12508631
930 Ga0105243_10000211
931 Ga0105243_10009599
932 Ga0105243_10851034
933 Ga0105243_11600397
934 Ga0105243_11721394
935 Ga0105243_12862726
936 Ga0105241_10116009
937 Ga0105241_10343281
938 Ga0105241_10394350
939 Ga0105241_10477876
940 Ga0105241_11862377
941 Ga0105242_10000644
942 Ga0105242_10269574
943 Ga0105242_10427876
944 Ga0105242_10507080
945 Ga0105242_12403117
946 Ga0105248_10003263
947 Ga0105248_10095290
948 Ga0105248_10101318
949 Ga0105248_11045955
950 Ga0105248_11748929
951 Ga0105248_12403566
952 Ga0105248_12577691
953 Ga0105237_10001880
954 Ga0105237_10020644
955 Ga0105237_10653896
956 Ga0105238_10003824
957 Ga0105249_10034400
958 Ga0105249_10058269
959 Ga0105249_10089076
960 Ga0105249_10111927
961 Ga0105249_10763269
962 Ga0105249_10802989
963 Ga0105249_11067887
964 Ga0105249_12128131
965 Ga0105249_12758994
966 Ga0105239_10101613
967 Ga0105239_10307134
968 Ga0105239_11165027
969 Ga0105239_11400006
970 Ga0105239_11997986
971 Ga0105239_12970243
972 Ga0105246_10167104
973 Ga0105246_10177454
974 Ga0105246_10329413
975 Ga0157374_11870366
976 Ga0157378_10015788
977 Ga0157378_10052847
978 Ga0157378_10067064
979 Ga0157378_10067967
980 Ga0157378_10077681
981 Ga0157378_10388663
982 Ga0157378_10452032
983 Ga0157378_10545018
984 Ga0157378_10967703
985 Ga0157378_11527774
986 Ga0157378_12846649
987 Ga0163162_10022049
988 Ga0163162_10054162
989 Ga0163162_11163152
990 Ga0163162_11794808
991 Ga0157372_10272093
992 Ga0157372_12803068
993 Ga0157375_10430853
994 Ga0157375_10514929
995 Ga0157375_10931847
996 Ga0163163_10047164
997 Ga0163163_11084277
998 Ga0163163_11899334
999 Ga0157380_10050615
1000 Ga0157380_10404435
1001 Ga0157380_10939238
1002 Ga0157380_11145027
1003 Ga0157380_11631953
1004 Ga0157380_11901449
1005 Ga0157377_10096817
1006 Ga0157379_10086902
1007 Ga0157376_10201642
1008 Ga0157376_10508444
1009 Ga0182007_10278354
1010 Ga0163161_10037468
1011 Ga0163161_10210227
1012 Ga0163161_10589628
1013 Ga0213874_10012565
1014 Ga0207697_10495553
1015 Ga0207713_1072196
1016 Ga0207653_10000121
1017 Ga0207653_10002223
1018 Ga0207653_10108879
1019 Ga0207682_10069691
1020 Ga0207682_10090853
1021 Ga0207710_10164547
1022 Ga0207688_10016809
1023 Ga0207688_10215543
1024 Ga0207647_10020517
1025 Ga0207647_10046470
1026 Ga0207685_10000016
1027 Ga0207643_10001161
1028 Ga0207643_10054529
1029 Ga0207684_10006192
1030 Ga0207684_10973350
1031 Ga0207684_10983230
1032 Ga0207654_11164324
1033 Ga0207654_11321839
1034 Ga0207707_10000003
1035 Ga0207707_10182556
1036 Ga0207671_10012698
1037 Ga0207660_10224697
1038 Ga0207662_10158556
1039 Ga0207662_10264683
1040 Ga0207662_10326660
1041 Ga0207662_10974444
1042 Ga0207649_10574763
1043 Ga0207649_10681467
1044 Ga0207652_10000297
1045 Ga0207652_10032216
1046 Ga0207652_10247080
1047 Ga0207646_10121494
1048 Ga0207646_10178734
1049 Ga0207646_10238871
1050 Ga0207646_10326686
1051 Ga0207646_10512592
1052 Ga0207646_10517654
1053 Ga0207646_10680460
1054 Ga0207646_11620937
1055 Ga0207681_11256324
1056 Ga0207694_10064493
1057 Ga0207650_10096478
1058 Ga0207650_11588899
1059 Ga0207659_10209397
1060 Ga0207687_10000074
1061 Ga0207687_10926344
1062 Ga0207644_10000129
1063 Ga0207644_10130283
1064 Ga0207644_10253102
1065 Ga0207706_10930762
1066 Ga0207686_10000054
1067 Ga0207686_10336570
1068 Ga0207709_10003915
1069 Ga0207709_11265091
1070 Ga0207670_10047245
1071 Ga0207669_10417905
1072 Ga0207669_11134799
1073 Ga0207665_10000029
1074 Ga0207665_10202663
