F472381

General Info

Members Datasets Scaffolds Average Seq Length
648 272 1296 293

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10025884|Ga0307405_100258842
Length 317
Sequence VSVQLRGVAIEDTFAEAFTMRAARVIITARNERWAREAALSMTGFATSVIGCKCEAGIERPLSAEETPDGRAGVSVLLFTMDSDSLPKRLMERLGQTVLTCPTTACFDGLPDSPDRMTVGKSLRVFGDGFQISKVVGGRRYWRIPVMEGEFLVAESFGRQKGVGGGNFLILAESAGAALRSAEAAVDAMRGTSGVILPFPGGVVRSGSKVGSKRYKGMIATTNDAFAPTLRAVTDSALPEGVNAVLEIVLDGVDAASIAAAMRAGIDAACTDGVVAISAGNYGGKLGPHHFHLRQIVAGDGAATAGGSPPRQHGTVP

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.26
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10025884 3300031731 Bacteria 3374
2 JGI25406J46586_10018614 3300003203 Bacteria 2851
3 JGI25407J50210_10009953 3300003373 Bacteria 2415
4 JGI25407J50210_10016336 3300003373 Bacteria 1922
5 Ga0065715_10097151 3300005293 Bacteria 3754
6 Ga0070683_100143308 3300005329 Bacteria 2264
7 Ga0070690_100047574 3300005330 Bacteria 2729
8 Ga0070680_100225072 3300005336 Bacteria 1583
9 Ga0070680_100273016 3300005336 Bacteria 1432
10 Ga0070682_100051109 3300005337 Bacteria 2582
11 Ga0068868_100206400 3300005338 Bacteria 1640
12 Ga0070691_10065332 3300005341 Bacteria 1756
13 Ga0070691_10227584 3300005341 Bacteria 991
14 Ga0070661_100148558 3300005344 Bacteria 1771
15 Ga0070692_10172837 3300005345 Bacteria 1247
16 Ga0070668_100001268 3300005347 Bacteria 18015
17 Ga0070669_100192010 3300005353 Bacteria 1602
18 Ga0070675_100007432 3300005354 Bacteria 8464
19 Ga0070675_100041830 3300005354 Bacteria 3743
20 Ga0070675_100306549 3300005354 Bacteria 1400
21 Ga0070675_100371242 3300005354 Bacteria 1272
22 Ga0070671_100001656 3300005355 Bacteria 16846
23 Ga0070674_100019833 3300005356 Bacteria 4280
24 Ga0070673_100061268 3300005364 Bacteria 2985
25 Ga0070673_100062862 3300005364 Bacteria 2952
26 Ga0070688_100070268 3300005365 Bacteria 2238
27 Ga0070659_100096789 3300005366 Bacteria 2371
28 Ga0070659_100171244 3300005366 Bacteria 1779
29 Ga0070703_10072843 3300005406 Bacteria 1152
30 Ga0070709_10060890 3300005434 Bacteria 2401
31 Ga0070714_100013874 3300005435 Bacteria 6461
32 Ga0070714_100056063 3300005435 Bacteria 3370
33 Ga0070714_100096891 3300005435 Bacteria 2592
34 Ga0070714_100328678 3300005435 Bacteria 1431
35 Ga0070713_100044586 3300005436 Bacteria 3630
36 Ga0070710_10022827 3300005437 Bacteria 3280
37 Ga0070701_10016453 3300005438 Bacteria 3439
38 Ga0070711_100000009 3300005439 Bacteria 172420
39 Ga0070711_100112336 3300005439 Bacteria 2002
40 Ga0070705_100006149 3300005440 Bacteria 5878
41 Ga0070705_100051932 3300005440 Bacteria 2393
42 Ga0070700_100008549 3300005441 Bacteria 5574
43 Ga0070694_100021428 3300005444 Bacteria 4129
44 Ga0070694_100047260 3300005444 Bacteria 2892
45 Ga0070708_100006105 3300005445 Bacteria 9585
46 Ga0070708_100036493 3300005445 Bacteria 4287
47 Ga0070708_100098616 3300005445 Bacteria 2672
48 Ga0070708_100219825 3300005445 Bacteria 1781
49 Ga0070708_100321081 3300005445 Bacteria 1458
50 Ga0070678_100114841 3300005456 Bacteria 2113
51 Ga0070681_10144997 3300005458 Bacteria 2304
52 Ga0068867_100089947 3300005459 Bacteria 2328
53 Ga0068867_100166256 3300005459 Unclassified 1743
54 Ga0070685_10095038 3300005466 Bacteria 1811
55 Ga0070706_100010912 3300005467 Bacteria 8435
56 Ga0070706_100043772 3300005467 Bacteria 4136
57 Ga0070706_100054048 3300005467 Bacteria 3707
58 Ga0070706_100237926 3300005467 Bacteria 1700
59 Ga0070706_100647075 3300005467 Bacteria 981
60 Ga0070707_100001686 3300005468 Bacteria 21311
61 Ga0070707_100010894 3300005468 Bacteria 8467
62 Ga0070707_100106639 3300005468 Bacteria 2717
63 Ga0070707_100336128 3300005468 Bacteria 1467
64 Ga0070698_100000520 3300005471 Bacteria 41001
65 Ga0070698_100127792 3300005471 Bacteria 2498
66 Ga0070699_100000926 3300005518 Bacteria 27348
67 Ga0070699_100009620 3300005518 Bacteria 8371
68 Ga0070699_100024148 3300005518 Bacteria 5239
69 Ga0070699_100030106 3300005518 Bacteria 4684
70 Ga0070699_100035792 3300005518 Bacteria 4292
71 Ga0070679_100158858 3300005530 Bacteria 2235
72 Ga0070684_100064120 3300005535 Bacteria 3222
73 Ga0070684_100071154 3300005535 Bacteria 3061
74 Ga0070684_100147679 3300005535 Bacteria 2129
75 Ga0070697_100002474 3300005536 Bacteria 14202
76 Ga0070697_100011291 3300005536 Bacteria 6979
77 Ga0070697_100072702 3300005536 Bacteria 2822
78 Ga0070697_100149187 3300005536 Bacteria 1970
79 Ga0070697_100273127 3300005536 Bacteria 1449
80 Ga0070672_100014446 3300005543 Bacteria 5596
81 Ga0070695_100002916 3300005545 Bacteria 9950
82 Ga0070695_100032715 3300005545 Bacteria 3251
83 Ga0070695_100101610 3300005545 Bacteria 1937
84 Ga0070695_100129751 3300005545 Bacteria 1736
85 Ga0070696_100051909 3300005546 Bacteria 2852
86 Ga0070696_100053187 3300005546 Bacteria 2818
87 Ga0070696_100105668 3300005546 Bacteria 2023
88 Ga0070696_100206869 3300005546 Bacteria 1467
89 Ga0070665_100024872 3300005548 Bacteria 6034
90 Ga0070665_100048334 3300005548 Unclassified 4272
91 Ga0070704_100001746 3300005549 Bacteria 11875
92 Ga0070704_100050812 3300005549 Bacteria 2916
93 Ga0068855_100015029 3300005563 Bacteria 9323
94 Ga0070664_100006273 3300005564 Bacteria 9594
95 Ga0070664_100083258 3300005564 Bacteria 2760
96 Ga0070664_100130786 3300005564 Bacteria 2205
97 Ga0070664_100434438 3300005564 Bacteria 1204
98 Ga0068857_100382290 3300005577 Bacteria 1308
99 Ga0068854_100033334 3300005578 Bacteria 3591
100 Ga0068854_100199415 3300005578 Bacteria 1572
101 Ga0068854_100263469 3300005578 Bacteria 1381
102 Ga0068856_100242711 3300005614 Bacteria 1817
103 Ga0068856_100462813 3300005614 Bacteria 1289
104 Ga0070702_100048276 3300005615 Bacteria 2422
105 Ga0070702_100077319 3300005615 Bacteria 1983
106 Ga0068859_100070805 3300005617 Bacteria 3523
107 Ga0068859_100206815 3300005617 Bacteria 2048
108 Ga0068864_100055360 3300005618 Bacteria 3424
109 Ga0068864_100397176 3300005618 Bacteria 1310
110 Ga0068861_100028995 3300005719 Bacteria 4043
111 Ga0068861_100069798 3300005719 Bacteria 2719
112 Ga0068870_10036290 3300005840 Bacteria 2535
113 Ga0068863_100197548 3300005841 Bacteria 1934
114 Ga0081455_10049841 3300005937 Bacteria 3607
115 Ga0081455_10101370 3300005937 Bacteria 2311
116 Ga0081538_10000130 3300005981 Bacteria 77384
117 Ga0081538_10000166 3300005981 Bacteria 70452
118 Ga0081538_10000397 3300005981 Bacteria 49637
119 Ga0081538_10001063 3300005981 Bacteria 29254
120 Ga0081538_10001996 3300005981 Bacteria 20387
121 Ga0081538_10002915 3300005981 Bacteria 16308
122 Ga0081538_10005724 3300005981 Bacteria 11105
123 Ga0081538_10007041 3300005981 Bacteria 9778
124 Ga0081538_10019712 3300005981 Bacteria 4995
125 Ga0081538_10023552 3300005981 Bacteria 4422
126 Ga0081538_10157643 3300005981 Bacteria 1015
127 Ga0081540_1000312 3300005983 Bacteria 50256
