F472342
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 648 | 395 | 634 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300003771|Ga0055526_1004255|Ga0055526_10042555 |
| Length | 326 |
| Sequence | MGRQCTGAMPRCRFLRTMPAMTLTELRYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEEELDVKIFERGANEVTMTPLGEDIVRQAQSVIEQASAIKDIAKRGKDPLDGPLRLGIIYTIGPYLLPELVKHCIDLYPRMPLMLQENFTQKLLDMLRTGELDCAIMAEPFPDAGLAVAPLYDESFVVAVPAVHPLAKKPRISAEELKAETMLLLGNGHCFRDHVLEVCPEFARFSTDAEGIRKSFEGSSLETIKHMVASGMGVTVVPALSVPDHVPPHLRYVPFEEPAPTRRVVLAWRRTFTRYEAVAALRNAVYACTLKGVTLLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 4 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 5 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 6 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 7 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 8 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 9 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 10 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 11 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 12 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 13 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 217 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 218 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 221 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 237 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 260 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 271 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 272 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 273 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 274 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 275 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 276 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 277 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 278 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 339 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 363 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 364 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 371 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 376 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 395 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.84 |
| Metatranscriptomes | 0 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.57 |
| Nodule | 0.46 |
| Rhizoplane | 2.78 |
| Rhizosphere | 77.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1015917 | 3300002705 | Bacteria | 1483 |
| 2 | JGI25164J39214_1002878 | 3300002772 | Bacteria | 2382 |
| 3 | JGI25406J46586_10026376 | 3300003203 | Bacteria | 2241 |
| 4 | rootH2_10012361 | 3300003320 | Bacteria | 4999 |
| 5 | rootL2_10005926 | 3300003322 | Bacteria | 13950 |
| 6 | rootH1_10012808 | 3300003323 | Bacteria | 5897 |
| 7 | Ga0055539_1000432 | 3300003752 | Bacteria | 14888 |