1075 Ga0207665_10268866
1076 Ga0207665_10392369
1077 Ga0207691_10071028
1078 Ga0207711_10049873
1079 Ga0207711_10231645
1080 Ga0207711_11631000
1081 Ga0207689_10187480
1082 Ga0207689_10303244
1083 Ga0207679_10023461
1084 Ga0207679_11595195
1085 Ga0207667_11200620
1086 Ga0207651_10235338
1087 Ga0207651_11641085
1088 Ga0207712_10067217
1089 Ga0207712_10388397
1090 Ga0207712_10713263
1091 Ga0207712_10715708
1092 Ga0207640_10106812
1093 Ga0207640_10327906
1094 Ga0207640_10383529
1095 Ga0207640_11580424
1096 Ga0207677_10677986
1097 Ga0207703_10019510
1098 Ga0207703_10077851
1099 Ga0207703_11335275
1100 Ga0207703_11421806
1101 Ga0207639_10013734
1102 Ga0207639_10029883
1103 Ga0207708_10000031
1104 Ga0207708_10036556
1105 Ga0207708_10199291
1106 Ga0207702_10035297
1107 Ga0207702_10965186
1108 Ga0207641_10096924
1109 Ga0207641_10738224
1110 Ga0207648_10121647
1111 Ga0207648_10199749
1112 Ga0207648_10437948
1113 Ga0207648_10659692
1114 Ga0207648_11527982
1115 Ga0207676_10004869
1116 Ga0207676_10046981
1117 Ga0207676_10083344
1118 Ga0207676_10385008
1119 Ga0207676_10695355
1120 Ga0207676_11657759
1121 Ga0207676_11764446
1122 Ga0207674_10019234
1123 Ga0207674_10084949
1124 Ga0207674_10224604
1125 Ga0207674_10531428
1126 Ga0207674_10781732
1127 Ga0207675_100001533
1128 Ga0207675_100028534
1129 Ga0207698_10293856
1130 Ga0207698_11109881
1131 Ga0207428_10000658
1132 Ga0207428_10027928
1133 Ga0207428_10042780
1134 Ga0268265_10458837
1135 Ga0268265_10670960
1136 Ga0268264_10109091
1137 Ga0268264_10367872
1138 Ga0268264_12091363
1139 Ga0265330_10001263
1140 Ga0307509_10015250
1141 Ga0307408_100629269
1142 Ga0316575_10003213
1143 Ga0316579_10217965
1144 Ga0265314_10494419
1145 Ga0316576_10464098
1146 Ga0316576_10627481
1147 Ga0316578_10093016
1148 Ga0307516_10076003
1149 Ga0316577_10190810
1150 Ga0307413_10986767
1151 Ga0307407_10465891
1152 Ga0307412_10364305
1153 Ga0307416_100355645
1154 Ga0307416_101153537
1155 Ga0307411_10154950
1156 Ga0373940_0208344
1157 Ga0373923_0037096
1158 Ga0373936_0084043
1159 Ga0373936_0324749
1160 Ga0373956_0592155
1161 Ga0373955_0067610
1162 Ga0316574_0015891
1163 Ga0373933_0244871
1164 Ga0373947_0539361
1165 Ga0373947_0933881
1166 Ga0373937_0724709
1167 Ga0316582_0210783
1168 Ga0316584_0110357
1169 Ga0395905_1461732
1170 Ga0395901_0106432
1171 Ga0242420_016469
1172 Ga0242420_028264
1173 Ga0436365_0691433
1174 Ga0436361_1021026
1175 Ga0436363_1125325
1176 Ga0439453_0043051
1177 Ga0439453_0052656
1178 Ga0439453_0177702
1179 Ga0451804_0665228
1180 Ga0439443_044727
1181 Ga0439455_0002678
1182 Ga0450919_007917
1183 Ga0439458_0001946
1184 Ga0451577_0320713
1185 Ga0451577_0543838
1186 Ga0453683_0034700
1187 Ga0453683_0043196
1188 Ga0453683_0045905
1189 Ga0453683_0335410
1190 Ga0451576_0023513
1191 Ga0451576_0023569
1192 Ga0451576_0044464
1193 Ga0451576_0070499
1194 Ga0451576_0208158
1195 Ga0451576_0398642
1196 Ga0451576_0555182
1197 Ga0451576_1119006
1198 Ga0451576_1242916
1199 Ga0451576_2694850
1200 Ga0495650_0041305
1201 Ga0495664_0637778
1202 Ga0495618_0070136
1203 Ga0495634_0246790
1204 Ga0495635_0155949
1205 Ga0495658_0070533
1206 Ga0495669_0024057
1207 Ga0495600_0267367
1208 Ga0495581_0660934
1209 Ga0495636_0174653
1210 Ga0495674_0424254
1211 Ga0495672_0194130
1212 Ga0495680_0669661
1213 Ga0495685_263642
1214 Ga0496100_0478369
1215 Ga0496102_0838036
1216 Ga0496103_0138488
1217 Ga0496104_0533301
1218 Ga0496106_0350179
1219 Ga0496106_0397431
1220 Ga0496106_0819455