128 Ga0081539_10000834 3300005985 Bacteria 59270
129 Ga0081539_10049574 3300005985 Bacteria 2382
130 Ga0070717_10030825 3300006028 Bacteria 4310
131 Ga0070717_10038622 3300006028 Bacteria 3881
132 Ga0070717_10171288 3300006028 Bacteria 1888
133 Ga0070717_10191349 3300006028 Bacteria 1788
134 Ga0070717_10239486 3300006028 Bacteria 1599
135 Ga0070715_10230765 3300006163 Bacteria 957
136 Ga0070712_100059060 3300006175 Bacteria 2699
137 Ga0070712_100453489 3300006175 Bacteria 1068
138 Ga0075428_100096262 3300006844 Bacteria 3226
139 Ga0075430_100001684 3300006846 Bacteria 18072
140 Ga0075431_100016308 3300006847 Bacteria 7537
141 Ga0075431_100060288 3300006847 Bacteria 3915
142 Ga0075431_100152062 3300006847 Bacteria 2383
143 Ga0075431_100345614 3300006847 Bacteria 1496
144 Ga0075431_100448027 3300006847 Bacteria 1287
145 Ga0075433_10009170 3300006852 Bacteria 7904
146 Ga0075433_10021228 3300006852 Bacteria 5443
147 Ga0075433_10208829 3300006852 Bacteria 1735
148 Ga0075434_100007232 3300006871 Bacteria 10273
149 Ga0075434_100008914 3300006871 Bacteria 9339
150 Ga0075434_100040979 3300006871 Bacteria 4586
151 Ga0075434_100100122 3300006871 Bacteria 2904
152 Ga0075434_100281224 3300006871 Bacteria 1683
153 Ga0075429_100008628 3300006880 Bacteria 8866
154 Ga0075429_100032459 3300006880 Bacteria 4539
155 Ga0068865_100019229 3300006881 Bacteria 4419
156 Ga0068865_100190677 3300006881 Bacteria 1585
157 Ga0075436_100002771 3300006914 Bacteria 12020
158 Ga0075436_100003569 3300006914 Bacteria 10657
159 Ga0075436_100013469 3300006914 Bacteria 5598
160 Ga0075436_100031946 3300006914 Bacteria 3627
161 Ga0097620_100070804 3300006931 Bacteria 3523
162 Ga0097620_100206808 3300006931 Bacteria 2048
163 Ga0075435_100015658 3300007076 Bacteria 5705
164 Ga0075435_100067753 3300007076 Bacteria 2906
165 Ga0111539_10454590 3300009094 Bacteria 1491
166 Ga0111539_10555278 3300009094 Bacteria 1337
167 Ga0105245_10005059 3300009098 Bacteria 11597
168 Ga0105245_10025278 3300009098 Bacteria 5221
169 Ga0105245_10215935 3300009098 Bacteria 1848
170 Ga0105247_10064419 3300009101 Bacteria 2277
171 Ga0105247_10099751 3300009101 Bacteria 1855
172 Ga0114129_10001846 3300009147 Bacteria 28863
173 Ga0114129_10189642 3300009147 Bacteria 2793
174 Ga0114129_10240583 3300009147 Bacteria 2433
175 Ga0114129_10354223 3300009147 Bacteria 1944
176 Ga0114129_10478625 3300009147 Bacteria 1629
177 Ga0105243_10321343 3300009148 Bacteria 1410
178 Ga0105243_10325438 3300009148 Bacteria 1402
179 Ga0105241_10000819 3300009174 Bacteria 23602
180 Ga0105241_10110570 3300009174 Bacteria 2199
181 Ga0105241_10264063 3300009174 Bacteria 1464
182 Ga0105242_10353050 3300009176 Bacteria 1359
183 Ga0105248_10094900 3300009177 Bacteria 3358
184 Ga0105248_10170719 3300009177 Bacteria 2451
185 Ga0105238_10042579 3300009551 Bacteria 4597
186 Ga0105238_10273212 3300009551 Bacteria 1671
187 Ga0105238_10461196 3300009551 Bacteria 1268
188 Ga0105249_10236270 3300009553 Bacteria 1805
189 Ga0105239_10100195 3300010375 Bacteria 3204
190 Ga0105239_10176476 3300010375 Bacteria 2390
191 Ga0105246_10237278 3300011119 Bacteria 1439
192 Ga0157373_10019732 3300013100 Bacteria 4903
193 Ga0157369_10209786 3300013105 Bacteria 2042
194 Ga0157374_10003718 3300013296 Bacteria 12824
195 Ga0163162_10291284 3300013306 Bacteria 1764
196 Ga0157372_10068055 3300013307 Bacteria 4003
197 Ga0157372_10131678 3300013307 Bacteria 2877
198 Ga0157372_10245888 3300013307 Bacteria 2076
199 Ga0157372_10324528 3300013307 Bacteria 1792
200 Ga0157375_10154482 3300013308 Bacteria 2433
201 Ga0157375_10175263 3300013308 Unclassified 2294
202 Ga0157375_10261302 3300013308 Bacteria 1893
203 Ga0163163_10007693 3300014325 Bacteria 9521
204 Ga0157380_10260869 3300014326 Bacteria 1574
205 Ga0157380_10266859 3300014326 Bacteria 1558
206 Ga0157377_10000715 3300014745 Bacteria 13733
207 Ga0213873_10019484 3300021358 Unclassified 1574
208 Ga0213874_10002189 3300021377 Bacteria 4146
209 Ga0213874_10018003 3300021377 Bacteria 1904
210 Ga0213874_10042600 3300021377 Bacteria 1365
211 Ga0213876_10005977 3300021384 Bacteria 6653
212 Ga0213876_10024539 3300021384 Bacteria 3183
213 Ga0213876_10040542 3300021384 Bacteria 2460
214 Ga0213876_10044263 3300021384 Bacteria 2353
215 Ga0213876_10083327 3300021384 Bacteria 1692
216 Ga0213876_10098113 3300021384 Bacteria 1552
217 Ga0213875_10000489 3300021388 Bacteria 33592
218 Ga0213875_10008732 3300021388 Bacteria 5171
219 Ga0213875_10018257 3300021388 Bacteria 3382
220 Ga0207653_10000673 3300025885 Bacteria 11740
221 Ga0207692_10114175 3300025898 Bacteria 1502
222 Ga0207688_10016948 3300025901 Bacteria 3958
223 Ga0207647_10043107 3300025904 Bacteria 2825
224 Ga0207685_10165246 3300025905 Bacteria 1014
225 Ga0207699_10057637 3300025906 Bacteria 2320
226 Ga0207699_10191141 3300025906 Bacteria 1382
227 Ga0207645_10129736 3300025907 Bacteria 1640
228 Ga0207643_10005997 3300025908 Bacteria 6493
229 Ga0207643_10096876 3300025908 Bacteria 1726
230 Ga0207684_10017041 3300025910 Bacteria 6240
231 Ga0207684_10018417 3300025910 Bacteria 5978
232 Ga0207684_10192942 3300025910 Bacteria 1757
233 Ga0207684_10300751 3300025910 Bacteria 1383
234 Ga0207654_10050743 3300025911 Bacteria 2385
235 Ga0207654_10330116 3300025911 Bacteria 1045
236 Ga0207707_10007538 3300025912 Bacteria 9479
237 Ga0207707_10027870 3300025912 Bacteria 4939
238 Ga0207707_10237265 3300025912 Bacteria 1586
239 Ga0207695_10101226 3300025913 Bacteria 2876
240 Ga0207671_10016598 3300025914 Bacteria 5717
241 Ga0207693_10010955 3300025915 Bacteria 7346
242 Ga0207693_10105662 3300025915 Bacteria 2208
243 Ga0207663_10000013 3300025916 Bacteria 167304
244 Ga0207663_10120350 3300025916 Bacteria 1797
245 Ga0207663_10354964 3300025916 Bacteria 1111
246 Ga0207660_10390546 3300025917 Bacteria 1120
247 Ga0207662_10006657 3300025918 Bacteria 6245
248 Ga0207662_10012066 3300025918 Bacteria 4807
249 Ga0207662_10067733 3300025918 Bacteria 2154
250 Ga0207657_10313113 3300025919 Bacteria 1242
251 Ga0207649_10145168 3300025920 Bacteria 1628
252 Ga0207652_10062371 3300025921 Bacteria 3221
253 Ga0207646_10016789 3300025922 Bacteria 6867
254 Ga0207646_10074726 3300025922 Bacteria 3027
255 Ga0207646_10091693 3300025922 Bacteria 2719
256 Ga0207646_10111836 3300025922 Bacteria 2451
257 Ga0207646_10119541 3300025922 Bacteria 2367
258 Ga0207646_10149620 3300025922 Bacteria 2105
259 Ga0207681_10221124 3300025923 Bacteria 1465
260 Ga0207694_10006480 3300025924 Bacteria 8907
261 Ga0207659_10013263 3300025926 Bacteria 5272
262 Ga0207659_10051809 3300025926 Bacteria 2921
263 Ga0207659_10140001 3300025926 Bacteria 1877
264 Ga0207659_10348254 3300025926 Bacteria 1229
265 Ga0207687_10007130 3300025927 Bacteria 7370
266 Ga0207687_10100809 3300025927 Bacteria 2125