| 8 | Ga0055533_1000026 | 3300003756 | Bacteria | 323407 |
| 9 | Ga0055535_1000163 | 3300003761 | Bacteria | 71841 |
| 10 | Ga0055529_1000278 | 3300003763 | Bacteria | 61095 |
| 11 | Ga0055526_1004255 | 3300003771 | Bacteria | 8670 |
| 12 | Ga0055524_1001100 | 3300003775 | Bacteria | 16457 |
| 13 | Ga0055524_1002597 | 3300003775 | Bacteria | 9193 |
| 14 | Ga0055528_1027970 | 3300003790 | Bacteria | 1567 |
| 15 | Ga0055530_10030464 | 3300003791 | Bacteria | 1428 |
| 16 | Ga0055531_10000031 | 3300003794 | Bacteria | 156686 |
| 17 | Ga0055531_10001122 | 3300003794 | Bacteria | 20732 |
| 18 | Ga0055531_10002152 | 3300003794 | Bacteria | 13461 |
| 19 | Ga0065165_1000407 | 3300005262 | Bacteria | 68987 |
| 20 | Ga0065165_1000455 | 3300005262 | Bacteria | 64259 |
| 21 | Ga0065707_10087928 | 3300005295 | Bacteria | 4840 |
| 22 | Ga0070658_10058973 | 3300005327 | Bacteria | 3125 |
| 23 | Ga0070658_10198185 | 3300005327 | Bacteria | 1693 |
| 24 | Ga0070676_10001356 | 3300005328 | Bacteria | 12320 |
| 25 | Ga0070676_10049414 | 3300005328 | Bacteria | 2462 |
| 26 | Ga0070676_10129177 | 3300005328 | Bacteria | 1596 |
| 27 | Ga0070683_100083913 | 3300005329 | Bacteria | 2984 |
| 28 | Ga0070683_100113954 | 3300005329 | Bacteria | 2552 |
| 29 | Ga0070690_100000131 | 3300005330 | Bacteria | 38893 |
| 30 | Ga0070670_100007040 | 3300005331 | Bacteria | 9532 |
| 31 | Ga0070670_100105061 | 3300005331 | Bacteria | 2433 |
| 32 | Ga0070670_100233873 | 3300005331 | Bacteria | 1599 |
| 33 | Ga0070677_10006765 | 3300005333 | Bacteria | 3815 |
| 34 | Ga0068869_100000526 | 3300005334 | Bacteria | 21336 |
| 35 | Ga0068869_100002847 | 3300005334 | Bacteria | 10483 |
| 36 | Ga0068869_100009625 | 3300005334 | Bacteria | 6277 |
| 37 | Ga0068869_100051790 | 3300005334 | Bacteria | 2979 |
| 38 | Ga0068869_100104802 | 3300005334 | Bacteria | 2144 |
| 39 | Ga0070666_10142092 | 3300005335 | Bacteria | 1672 |
| 40 | Ga0070666_10243675 | 3300005335 | Bacteria | 1271 |
| 41 | Ga0070680_100008304 | 3300005336 | Bacteria | 7944 |
| 42 | Ga0070680_100014274 | 3300005336 | Bacteria | 6204 |
| 43 | Ga0070682_100003841 | 3300005337 | Bacteria | 8339 |
| 44 | Ga0068868_100001473 | 3300005338 | Bacteria | 16252 |
| 45 | Ga0068868_100001665 | 3300005338 | Bacteria | 15176 |
| 46 | Ga0068868_100002887 | 3300005338 | Bacteria | 11929 |
| 47 | Ga0070689_100001412 | 3300005340 | Bacteria | 15327 |
| 48 | Ga0070689_100004173 | 3300005340 | Bacteria | 9738 |
| 49 | Ga0070689_100050720 | 3300005340 | Bacteria | 3206 |
| 50 | Ga0070691_10001649 | 3300005341 | Bacteria | 9679 |
| 51 | Ga0070687_100000176 | 3300005343 | Bacteria | 22186 |
| 52 | Ga0070668_100090644 | 3300005347 | Bacteria | 2409 |
| 53 | Ga0070669_100028464 | 3300005353 | Bacteria | 4024 |
| 54 | Ga0070675_100000289 | 3300005354 | Bacteria | 33460 |
| 55 | Ga0070675_100002011 | 3300005354 | Bacteria | 15079 |
| 56 | Ga0070675_100075040 | 3300005354 | Bacteria | 2810 |