1221 Ga0496107_0224007
1222 Ga0496108_0056069
1223 Ga0496108_0117707
1224 Ga0496108_0218982
1225 Ga0496110_0000448
1226 Ga0496110_1556858
1227 Ga0496111_0001193
1228 Ga0496113_0062195
1229 Ga0496114_0376427
1230 Ga0496116_0432042
1231 Ga0501031_0265174
1232 Ga0501038_0125896
1233 Ga0501040_0043906
1234 Ga0501041_1130234
1235 Ga0501042_0726154
1236 Ga0501046_0384288
1237 Ga0501048_0029462
1238 Ga0501068_0448909
1239 Ga0501070_0672873
1240 Ga0501072_0426385
1241 Ga0501076_0066372
1242 Ga0501077_1043668
1243 Ga0501202_043691
1244 Ga0501079_0933253
1245 Ga0501080_0278858
1246 Ga0501081_0814531
1247 Ga0501045_0061249
1248 nmdc:mga05p37_151616_c1
1249 nmdc:mga05p37_19654_c1
1250 nmdc:mga05p37_293412_c1
1251 nmdc:mga05p37_387508_c1
1252 nmdc:mga05p37_491658_c1
1253 nmdc:mga05p37_852097_c1
1254 nmdc:mga09592_200035_c1
1255 nmdc:mga09592_49927_c1
1256 nmdc:mga09592_845630_c1
1257 nmdc:mga0qj67_171678_c1
1258 nmdc:mga0qj67_201461_c1
1259 nmdc:mga0qj67_556373_c1
1260 nmdc:mga06r32_1091016_c1
1261 nmdc:mga06r32_140301_c1
1262 nmdc:mga06r32_536206_c1
1263 nmdc:mga08y16_10_c1
1264 nmdc:mga08y16_136486_c1
1265 nmdc:mga08y16_21286_c1
1266 nmdc:mga0n895_1484_c1
1267 nmdc:mga0n895_32213_c1
1268 nmdc:mga0n895_467457_c1
1269 nmdc:mga0n895_582787_c1
1270 nmdc:mga0rr50_188886_c1
1271 nmdc:mga0rr50_226369_c1
1272 nmdc:mga0rr50_463952_c1
1273 nmdc:mga0rr50_810858_c1
1274 nmdc:mga0rr50_823_c1
1275 nmdc:mga08x19_13_c1
1276 nmdc:mga08x19_55178_c1
1277 nmdc:mga0a205_1376534_c1
1278 nmdc:mga0a205_1388958_c1
1279 nmdc:mga0a205_206850_c1
1280 nmdc:mga0a205_2185_c1
1281 nmdc:mga0a205_242410_c1
1282 nmdc:mga0a205_25380_c1
1283 nmdc:mga0a205_26561_c1
1284 nmdc:mga0a205_303571_c1
1285 nmdc:mga0a205_31895_c1
1286 nmdc:mga0a205_36162_c1
1287 nmdc:mga0a205_41913_c1
1288 nmdc:mga0a205_849516_c1
1289 nmdc:mga0a205_854041_c1
1290 nmdc:mga0a205_992437_c1
1291 Ga0500640_006349
1292 Ga0500554_001722
1293 Ga0500572_118125
1294 Ga0500595_000170
1295 Ga0500614_013250
1296 Ga0500559_0007084
1297 Ga0500576_220314
1298 Ga0501082_0076078
1299 2672334391
1300 2849144825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

24

142

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.9909 2 124
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9904 1 124
3k0t-assembly1.cif.gz_B crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000 0.9861 3 124
1x25-assembly2.cif.gz_B crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811) 0.9856 2 126
2dyy-assembly1.cif.gz_A crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9856 1 124
ID Description Score Start End Superfamily
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9846 3 124 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9827 3 124 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9816 1 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9797 18 125 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9757 1 126 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A321LJU5-F1-model_v4 Reactive intermediate/imine deaminase 0.9945 1 124 GO:0005829
GO:0019239
AF-A0A2V8BM28-F1-model_v4 RidA family protein 0.9944 1 126 GO:0005829
GO:0019239
AF-A0A348UNJ8-F1-model_v4 Reactive intermediate/imine deaminase 0.9943 3 126 GO:0005829
GO:0019239
AF-A0A3E1E6X0-F1-model_v4 2-iminobutanoate/2-iminopropanoate deaminase 0.9935 1 124 GO:0005829
GO:0019239
AF-A0A2D6QWS1-F1-model_v4 Reactive intermediate/imine deaminase 0.9934 1 125 GO:0005829
GO:0019239

Map