267 Ga0207687_10168088 3300025927 Bacteria 1689
268 Ga0207687_10255333 3300025927 Bacteria 1395
269 Ga0207700_10383568 3300025928 Bacteria 1229
270 Ga0207664_10034650 3300025929 Bacteria 3889
271 Ga0207664_10051825 3300025929 Bacteria 3243
272 Ga0207664_10069879 3300025929 Bacteria 2824
273 Ga0207664_10187626 3300025929 Bacteria 1778
274 Ga0207644_10017932 3300025931 Bacteria 4787
275 Ga0207690_10052493 3300025932 Bacteria 2731
276 Ga0207690_10069957 3300025932 Bacteria 2416
277 Ga0207706_10049916 3300025933 Bacteria 3697
278 Ga0207709_10142558 3300025935 Bacteria 1649
279 Ga0207709_10149936 3300025935 Bacteria 1614
280 Ga0207709_10252084 3300025935 Bacteria 1290
281 Ga0207670_10066320 3300025936 Bacteria 2480
282 Ga0207669_10016831 3300025937 Bacteria 3731
283 Ga0207704_10039874 3300025938 Bacteria 2739
284 Ga0207704_10272103 3300025938 Bacteria 1283
285 Ga0207704_10320849 3300025938 Bacteria 1195
286 Ga0207665_10004977 3300025939 Bacteria 8867
287 Ga0207691_10025709 3300025940 Bacteria 5526
288 Ga0207689_10028317 3300025942 Bacteria 4687
289 Ga0207661_10029418 3300025944 Bacteria 4219
290 Ga0207661_10085471 3300025944 Bacteria 2615
291 Ga0207679_10167001 3300025945 Bacteria 1808
292 Ga0207679_10235949 3300025945 Bacteria 1547
293 Ga0207679_10466307 3300025945 Bacteria 1122
294 Ga0207651_10060351 3300025960 Bacteria 2632
295 Ga0207651_10178769 3300025960 Unclassified 1681
296 Ga0207712_10093455 3300025961 Bacteria 2220
297 Ga0207668_10006461 3300025972 Bacteria 6931
298 Ga0207640_10024254 3300025981 Bacteria 3658
299 Ga0207677_10013980 3300026023 Bacteria 4670
300 Ga0207677_10104821 3300026023 Bacteria 2091
301 Ga0207677_10330881 3300026023 Bacteria 1269
302 Ga0207703_10133027 3300026035 Bacteria 2150
303 Ga0207639_10032142 3300026041 Bacteria 3862
304 Ga0207639_10222912 3300026041 Bacteria 1630
305 Ga0207678_10139950 3300026067 Bacteria 2065
306 Ga0207708_10000257 3300026075 Bacteria 41841
307 Ga0207708_10009817 3300026075 Bacteria 7102
308 Ga0207702_10033362 3300026078 Bacteria 4300
309 Ga0207702_10444809 3300026078 Bacteria 1257
310 Ga0207648_10041843 3300026089 Bacteria 4024
311 Ga0207648_10130470 3300026089 Unclassified 2212
312 Ga0207648_10350182 3300026089 Bacteria 1331
313 Ga0207676_10240632 3300026095 Bacteria 1623
314 Ga0207676_10247631 3300026095 Bacteria 1602
315 Ga0207676_10364453 3300026095 Bacteria 1340
316 Ga0207674_10039374 3300026116 Bacteria 4900
317 Ga0207675_100085335 3300026118 Unclassified 2963
318 Ga0207675_100142254 3300026118 Bacteria 2279
319 Ga0207683_10040546 3300026121 Bacteria 4064
320 Ga0207683_10198530 3300026121 Bacteria 1823
321 Ga0207683_10383839 3300026121 Bacteria 1291
322 Ga0209974_10021010 3300027876 Bacteria 2164
323 Ga0207428_10032191 3300027907 Bacteria 4316
324 Ga0268265_10287673 3300028380 Bacteria 1474
325 Ga0268264_10260295 3300028381 Bacteria 1616
326 Ga0307408_100007084 3300031548 Bacteria 7420
327 Ga0307408_100298555 3300031548 Bacteria 1348
328 Ga0307405_10101384 3300031731 Bacteria 1931
329 Ga0307405_10231712 3300031731 Bacteria 1362
330 Ga0307413_10003313 3300031824 Bacteria 6761
331 Ga0307413_10005994 3300031824 Bacteria 5500
332 Ga0307413_10010664 3300031824 Bacteria 4473
333 Ga0307413_10023621 3300031824 Bacteria 3334
334 Ga0307413_10069156 3300031824 Bacteria 2215
335 Ga0307413_10116580 3300031824 Bacteria 1800
336 Ga0307410_10002120 3300031852 Bacteria 9423
337 Ga0307410_10008345 3300031852 Bacteria 5739
338 Ga0307410_10075382 3300031852 Bacteria 2351
339 Ga0307410_10397135 3300031852 Bacteria 1113
340 Ga0307406_10013564 3300031901 Bacteria 4671
341 Ga0307406_10018309 3300031901 Bacteria 4090
342 Ga0307406_10019623 3300031901 Bacteria 3970
343 Ga0307406_10088409 3300031901 Bacteria 2079
344 Ga0307406_10098762 3300031901 Bacteria 1983
345 Ga0307407_10000365 3300031903 Bacteria 13609
346 Ga0307407_10017741 3300031903 Bacteria 3581
347 Ga0307407_10045573 3300031903 Bacteria 2479
348 Ga0307412_10012073 3300031911 Bacteria 5022
349 Ga0307412_10119683 3300031911 Bacteria 1894
350 Ga0307412_10155883 3300031911 Bacteria 1690
351 Ga0307412_10176909 3300031911 Bacteria 1601
352 Ga0307409_100028300 3300031995 Bacteria 3990
353 Ga0307409_100072010 3300031995 Bacteria 2750
354 Ga0307409_100076838 3300031995 Bacteria 2679
355 Ga0307409_100089606 3300031995 Bacteria 2515
356 Ga0307409_100107376 3300031995 Bacteria 2332
357 Ga0307409_100143622 3300031995 Bacteria 2060
358 Ga0307409_100194779 3300031995 Bacteria 1807
359 Ga0307409_100294754 3300031995 Bacteria 1506
360 Ga0307409_100507610 3300031995 Bacteria 1175
361 Ga0307416_100007077 3300032002 Bacteria 7087
362 Ga0307416_100020144 3300032002 Bacteria 4751
363 Ga0307416_100035292 3300032002 Bacteria 3817
364 Ga0307416_100054436 3300032002 Bacteria 3216
365 Ga0307416_100126698 3300032002 Bacteria 2288
366 Ga0307416_100220950 3300032002 Bacteria 1817
367 Ga0307416_100493735 3300032002 Bacteria 1287
368 Ga0307416_100786573 3300032002 Bacteria 1046
369 Ga0307414_10007290 3300032004 Bacteria 6213
370 Ga0307414_10015852 3300032004 Bacteria 4563
371 Ga0307414_10101661 3300032004 Bacteria 2165
372 Ga0307414_10106276 3300032004 Bacteria 2124
373 Ga0307414_10140624 3300032004 Bacteria 1889
374 Ga0307411_10005247 3300032005 Bacteria 6341
375 Ga0307411_10005784 3300032005 Bacteria 6119
376 Ga0307411_10030533 3300032005 Bacteria 3304
377 Ga0307411_10065423 3300032005 Bacteria 2438
378 Ga0307411_10156123 3300032005 Bacteria 1702
379 Ga0307415_100003370 3300032126 Bacteria 8123
380 Ga0307415_100004139 3300032126 Bacteria 7480
381 Ga0307415_100006864 3300032126 Bacteria 6180
382 Ga0307415_100012760 3300032126 Bacteria 4872
383 Ga0307415_100023467 3300032126 Bacteria 3830
384 Ga0307415_100036636 3300032126 Bacteria 3216
385 Ga0307415_100045822 3300032126 Bacteria 2935
386 Ga0307415_100111941 3300032126 Bacteria 2027
387 Ga0307415_100169276 3300032126 Bacteria 1702
388 Ga0307415_100279934 3300032126 Bacteria 1371
389 Ga0316583_10017753 3300032133 Unclassified 2556
390 Ga0316585_10018038 3300032137 Bacteria 2138
391 Ga0316580_10001971 3300032139 Bacteria 5541
392 Ga0316586_1001804 3300033527 Bacteria 2554
393 Ga0316588_1000531 3300033528 Bacteria 5285
394 Ga0316596_1001794 3300033541 Bacteria 4463
395 Ga0373928_0044466 3300035084 Bacteria 1031
396 Ga0373933_0088871 3300035724 Bacteria 1904
397 Ga0373947_0231890 3300035725 Bacteria 1216
398 Ga0373937_0173995 3300036401 Bacteria 2020
399 Ga0316582_0016264 3300036647 Bacteria 4275
400 Ga0316584_0049452 3300036712 Unclassified 3142
401 Ga0316584_0064424 3300036712 Bacteria 2744
402 Ga0395898_0105304 3300037466 Bacteria 2705
403 Ga0395898_0312265 3300037466 Bacteria 1500
404 Ga0316581_0010150 3300037588 Unclassified 2605
405 Ga0436364_0023787 3300037853 Bacteria 12096