| 57 | Ga0070675_100081783 | 3300005354 | Bacteria | 2694 |
| 58 | Ga0070675_100121182 | 3300005354 | Bacteria | 2222 |
| 59 | Ga0070671_100021484 | 3300005355 | Bacteria | 5270 |
| 60 | Ga0070671_100084088 | 3300005355 | Bacteria | 2661 |
| 61 | Ga0070671_100125184 | 3300005355 | Bacteria | 2164 |
| 62 | Ga0070671_100172752 | 3300005355 | Bacteria | 1828 |
| 63 | Ga0070674_100140579 | 3300005356 | Bacteria | 1811 |
| 64 | Ga0070674_100163900 | 3300005356 | Bacteria | 1689 |
| 65 | Ga0070673_100011556 | 3300005364 | Bacteria | 6031 |
| 66 | Ga0070673_100205029 | 3300005364 | Bacteria | 1700 |
| 67 | Ga0070673_100282017 | 3300005364 | Bacteria | 1457 |
| 68 | Ga0070688_100054248 | 3300005365 | Bacteria | 2510 |
| 69 | Ga0070688_100148805 | 3300005365 | Bacteria | 1598 |
| 70 | Ga0070659_100030016 | 3300005366 | Bacteria | 4205 |
| 71 | Ga0070667_100003068 | 3300005367 | Bacteria | 14359 |
| 72 | Ga0070667_100331694 | 3300005367 | Bacteria | 1374 |
| 73 | Ga0070701_10000060 | 3300005438 | Bacteria | 29083 |
| 74 | Ga0070705_100000431 | 3300005440 | Bacteria | 24090 |
| 75 | Ga0070705_100069781 | 3300005440 | Bacteria | 2120 |
| 76 | Ga0070700_100001389 | 3300005441 | Bacteria | 12021 |
| 77 | Ga0070694_100000136 | 3300005444 | Bacteria | 36787 |
| 78 | Ga0070663_100008955 | 3300005455 | Bacteria | 6180 |
| 79 | Ga0070663_100069192 | 3300005455 | Bacteria | 2564 |
| 80 | Ga0070678_100000935 | 3300005456 | Bacteria | 14981 |
| 81 | Ga0070662_100003340 | 3300005457 | Bacteria | 10008 |
| 82 | Ga0070662_100033338 | 3300005457 | Bacteria | 3625 |
| 83 | Ga0070662_100178683 | 3300005457 | Bacteria | 1672 |
| 84 | Ga0070681_10150400 | 3300005458 | Bacteria | 2255 |
| 85 | Ga0068867_100002957 | 3300005459 | Bacteria | 11965 |
| 86 | Ga0068867_100039231 | 3300005459 | Bacteria | 3452 |
| 87 | Ga0068867_100049225 | 3300005459 | Bacteria | 3102 |
| 88 | Ga0068867_100086853 | 3300005459 | Bacteria | 2367 |
| 89 | Ga0070706_100002267 | 3300005467 | Bacteria | 19485 |
| 90 | Ga0070699_100200789 | 3300005518 | Bacteria | 1773 |
| 91 | Ga0070679_100002086 | 3300005530 | Bacteria | 17991 |
| 92 | Ga0070679_100004158 | 3300005530 | Bacteria | 13341 |
| 93 | Ga0068853_100027475 | 3300005539 | Bacteria | 4780 |
| 94 | Ga0068853_100367368 | 3300005539 | Bacteria | 1342 |
| 95 | Ga0070672_100033043 | 3300005543 | Bacteria | 3914 |
| 96 | Ga0070672_100160270 | 3300005543 | Bacteria | 1866 |
| 97 | Ga0070672_100265837 | 3300005543 | Bacteria | 1447 |
| 98 | Ga0070686_100000285 | 3300005544 | Bacteria | 34108 |
| 99 | Ga0070686_100007857 | 3300005544 | Bacteria | 5962 |
| 100 | Ga0070695_100001799 | 3300005545 | Bacteria | 12087 |
| 101 | Ga0070695_100085907 | 3300005545 | Bacteria | 2090 |
| 102 | Ga0070696_100001197 | 3300005546 | Bacteria | 16837 |
| 103 | Ga0070693_100000507 | 3300005547 | Bacteria | 17464 |