406 Ga0436364_0080477 3300037853 Bacteria 33606
407 Ga0436364_0261392 3300037853 Bacteria 14425
408 Ga0436364_0362464 3300037853 Bacteria 14566
409 Ga0436364_1066317 3300037853 Bacteria 3638
410 Ga0436364_1441187 3300037853 Bacteria 9459
411 Ga0395901_0043363 3300038443 Bacteria 4667
412 Ga0395901_0226213 3300038443 Bacteria 1954
413 Ga0395901_0306355 3300038443 Bacteria 1646
414 Ga0395901_0479302 3300038443 Bacteria 1269
415 Ga0436365_0055247 3300039437 Bacteria 8168
416 Ga0436365_0389546 3300039437 Bacteria 6847
417 Ga0436365_0584563 3300039437 Bacteria 13176
418 Ga0436365_0704878 3300039437 Bacteria 5946
419 Ga0436365_0921647 3300039437 Bacteria 2756
420 Ga0436365_0948346 3300039437 Bacteria 2774
421 Ga0436365_0967629 3300039437 Bacteria 1894
422 Ga0436365_1328609 3300039437 Bacteria 20534
423 Ga0436365_1354231 3300039437 Bacteria 2780
424 Ga0436361_0064816 3300039447 Bacteria 1988
425 Ga0436361_1095720 3300039447 Bacteria 1432
426 Ga0436363_0168903 3300039450 Bacteria 5003
427 Ga0436363_0228184 3300039450 Bacteria 55094
428 Ga0436363_1038972 3300039450 Bacteria 1521
429 Ga0436362_0715185 3300039453 Unclassified 1179
430 Ga0436362_0734465 3300039453 Unclassified 1651
431 Ga0436362_0751876 3300039453 Bacteria 1346
432 Ga0439448_0059692 3300042005 Bacteria 1259
433 Ga0439446_0024101 3300042156 Bacteria 1734
434 Ga0451577_0015422 3300042876 Bacteria 7111
435 Ga0466963_0045988 3300044694 Bacteria 2876
436 Ga0466963_0149373 3300044694 Bacteria 1622
437 Ga0466963_0190117 3300044694 Bacteria 1434
438 Ga0466963_0378353 3300044694 Bacteria 998
439 Ga0466964_0100542 3300044706 Unclassified 1274
440 Ga0453684_0597156 3300044712 Bacteria 1210
441 Ga0466968_0048369 3300044735 Bacteria 1810
442 Ga0466957_0062449 3300044842 Bacteria 2288
443 Ga0466960_0054630 3300044901 Bacteria 1940
444 Ga0466960_0079104 3300044901 Bacteria 1653
445 Ga0466959_0013796 3300045049 Bacteria 5867
446 Ga0466958_0039660 3300045836 Bacteria 2830
447 Ga0466958_0152054 3300045836 Bacteria 1460
448 Ga0466967_0005851 3300045976 Bacteria 8605
449 Ga0466967_0011433 3300045976 Bacteria 6722
450 Ga0466967_0053988 3300045976 Bacteria 3534
451 Ga0466967_0068010 3300045976 Bacteria 3179
452 Ga0466967_0118490 3300045976 Bacteria 2442
453 Ga0466967_0157696 3300045976 Bacteria 2128
454 Ga0466967_0248390 3300045976 Bacteria 1699
455 Ga0495603_0021750 3300046455 Bacteria 3884
456 Ga0495590_0047214 3300046457 Bacteria 1502
457 Ga0495651_0046284 3300046462 Bacteria 3367
458 Ga0495653_0142859 3300046463 Bacteria 1681
459 Ga0495639_0081044 3300046475 Bacteria 1512
460 Ga0495620_0059435 3300046515 Bacteria 1598
461 Ga0495644_0026093 3300046523 Bacteria 2218
462 Ga0495644_0095360 3300046523 Bacteria 1124
463 Ga0495598_0017143 3300046537 Bacteria 1862
464 Ga0495667_0059857 3300046559 Bacteria 2499
465 Ga0495667_0069322 3300046559 Bacteria 2301
466 Ga0495634_0045211 3300046642 Bacteria 2978
467 Ga0495646_0052715 3300046680 Bacteria 2456
468 Ga0495604_0280835 3300047317 Bacteria 1125
469 Ga0495676_0094111 3300047321 Bacteria 2233
470 Ga0495680_0009148 3300047322 Bacteria 8938
471 Ga0495675_0077405 3300047444 Bacteria 2096
472 Ga0495602_0022121 3300048088 Bacteria 6231
473 Ga0496100_0003847 3300048903 Bacteria 7872
474 Ga0496100_0027176 3300048903 Bacteria 3517
475 Ga0496102_0004626 3300048905 Bacteria 11646
476 Ga0496102_0005252 3300048905 Bacteria 10996
477 Ga0496102_0011053 3300048905 Bacteria 7776
478 Ga0496102_0169432 3300048905 Bacteria 2056
479 Ga0496102_0294530 3300048905 Bacteria 1529
480 Ga0496103_0031546 3300048906 Bacteria 3229
481 Ga0496103_0032176 3300048906 Bacteria 3200
482 Ga0496104_0006563 3300048907 Bacteria 10233
483 Ga0496104_0171383 3300048907 Bacteria 2081
484 Ga0496104_0179504 3300048907 Bacteria 2027
485 Ga0496104_0605666 3300048907 Bacteria 1006
486 Ga0496105_0018078 3300048908 Bacteria 5659
487 Ga0496105_0062243 3300048908 Bacteria 3079
488 Ga0496105_0122054 3300048908 Bacteria 2148
489 Ga0496106_0008301 3300048909 Bacteria 7684
490 Ga0496106_0009469 3300048909 Bacteria 7200
491 Ga0496106_0021141 3300048909 Bacteria 4832
492 Ga0496106_0024483 3300048909 Bacteria 4489
493 Ga0496106_0036389 3300048909 Unclassified 3683
494 Ga0496106_0118714 3300048909 Bacteria 2065
495 Ga0496107_0038027 3300048910 Bacteria 3455
496 Ga0496107_0067677 3300048910 Bacteria 2592
497 Ga0496108_0000573 3300048911 Bacteria 28745
498 Ga0496108_0002818 3300048911 Bacteria 13951
499 Ga0496108_0009182 3300048911 Bacteria 8002
500 Ga0496108_0017377 3300048911 Bacteria 5885
501 Ga0496108_0203327 3300048911 Bacteria 1719
502 Ga0496109_0001860 3300048912 Bacteria 17485
503 Ga0496109_0009285 3300048912 Bacteria 8379
504 Ga0496109_0028948 3300048912 Bacteria 4959
505 Ga0496109_0099360 3300048912 Bacteria 2699
506 Ga0496109_0151826 3300048912 Bacteria 2169
507 Ga0496109_0153097 3300048912 Bacteria 2159
508 Ga0496109_0339659 3300048912 Bacteria 1418
509 Ga0496109_0418323 3300048912 Bacteria 1266
510 Ga0496110_0002244 3300048913 Bacteria 14455
511 Ga0496110_0008506 3300048913 Bacteria 8265
512 Ga0496110_0027347 3300048913 Bacteria 4889
513 Ga0496110_0267129 3300048913 Bacteria 1557
514 Ga0496111_0008393 3300048914 Bacteria 6833
515 Ga0496111_0018570 3300048914 Bacteria 4818
516 Ga0496111_0037656 3300048914 Bacteria 3462
517 Ga0496111_0392767 3300048914 Bacteria 1025
518 Ga0496112_0005731 3300048915 Bacteria 10793
519 Ga0496112_0023090 3300048915 Bacteria 5937
520 Ga0496112_0083661 3300048915 Bacteria 3156
521 Ga0496112_0203869 3300048915 Bacteria 1936
522 Ga0496112_0315461 3300048915 Bacteria 1508
523 Ga0496112_0374984 3300048915 Bacteria 1364
524 Ga0496112_0376235 3300048915 Bacteria 1361
525 Ga0496113_0005440 3300048916 Bacteria 7941
526 Ga0496113_0013328 3300048916 Bacteria 5564
527 Ga0496113_0018413 3300048916 Bacteria 4863
528 Ga0496113_0020573 3300048916 Bacteria 4641
529 Ga0496114_0041119 3300048917 Bacteria 3831
530 Ga0496114_0242343 3300048917 Bacteria 1586
531 Ga0496115_0030347 3300048918 Bacteria 4252
532 Ga0496115_0313418 3300048918 Bacteria 1284
533 Ga0501031_0082483 3300049568 Bacteria 2096
534 Ga0501031_0110641 3300049568 Bacteria 1794
535 Ga0501031_0144355 3300049568 Bacteria 1555
536 Ga0501031_0146086 3300049568 Bacteria 1545
537 Ga0501036_0043411 3300049572 Bacteria 3808
538 Ga0501036_0064680 3300049572 Bacteria 3096
539 Ga0501036_0066588 3300049572 Bacteria 3048
540 Ga0501036_0203405 3300049572 Bacteria 1665
541 Ga0501036_0288928 3300049572 Bacteria 1372
542 Ga0501036_0460090 3300049572 Bacteria 1060
543 Ga0501038_0179467 3300049574 Bacteria 1709
544 Ga0501038_0227993 3300049574 Bacteria 1484
545 Ga0501039_0117098 3300049575 Bacteria 2086
546 Ga0501039_0121935 3300049575 Bacteria 2043
547 Ga0501039_0208567 3300049575 Bacteria 1536
548 Ga0501040_0040738 3300049576 Bacteria 3162