| 104 | Ga0070693_100326626 | 3300005547 | Bacteria | 1043 |
| 105 | Ga0070704_100000103 | 3300005549 | Bacteria | 29844 |
| 106 | Ga0068855_100001779 | 3300005563 | Bacteria | 26944 |
| 107 | Ga0068855_100032621 | 3300005563 | Bacteria | 6218 |
| 108 | Ga0068857_100019546 | 3300005577 | Bacteria | 5949 |
| 109 | Ga0068857_100369928 | 3300005577 | Bacteria | 1330 |
| 110 | Ga0068854_100110033 | 3300005578 | Bacteria | 2077 |
| 111 | Ga0068856_100025363 | 3300005614 | Bacteria | 5780 |
| 112 | Ga0068856_100032369 | 3300005614 | Bacteria | 5119 |
| 113 | Ga0070702_100000039 | 3300005615 | Bacteria | 35203 |
| 114 | Ga0068852_100003362 | 3300005616 | Bacteria | 11162 |
| 115 | Ga0068852_100043355 | 3300005616 | Bacteria | 3816 |
| 116 | Ga0068852_100172996 | 3300005616 | Bacteria | 2026 |
| 117 | Ga0068859_100000420 | 3300005617 | Bacteria | 42401 |
| 118 | Ga0068859_100001930 | 3300005617 | Bacteria | 21145 |
| 119 | Ga0068859_100547422 | 3300005617 | Bacteria | 1252 |
| 120 | Ga0068864_100000799 | 3300005618 | Bacteria | 26376 |
| 121 | Ga0068864_100131830 | 3300005618 | Bacteria | 2246 |
| 122 | Ga0068866_10000153 | 3300005718 | Bacteria | 31527 |
| 123 | Ga0068866_10159631 | 3300005718 | Bacteria | 1313 |
| 124 | Ga0068866_10209654 | 3300005718 | Bacteria | 1169 |
| 125 | Ga0068861_100000987 | 3300005719 | Bacteria | 17369 |
| 126 | Ga0068861_100004849 | 3300005719 | Bacteria | 9048 |
| 127 | Ga0068851_10008715 | 3300005834 | Bacteria | 4697 |
| 128 | Ga0068851_10045224 | 3300005834 | Bacteria | 2224 |
| 129 | Ga0068863_100014630 | 3300005841 | Bacteria | 7554 |
| 130 | Ga0068863_100015891 | 3300005841 | Bacteria | 7220 |
| 131 | Ga0068863_100459917 | 3300005841 | Bacteria | 1250 |
| 132 | Ga0068863_100509302 | 3300005841 | Bacteria | 1186 |
| 133 | Ga0068858_100000259 | 3300005842 | Bacteria | 56570 |
| 134 | Ga0068858_100024401 | 3300005842 | Bacteria | 5634 |
| 135 | Ga0068858_100423931 | 3300005842 | Bacteria | 1280 |
| 136 | Ga0068860_100002022 | 3300005843 | Bacteria | 21401 |
| 137 | Ga0068860_100080262 | 3300005843 | Bacteria | 3102 |
| 138 | Ga0068862_100004968 | 3300005844 | Bacteria | 11195 |
| 139 | Ga0081539_10000668 | 3300005985 | Bacteria | 68754 |
| 140 | Ga0075365_10078643 | 3300006038 | Bacteria | 2230 |
| 141 | Ga0075368_10048102 | 3300006042 | Bacteria | 1689 |
| 142 | Ga0075362_10008340 | 3300006177 | Bacteria | 3958 |
| 143 | Ga0075362_10028980 | 3300006177 | Bacteria | 2382 |
| 144 | Ga0075367_10003732 | 3300006178 | Bacteria | 7328 |
| 145 | Ga0075367_10062680 | 3300006178 | Bacteria | 2221 |
| 146 | Ga0075367_10064275 | 3300006178 | Bacteria | 2195 |
| 147 | Ga0075367_10160334 | 3300006178 | Bacteria | 1398 |
| 148 | Ga0075369_10004347 | 3300006186 | Bacteria | 5225 |
| 149 | Ga0075366_10000934 | 3300006195 | Bacteria | 14194 |
| 150 | Ga0075366_10005540 | 3300006195 | Bacteria | 6842 |
| 151 | Ga0075366_10006445 | 3300006195 | Bacteria | 6431 |
| 152 | Ga0075366_10013063 | 3300006195 | Bacteria | 4722 |
| 153 | Ga0075366_10020955 | 3300006195 | Bacteria | 3798 |
| 154 | Ga0075366_10071147 | 3300006195 | Bacteria | 2072 |
| 155 | Ga0097621_100004055 | 3300006237 | Bacteria | 10159 |
| 156 | Ga0097621_100006968 | 3300006237 | Bacteria | 8050 |
| 157 | Ga0097621_100024370 | 3300006237 | Bacteria | 4725 |
| 158 | Ga0097621_100198317 | 3300006237 | Bacteria | 1741 |
| 159 | Ga0097621_100297473 | 3300006237 | Bacteria | 1425 |
| 160 | Ga0075370_10003984 | 3300006353 | Bacteria | 7095 |
| 161 | Ga0075370_10047254 | 3300006353 | Bacteria | 2437 |
| 162 | Ga0075370_10105697 | 3300006353 | Bacteria | 1632 |
| 163 | Ga0075370_10115134 | 3300006353 | Bacteria | 1563 |
| 164 | Ga0068871_100001023 | 3300006358 | Bacteria | 18737 |
| 165 | Ga0068871_100001380 | 3300006358 | Bacteria | 16255 |
| 166 | Ga0068871_100011400 | 3300006358 | Bacteria | 6518 |
| 167 | Ga0068871_100051115 | 3300006358 | Bacteria | 3345 |
| 168 | Ga0068871_100284424 | 3300006358 | Bacteria | 1447 |
| 169 | Ga0068871_100303230 | 3300006358 | Bacteria | 1402 |
| 170 | Ga0075428_100000109 | 3300006844 | Bacteria | 69948 |
| 171 | Ga0075430_100052839 | 3300006846 | Bacteria | 3421 |
| 172 | Ga0075430_100094035 | 3300006846 | Bacteria | 2506 |
| 173 | Ga0075433_10026884 | 3300006852 | Bacteria | 4876 |
| 174 | Ga0075434_100001188 | 3300006871 | Bacteria | 21590 |
| 175 | Ga0075434_100010325 | 3300006871 | Bacteria | 8754 |
| 176 | Ga0068865_100006284 | 3300006881 | Bacteria | 7233 |
| 177 | Ga0075436_100000075 | 3300006914 | Bacteria | 59554 |
| 178 | Ga0097620_100000420 | 3300006931 | Bacteria | 42401 |
| 179 | Ga0097620_100001930 | 3300006931 | Bacteria | 21145 |
| 180 | Ga0097620_100547347 | 3300006931 | Bacteria | 1252 |
| 181 | Ga0099823_1000003 | 3300006944 | Bacteria | 189058 |
| 182 | Ga0075435_100000116 | 3300007076 | Bacteria | 44259 |
| 183 | Ga0075435_100003441 | 3300007076 | Bacteria | 10738 |
| 184 | Ga0099794_10040059 | 3300007265 | Bacteria | 2226 |
| 185 | Ga0105240_10415310 | 3300009093 | Bacteria | 1513 |
| 186 | Ga0105240_10426591 | 3300009093 | Bacteria | 1489 |
| 187 | Ga0111539_10109921 | 3300009094 | Bacteria | 3235 |
| 188 | Ga0105245_10000533 | 3300009098 | Bacteria | 34922 |
| 189 | Ga0105245_10124707 | 3300009098 | Bacteria | 2409 |
| 190 | Ga0105247_10084472 | 3300009101 | Bacteria | 2006 |
| 191 | Ga0114129_10061813 | 3300009147 | Bacteria | 5234 |
| 192 | Ga0105243_10000495 | 3300009148 | Bacteria | 40193 |
| 193 | Ga0105243_10069162 | 3300009148 | Bacteria | 2847 |
| 194 | Ga0105241_10214946 | 3300009174 | Bacteria | 1613 |
| 195 | Ga0105242_10000248 | 3300009176 | Bacteria | 42523 |
| 196 | Ga0105242_10147911 | 3300009176 | Bacteria | 2045 |
| 197 | Ga0105248_10007056 | 3300009177 | Bacteria | 12308 |
| 198 | Ga0105248_10015976 | 3300009177 | Bacteria | 8264 |