549 Ga0501040_0139109 3300049576 Bacteria 1710
550 Ga0501041_0015563 3300049577 Bacteria 4518
551 Ga0501041_0037803 3300049577 Bacteria 2926
552 Ga0501041_0065931 3300049577 Bacteria 2218
553 Ga0501041_0112457 3300049577 Bacteria 1689
554 Ga0501042_0040659 3300049578 Bacteria 3305
555 Ga0501042_0274936 3300049578 Bacteria 1216
556 Ga0501042_0337601 3300049578 Bacteria 1089
557 Ga0501043_0125814 3300049579 Bacteria 2010
558 Ga0501046_0070219 3300049580 Bacteria 2724
559 Ga0501046_0113682 3300049580 Bacteria 2066
560 Ga0501046_0244268 3300049580 Bacteria 1323
561 Ga0501048_0031054 3300049582 Bacteria 3866
562 Ga0501048_0047823 3300049582 Bacteria 3052
563 Ga0501048_0052512 3300049582 Bacteria 2901
564 Ga0501048_0160026 3300049582 Bacteria 1593
565 Ga0501070_0086833 3300049586 Bacteria 2590
566 Ga0501071_0041172 3300049587 Bacteria 3308
567 Ga0501071_0063833 3300049587 Bacteria 2671
568 Ga0501071_0130282 3300049587 Bacteria 1868
569 Ga0501072_0075375 3300049588 Bacteria 2668
570 Ga0501072_0177371 3300049588 Bacteria 1699
571 Ga0501072_0317283 3300049588 Bacteria 1238
572 Ga0501074_0035590 3300049590 Bacteria 3608
573 Ga0501074_0182633 3300049590 Bacteria 1496
574 Ga0501075_0023662 3300049591 Bacteria 4499
575 Ga0501075_0038529 3300049591 Bacteria 3574
576 Ga0501075_0372436 3300049591 Bacteria 1088
577 Ga0501076_0016112 3300049592 Bacteria 5659
578 Ga0501076_0061506 3300049592 Bacteria 2988
579 Ga0501076_0080238 3300049592 Bacteria 2619
580 Ga0501077_0000553 3300049593 Bacteria 22727
581 Ga0501077_0034611 3300049593 Bacteria 3215
582 Ga0501077_0043769 3300049593 Bacteria 2845
583 Ga0501077_0158997 3300049593 Bacteria 1434
584 Ga0501079_0001648 3300049741 Bacteria 15901
585 Ga0501079_0061024 3300049741 Bacteria 2909
586 Ga0501079_0070873 3300049741 Bacteria 2692
587 Ga0501079_0259707 3300049741 Bacteria 1358
588 Ga0501079_0323960 3300049741 Bacteria 1206
589 Ga0501079_0500986 3300049741 Bacteria 955
590 Ga0501080_0075688 3300049742 Bacteria 3131
591 Ga0501080_0165791 3300049742 Bacteria 2039
592 Ga0501081_0017392 3300049743 Bacteria 4758
593 Ga0501081_0043289 3300049743 Bacteria 3088
594 Ga0501081_0093948 3300049743 Bacteria 2112
595 Ga0501081_0106725 3300049743 Bacteria 1985
596 Ga0501081_0205970 3300049743 Bacteria 1427
597 Ga0501083_0093445 3300049744 Bacteria 1986
598 Ga0501035_0120353 3300049822 Bacteria 2296
599 Ga0501035_0460274 3300049822 Bacteria 1051
600 Ga0501044_0541499 3300049823 Bacteria 1062
601 Ga0501045_0003788 3300049824 Bacteria 10401
602 Ga0501045_0056067 3300049824 Bacteria 2882
603 Ga0501045_0065218 3300049824 Bacteria 2674
604 Ga0501045_0075778 3300049824 Bacteria 2478
605 Ga0501045_0110169 3300049824 Bacteria 2041
606 nmdc:mga05p37_135622_c1 3300050507 Bacteria 3019
607 nmdc:mga05p37_1741_c1 3300050507 Bacteria 25395
608 nmdc:mga05p37_239754_c1 3300050507 Bacteria 2181
609 nmdc:mga05p37_276592_c1 3300050507 Bacteria 2004
610 nmdc:mga05p37_579601_c1 3300050507 Bacteria 1271
611 nmdc:mga09592_33430_c1 3300050508 Bacteria 4292
612 nmdc:mga09592_47038_c1 3300050508 Bacteria 3635
613 nmdc:mga0qj67_177354_c1 3300050509 Bacteria 1730
614 nmdc:mga0qj67_3328_c1 3300050509 Bacteria 11591
615 nmdc:mga06r32_154233_c1 3300050510 Bacteria 2277
616 nmdc:mga06r32_84409_c1 3300050510 Bacteria 3095
617 nmdc:mga08y16_118592_c1 3300050511 Bacteria 2754
618 nmdc:mga08y16_220440_c1 3300050511 Bacteria 1964
619 nmdc:mga08y16_46325_c1 3300050511 Bacteria 4552
620 nmdc:mga0n895_1181_c1 3300050512 Bacteria 19181
621 nmdc:mga0n895_141813_c1 3300050512 Bacteria 2432
622 nmdc:mga0n895_15839_c1 3300050512 Bacteria 6894
623 nmdc:mga0n895_185191_c1 3300050512 Bacteria 2113
624 nmdc:mga0n895_5310_c1 3300050512 Bacteria 10734
625 nmdc:mga0n895_54971_c1 3300050512 Bacteria 3917
626 nmdc:mga0rr50_219677_c1 3300050513 Bacteria 1569
627 nmdc:mga0rr50_89055_c1 3300050513 Bacteria 2399
628 nmdc:mga08x19_1619_c1 3300050514 Bacteria 13966
629 nmdc:mga08x19_16936_c1 3300050514 Bacteria 4453
630 nmdc:mga08x19_2161_c1 3300050514 Bacteria 12011
631 nmdc:mga0a205_107473_c1 3300050515 Bacteria 2688
632 nmdc:mga0a205_212998_c1 3300050515 Bacteria 1820
633 nmdc:mga0a205_41327_c1 3300050515 Bacteria 4440
634 nmdc:mga0a205_9241_c1 3300050515 Bacteria 9001
635 Ga0495619_0381433 3300053085 Bacteria 974
636 Ga0501084_0009717 3300054114 Bacteria 7956
637 Ga0501084_0043566 3300054114 Bacteria 3754
638 Ga0501084_0047307 3300054114 Bacteria 3603
639 Ga0501084_0137539 3300054114 Bacteria 2056
640 Ga0501084_0153716 3300054114 Bacteria 1940
641 Ga0501084_0302751 3300054114 Bacteria 1350
642 Ga0590071_000626 3300059421 Bacteria 10082
643 Ga0590074_004112 3300059423 Bacteria 2405
644 Ga0590075_010033 3300059424 Bacteria 2276
645 Ga0501082_0025647 3300060353 Bacteria 5079
646 Ga0501082_0037208 3300060353 Bacteria 4194
647 Ga0501082_0293538 3300060353 Bacteria 1415
648 Ga0530510_0006393 3300061734 Bacteria 8202
649 Ga0307405_10025884
650 JGI25406J46586_10018614
651 JGI25407J50210_10009953
652 JGI25407J50210_10016336
653 Ga0065715_10097151
654 Ga0070683_100143308
655 Ga0070690_100047574
656 Ga0070680_100225072
657 Ga0070680_100273016
658 Ga0070682_100051109
659 Ga0068868_100206400
660 Ga0070691_10065332
661 Ga0070691_10227584
662 Ga0070661_100148558
663 Ga0070692_10172837
664 Ga0070668_100001268
665 Ga0070669_100192010
666 Ga0070675_100007432
667 Ga0070675_100041830
668 Ga0070675_100306549
669 Ga0070675_100371242
670 Ga0070671_100001656
671 Ga0070674_100019833
672 Ga0070673_100061268
673 Ga0070673_100062862
674 Ga0070688_100070268
675 Ga0070659_100096789
676 Ga0070659_100171244
677 Ga0070703_10072843
678 Ga0070709_10060890
679 Ga0070714_100013874
680 Ga0070714_100056063
681 Ga0070714_100096891
682 Ga0070714_100328678
683 Ga0070713_100044586
684 Ga0070710_10022827
685 Ga0070701_10016453
686 Ga0070711_100000009
687 Ga0070711_100112336
688 Ga0070705_100006149
689 Ga0070705_100051932
690 Ga0070700_100008549
691 Ga0070694_100021428
692 Ga0070694_100047260
693 Ga0070708_100006105
694 Ga0070708_100036493
695 Ga0070708_100098616
696 Ga0070708_100219825
697 Ga0070708_100321081
698 Ga0070678_100114841
699 Ga0070681_10144997
700 Ga0068867_100089947
701 Ga0068867_100166256
702 Ga0070685_10095038
703 Ga0070706_100010912
704 Ga0070706_100043772
705 Ga0070706_100054048
706 Ga0070706_100237926
707 Ga0070706_100647075
708 Ga0070707_100001686
709 Ga0070707_100010894
710 Ga0070707_100106639
711 Ga0070707_100336128
712 Ga0070698_100000520
713 Ga0070698_100127792
714 Ga0070699_100000926
715 Ga0070699_100009620
716 Ga0070699_100024148
717 Ga0070699_100030106
718 Ga0070699_100035792
719 Ga0070679_100158858
720 Ga0070684_100064120
721 Ga0070684_100071154
722 Ga0070684_100147679
723 Ga0070697_100002474
724 Ga0070697_100011291
725 Ga0070697_100072702
726 Ga0070697_100149187
727 Ga0070697_100273127
728 Ga0070672_100014446
729 Ga0070695_100002916
730 Ga0070695_100032715
731 Ga0070695_100101610
732 Ga0070695_100129751
733 Ga0070696_100051909
734 Ga0070696_100053187
735 Ga0070696_100105668
736 Ga0070696_100206869
737 Ga0070665_100024872
738 Ga0070665_100048334
739 Ga0070704_100001746
740 Ga0070704_100050812
741 Ga0068855_100015029
742 Ga0070664_100006273
743 Ga0070664_100083258
744 Ga0070664_100130786
745 Ga0070664_100434438
746 Ga0068857_100382290
747 Ga0068854_100033334
748 Ga0068854_100199415
749 Ga0068854_100263469
750 Ga0068856_100242711
751 Ga0068856_100462813
752 Ga0070702_100048276
753 Ga0070702_100077319
754 Ga0068859_100070805
755 Ga0068859_100206815
756 Ga0068864_100055360
757 Ga0068864_100397176
758 Ga0068861_100028995
759 Ga0068861_100069798
760 Ga0068870_10036290
761 Ga0068863_100197548
762 Ga0081455_10049841
763 Ga0081455_10101370
764 Ga0081538_10000130
765 Ga0081538_10000166
766 Ga0081538_10000397
767 Ga0081538_10001063
768 Ga0081538_10001996
769 Ga0081538_10002915
770 Ga0081538_10005724
771 Ga0081538_10007041
772 Ga0081538_10019712
773 Ga0081538_10023552
774 Ga0081538_10157643
775 Ga0081540_1000312
776 Ga0081539_10000834
777 Ga0081539_10049574
778 Ga0070717_10030825
779 Ga0070717_10038622
780 Ga0070717_10171288
781 Ga0070717_10191349
782 Ga0070717_10239486
783 Ga0070715_10230765
784 Ga0070712_100059060
785 Ga0070712_100453489
786 Ga0075428_100096262
787 Ga0075430_100001684
788 Ga0075431_100016308
789 Ga0075431_100060288
790 Ga0075431_100152062
791 Ga0075431_100345614
792 Ga0075431_100448027
793 Ga0075433_10009170
794 Ga0075433_10021228
795 Ga0075433_10208829
796 Ga0075434_100007232
797 Ga0075434_100008914
798 Ga0075434_100040979
799 Ga0075434_100100122
800 Ga0075434_100281224
801 Ga0075429_100008628
802 Ga0075429_100032459
803 Ga0068865_100019229
804 Ga0068865_100190677
805 Ga0075436_100002771
806 Ga0075436_100003569
807 Ga0075436_100013469
808 Ga0075436_100031946
809 Ga0097620_100070804
810 Ga0097620_100206808
811 Ga0075435_100015658
812 Ga0075435_100067753
813 Ga0111539_10454590
814 Ga0111539_10555278
815 Ga0105245_10005059
816 Ga0105245_10025278
817 Ga0105245_10215935
818 Ga0105247_10064419
819 Ga0105247_10099751
820 Ga0114129_10001846
821 Ga0114129_10189642
822 Ga0114129_10240583
823 Ga0114129_10354223
824 Ga0114129_10478625
825 Ga0105243_10321343
826 Ga0105243_10325438
827 Ga0105241_10000819
828 Ga0105241_10110570
829 Ga0105241_10264063
830 Ga0105242_10353050
831 Ga0105248_10094900
832 Ga0105248_10170719
833 Ga0105238_10042579
834 Ga0105238_10273212
835 Ga0105238_10461196
836 Ga0105249_10236270
837 Ga0105239_10100195
838 Ga0105239_10176476
839 Ga0105246_10237278
840 Ga0157373_10019732
841 Ga0157369_10209786
842 Ga0157374_10003718
843 Ga0163162_10291284
844 Ga0157372_10068055
845 Ga0157372_10131678
846 Ga0157372_10245888
847 Ga0157372_10324528
848 Ga0157375_10154482
849 Ga0157375_10175263
850 Ga0157375_10261302
851 Ga0163163_10007693
852 Ga0157380_10260869
853 Ga0157380_10266859
854 Ga0157377_10000715
855 Ga0213873_10019484
856 Ga0213874_10002189
857 Ga0213874_10018003
858 Ga0213874_10042600
859 Ga0213876_10005977
860 Ga0213876_10024539
861 Ga0213876_10040542
862 Ga0213876_10044263
863 Ga0213876_10083327
864 Ga0213876_10098113
865 Ga0213875_10000489
866 Ga0213875_10008732
867 Ga0213875_10018257
868 Ga0207653_10000673
869 Ga0207692_10114175
870 Ga0207688_10016948
871 Ga0207647_10043107
872 Ga0207685_10165246
873 Ga0207699_10057637
874 Ga0207699_10191141
875 Ga0207645_10129736
876 Ga0207643_10005997
877 Ga0207643_10096876
878 Ga0207684_10017041
879 Ga0207684_10018417
880 Ga0207684_10192942
881 Ga0207684_10300751
882 Ga0207654_10050743
883 Ga0207654_10330116
884 Ga0207707_10007538
885 Ga0207707_10027870
886 Ga0207707_10237265
887 Ga0207695_10101226
888 Ga0207671_10016598
889 Ga0207693_10010955
890 Ga0207693_10105662
891 Ga0207663_10000013
892 Ga0207663_10120350
893 Ga0207663_10354964
894 Ga0207660_10390546
895 Ga0207662_10006657
896 Ga0207662_10012066
897 Ga0207662_10067733
898 Ga0207657_10313113
899 Ga0207649_10145168
900 Ga0207652_10062371
901 Ga0207646_10016789
902 Ga0207646_10074726
903 Ga0207646_10091693
904 Ga0207646_10111836
905 Ga0207646_10119541
906 Ga0207646_10149620
907 Ga0207681_10221124
908 Ga0207694_10006480
909 Ga0207659_10013263
910 Ga0207659_10051809
911 Ga0207659_10140001
912 Ga0207659_10348254
913 Ga0207687_10007130
914 Ga0207687_10100809
915 Ga0207687_10168088
916 Ga0207687_10255333
917 Ga0207700_10383568
918 Ga0207664_10034650
919 Ga0207664_10051825
920 Ga0207664_10069879
921 Ga0207664_10187626
922 Ga0207644_10017932
923 Ga0207690_10052493
924 Ga0207690_10069957
925 Ga0207706_10049916
926 Ga0207709_10142558
927 Ga0207709_10149936
928 Ga0207709_10252084
929 Ga0207670_10066320
930 Ga0207669_10016831
931 Ga0207704_10039874
932 Ga0207704_10272103
933 Ga0207704_10320849
934 Ga0207665_10004977
935 Ga0207691_10025709
936 Ga0207689_10028317
937 Ga0207661_10029418
938 Ga0207661_10085471
939 Ga0207679_10167001
940 Ga0207679_10235949
941 Ga0207679_10466307
942 Ga0207651_10060351
943 Ga0207651_10178769
944 Ga0207712_10093455
945 Ga0207668_10006461
946 Ga0207640_10024254
947 Ga0207677_10013980
948 Ga0207677_10104821
949 Ga0207677_10330881
950 Ga0207703_10133027
951 Ga0207639_10032142
952 Ga0207639_10222912
953 Ga0207678_10139950
954 Ga0207708_10000257
955 Ga0207708_10009817
956 Ga0207702_10033362
957 Ga0207702_10444809
958 Ga0207648_10041843
959 Ga0207648_10130470
960 Ga0207648_10350182
961 Ga0207676_10240632
962 Ga0207676_10247631
963 Ga0207676_10364453
964 Ga0207674_10039374
965 Ga0207675_100085335
966 Ga0207675_100142254
967 Ga0207683_10040546
968 Ga0207683_10198530
969 Ga0207683_10383839
970 Ga0209974_10021010
971 Ga0207428_10032191
972 Ga0268265_10287673
973 Ga0268264_10260295
974 Ga0307408_100007084
975 Ga0307408_100298555
976 Ga0307405_10101384
977 Ga0307405_10231712
978 Ga0307413_10003313
979 Ga0307413_10005994
980 Ga0307413_10010664
981 Ga0307413_10023621
982 Ga0307413_10069156
983 Ga0307413_10116580
984 Ga0307410_10002120
985 Ga0307410_10008345
986 Ga0307410_10075382
987 Ga0307410_10397135
988 Ga0307406_10013564
989 Ga0307406_10018309
990 Ga0307406_10019623
991 Ga0307406_10088409
992 Ga0307406_10098762
993 Ga0307407_10000365
994 Ga0307407_10017741
995 Ga0307407_10045573
996 Ga0307412_10012073
997 Ga0307412_10119683
998 Ga0307412_10155883
999 Ga0307412_10176909
1000 Ga0307409_100028300
1001 Ga0307409_100072010
1002 Ga0307409_100076838
1003 Ga0307409_100089606
1004 Ga0307409_100107376
1005 Ga0307409_100143622
1006 Ga0307409_100194779
1007 Ga0307409_100294754
1008 Ga0307409_100507610
1009 Ga0307416_100007077
1010 Ga0307416_100020144
1011 Ga0307416_100035292
1012 Ga0307416_100054436
1013 Ga0307416_100126698
1014 Ga0307416_100220950
1015 Ga0307416_100493735
1016 Ga0307416_100786573
1017 Ga0307414_10007290
1018 Ga0307414_10015852
1019 Ga0307414_10101661
1020 Ga0307414_10106276
1021 Ga0307414_10140624
1022 Ga0307411_10005247
1023 Ga0307411_10005784
1024 Ga0307411_10030533
1025 Ga0307411_10065423
1026 Ga0307411_10156123
1027 Ga0307415_100003370
1028 Ga0307415_100004139
1029 Ga0307415_100006864
1030 Ga0307415_100012760
1031 Ga0307415_100023467
1032 Ga0307415_100036636
1033 Ga0307415_100045822
1034 Ga0307415_100111941
1035 Ga0307415_100169276
1036 Ga0307415_100279934
1037 Ga0316583_10017753
1038 Ga0316585_10018038
1039 Ga0316580_10001971
1040 Ga0316586_1001804
1041 Ga0316588_1000531
1042 Ga0316596_1001794
1043 Ga0373928_0044466
1044 Ga0373933_0088871
1045 Ga0373947_0231890
1046 Ga0373937_0173995
1047 Ga0316582_0016264
1048 Ga0316584_0049452
1049 Ga0316584_0064424
1050 Ga0395898_0105304
1051 Ga0395898_0312265
1052 Ga0316581_0010150
1053 Ga0436364_0023787
1054 Ga0436364_0080477
1055 Ga0436364_0261392
1056 Ga0436364_0362464
1057 Ga0436364_1066317
1058 Ga0436364_1441187
1059 Ga0395901_0043363
1060 Ga0395901_0226213
1061 Ga0395901_0306355
1062 Ga0395901_0479302
1063 Ga0436365_0055247
1064 Ga0436365_0389546
1065 Ga0436365_0584563
1066 Ga0436365_0704878
1067 Ga0436365_0921647
1068 Ga0436365_0948346
1069 Ga0436365_0967629
1070 Ga0436365_1328609
1071 Ga0436365_1354231
1072 Ga0436361_0064816
1073 Ga0436361_1095720
1074 Ga0436363_0168903
1075 Ga0436363_0228184
1076 Ga0436363_1038972
1077 Ga0436362_0715185
1078 Ga0436362_0734465
1079 Ga0436362_0751876
1080 Ga0439448_0059692
1081 Ga0439446_0024101
1082 Ga0451577_0015422
1083 Ga0466963_0045988
1084 Ga0466963_0149373
1085 Ga0466963_0190117
1086 Ga0466963_0378353
1087 Ga0466964_0100542
1088 Ga0453684_0597156
1089 Ga0466968_0048369
1090 Ga0466957_0062449
1091 Ga0466960_0054630
1092 Ga0466960_0079104
1093 Ga0466959_0013796
1094 Ga0466958_0039660
1095 Ga0466958_0152054
1096 Ga0466967_0005851
1097 Ga0466967_0011433
1098 Ga0466967_0053988
1099 Ga0466967_0068010
1100 Ga0466967_0118490
1101 Ga0466967_0157696
1102 Ga0466967_0248390
1103 Ga0495603_0021750
1104 Ga0495590_0047214
1105 Ga0495651_0046284
1106 Ga0495653_0142859
1107 Ga0495639_0081044
1108 Ga0495620_0059435
1109 Ga0495644_0026093
1110 Ga0495644_0095360
1111 Ga0495598_0017143
1112 Ga0495667_0059857
1113 Ga0495667_0069322
1114 Ga0495634_0045211
1115 Ga0495646_0052715
1116 Ga0495604_0280835
1117 Ga0495676_0094111
1118 Ga0495680_0009148
1119 Ga0495675_0077405
1120 Ga0495602_0022121
1121 Ga0496100_0003847
1122 Ga0496100_0027176
1123 Ga0496102_0004626
1124 Ga0496102_0005252
1125 Ga0496102_0011053
1126 Ga0496102_0169432
1127 Ga0496102_0294530
1128 Ga0496103_0031546
1129 Ga0496103_0032176
1130 Ga0496104_0006563
1131 Ga0496104_0171383
1132 Ga0496104_0179504
1133 Ga0496104_0605666
1134 Ga0496105_0018078
1135 Ga0496105_0062243
1136 Ga0496105_0122054
1137 Ga0496106_0008301
1138 Ga0496106_0009469
1139 Ga0496106_0021141
1140 Ga0496106_0024483
1141 Ga0496106_0036389
1142 Ga0496106_0118714
1143 Ga0496107_0038027
1144 Ga0496107_0067677
1145 Ga0496108_0000573
1146 Ga0496108_0002818
1147 Ga0496108_0009182
1148 Ga0496108_0017377
1149 Ga0496108_0203327
1150 Ga0496109_0001860
1151 Ga0496109_0009285
1152 Ga0496109_0028948
1153 Ga0496109_0099360
1154 Ga0496109_0151826
1155 Ga0496109_0153097
1156 Ga0496109_0339659
1157 Ga0496109_0418323
1158 Ga0496110_0002244
1159 Ga0496110_0008506
1160 Ga0496110_0027347
1161 Ga0496110_0267129
1162 Ga0496111_0008393
1163 Ga0496111_0018570
1164 Ga0496111_0037656
1165 Ga0496111_0392767
1166 Ga0496112_0005731
1167 Ga0496112_0023090
1168 Ga0496112_0083661
1169 Ga0496112_0203869
1170 Ga0496112_0315461
1171 Ga0496112_0374984
1172 Ga0496112_0376235
1173 Ga0496113_0005440
1174 Ga0496113_0013328
1175 Ga0496113_0018413
1176 Ga0496113_0020573
1177 Ga0496114_0041119
1178 Ga0496114_0242343
1179 Ga0496115_0030347
1180 Ga0496115_0313418
1181 Ga0501031_0082483
1182 Ga0501031_0110641
1183 Ga0501031_0144355
1184 Ga0501031_0146086
1185 Ga0501036_0043411
1186 Ga0501036_0064680
1187 Ga0501036_0066588
1188 Ga0501036_0203405
1189 Ga0501036_0288928
1190 Ga0501036_0460090
1191 Ga0501038_0179467
1192 Ga0501038_0227993
1193 Ga0501039_0117098
1194 Ga0501039_0121935
1195 Ga0501039_0208567
1196 Ga0501040_0040738
1197 Ga0501040_0139109
1198 Ga0501041_0015563
1199 Ga0501041_0037803
1200 Ga0501041_0065931
1201 Ga0501041_0112457
1202 Ga0501042_0040659
1203 Ga0501042_0274936
1204 Ga0501042_0337601
1205 Ga0501043_0125814
1206 Ga0501046_0070219
1207 Ga0501046_0113682
1208 Ga0501046_0244268
1209 Ga0501048_0031054
1210 Ga0501048_0047823
1211 Ga0501048_0052512
1212 Ga0501048_0160026
1213 Ga0501070_0086833
1214 Ga0501071_0041172
1215 Ga0501071_0063833
1216 Ga0501071_0130282
1217 Ga0501072_0075375
1218 Ga0501072_0177371
1219 Ga0501072_0317283
1220 Ga0501074_0035590
1221 Ga0501074_0182633
1222 Ga0501075_0023662
1223 Ga0501075_0038529
1224 Ga0501075_0372436
1225 Ga0501076_0016112
1226 Ga0501076_0061506
1227 Ga0501076_0080238
1228 Ga0501077_0000553
1229 Ga0501077_0034611
1230 Ga0501077_0043769
1231 Ga0501077_0158997
1232 Ga0501079_0001648
1233 Ga0501079_0061024
1234 Ga0501079_0070873
1235 Ga0501079_0259707
1236 Ga0501079_0323960
1237 Ga0501079_0500986
1238 Ga0501080_0075688
1239 Ga0501080_0165791
1240 Ga0501081_0017392
1241 Ga0501081_0043289
1242 Ga0501081_0093948
1243 Ga0501081_0106725
1244 Ga0501081_0205970
1245 Ga0501083_0093445
1246 Ga0501035_0120353
1247 Ga0501035_0460274
1248 Ga0501044_0541499
1249 Ga0501045_0003788
1250 Ga0501045_0056067
1251 Ga0501045_0065218
1252 Ga0501045_0075778
1253 Ga0501045_0110169
1254 nmdc:mga05p37_135622_c1
1255 nmdc:mga05p37_1741_c1
1256 nmdc:mga05p37_239754_c1
1257 nmdc:mga05p37_276592_c1
1258 nmdc:mga05p37_579601_c1
1259 nmdc:mga09592_33430_c1
1260 nmdc:mga09592_47038_c1
1261 nmdc:mga0qj67_177354_c1
1262 nmdc:mga0qj67_3328_c1
1263 nmdc:mga06r32_154233_c1
1264 nmdc:mga06r32_84409_c1
1265 nmdc:mga08y16_118592_c1
1266 nmdc:mga08y16_220440_c1
1267 nmdc:mga08y16_46325_c1
1268 nmdc:mga0n895_1181_c1
1269 nmdc:mga0n895_141813_c1
1270 nmdc:mga0n895_15839_c1
1271 nmdc:mga0n895_185191_c1
1272 nmdc:mga0n895_5310_c1
1273 nmdc:mga0n895_54971_c1
1274 nmdc:mga0rr50_219677_c1
1275 nmdc:mga0rr50_89055_c1
1276 nmdc:mga08x19_1619_c1
1277 nmdc:mga08x19_16936_c1
1278 nmdc:mga08x19_2161_c1
1279 nmdc:mga0a205_107473_c1
1280 nmdc:mga0a205_212998_c1
1281 nmdc:mga0a205_41327_c1
1282 nmdc:mga0a205_9241_c1
1283 Ga0495619_0381433
1284 Ga0501084_0009717
1285 Ga0501084_0043566
1286 Ga0501084_0047307
1287 Ga0501084_0137539
1288 Ga0501084_0153716
1289 Ga0501084_0302751
1290 Ga0590071_000626
1291 Ga0590074_004112
1292 Ga0590075_010033
1293 Ga0501082_0025647
1294 Ga0501082_0037208
1295 Ga0501082_0293538
1296 Ga0530510_0006393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02741

FTR_C

FTR, proximal lobe

149

296

0.98

PF01913

FTR

Formylmethanofuran-tetrahydromethanopterin formyltransferase

3

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s6y-assembly2.cif.gz_P x-ray crystal structure of the formyltransferase/hydrolase complex (fhcabcd) from methylorubrum extorquens in complex with methylofuran 0.9425 1 293
6s6y-assembly2.cif.gz_P x-ray crystal structure of the formyltransferase/hydrolase complex (fhcabcd) from methylorubrum extorquens in complex with methylofuran 0.9333 1 293
1m5h-assembly2.cif.gz_E formylmethanofuran:tetrahydromethanopterin formyltransferase from archaeoglobus fulgidus 0.931 1 293
1m5h-assembly2.cif.gz_E formylmethanofuran:tetrahydromethanopterin formyltransferase from archaeoglobus fulgidus 0.922 1 293
1m5s-assembly1.cif.gz_D formylmethanofuran:tetrahydromethanopterin fromyltransferase from methanosarcina barkeri 0.9211 1 293
ID Description Score Start End Superfamily
af_Q57766_18_158_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9214 19 155 3.30.70.520
af_Q57766_160_295_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8979 159 288 3.30.70.520
af_Q57766_18_158_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8905 19 155 3.30.70.520
af_Q57766_160_295_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.854 159 288 3.30.70.520
af_Q9LYY3_95_246_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8108 128 151 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A351A1Y2-F1-model_v4 Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101) 0.9809 1 79 GO:0006730
GO:0030270
AF-A0A842ZHB9-F1-model_v4 deleted 0.9781 10 91
AF-A0A7C1PH49-F1-model_v4 Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101) 0.9779 1 95 GO:0006730
GO:0030270
AF-A0A497MCU1-F1-model_v4 Formylmethanofuran: tetrahydromethanopterin formyltransferase Ftr N-terminal domain-containing protein 0.9755 1 90 GO:0006730
GO:0016740
AF-A0A3S2HUR3-F1-model_v4 Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101) 0.9747 1 74 GO:0006730
GO:0030270

Map