| 199 | Ga0105248_10074684 | 3300009177 | Bacteria | 3810 |
| 200 | Ga0105237_10043340 | 3300009545 | Bacteria | 4533 |
| 201 | Ga0105237_10521258 | 3300009545 | Bacteria | 1195 |
| 202 | Ga0105249_10012063 | 3300009553 | Bacteria | 7607 |
| 203 | Ga0105239_10072973 | 3300010375 | Bacteria | 3774 |
| 204 | Ga0157319_1000002 | 3300012497 | Bacteria | 410803 |
| 205 | Ga0157371_10028746 | 3300013102 | Bacteria | 4024 |
| 206 | Ga0157374_10004892 | 3300013296 | Bacteria | 11240 |
| 207 | Ga0157378_10000387 | 3300013297 | Bacteria | 43542 |
| 208 | Ga0163162_10011233 | 3300013306 | Bacteria | 8730 |
| 209 | Ga0157372_10041512 | 3300013307 | Bacteria | 5087 |
| 210 | Ga0157375_10452315 | 3300013308 | Bacteria | 1450 |
| 211 | Ga0157375_10545374 | 3300013308 | Bacteria | 1322 |
| 212 | Ga0157380_10074896 | 3300014326 | Bacteria | 2750 |
| 213 | Ga0157377_10054727 | 3300014745 | Bacteria | 2260 |
| 214 | Ga0157379_10009677 | 3300014968 | Bacteria | 8390 |
| 215 | Ga0157379_10182479 | 3300014968 | Bacteria | 1896 |
| 216 | Ga0157376_10019230 | 3300014969 | Bacteria | 5259 |
| 217 | Ga0157376_10079824 | 3300014969 | Bacteria | 2805 |
| 218 | Ga0163161_10073015 | 3300017792 | Bacteria | 2513 |
| 219 | Ga0213872_10000022 | 3300021361 | Bacteria | 158011 |
| 220 | Ga0213872_10000039 | 3300021361 | Bacteria | 123507 |
| 221 | Ga0213872_10002263 | 3300021361 | Bacteria | 11482 |
| 222 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 223 | Ga0209563_100069 | 3300025230 | Bacteria | 253154 |
| 224 | Ga0207427_100422 | 3300025231 | Bacteria | 24068 |
| 225 | Ga0209258_100080 | 3300025242 | Bacteria | 255287 |
| 226 | Ga0209677_100048 | 3300025253 | Bacteria | 183563 |
| 227 | Ga0209148_1004019 | 3300025254 | Bacteria | 3761 |
| 228 | Ga0209759_1000207 | 3300025256 | Bacteria | 91180 |
| 229 | Ga0209759_1000925 | 3300025256 | Bacteria | 21323 |
| 230 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 231 | Ga0209673_1004160 | 3300025273 | Bacteria | 7912 |
| 232 | Ga0209673_1009288 | 3300025273 | Bacteria | 4282 |
| 233 | Ga0209564_1000030 | 3300025295 | Bacteria | 503296 |
| 234 | Ga0209050_1006312 | 3300025298 | Bacteria | 7062 |
| 235 | Ga0209050_1014557 | 3300025298 | Bacteria | 3379 |
| 236 | Ga0209256_1002110 | 3300025299 | Bacteria | 17294 |
| 237 | Ga0209256_1002225 | 3300025299 | Bacteria | 16565 |
| 238 | Ga0209051_1001516 | 3300025303 | Bacteria | 19358 |
| 239 | Ga0209051_1008898 | 3300025303 | Bacteria | 5247 |
| 240 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 241 | Ga0209257_1001314 | 3300025304 | Bacteria | 30250 |
| 242 | Ga0209257_1003977 | 3300025304 | Bacteria | 11958 |
| 243 | Ga0207656_10008247 | 3300025321 | Bacteria | 3825 |
| 244 | Ga0207656_10118584 | 3300025321 | Bacteria | 1230 |
| 245 | Ga0207682_10012083 | 3300025893 | Bacteria | 3373 |
| 246 | Ga0207682_10125522 | 3300025893 | Bacteria | 1142 |
| 247 | Ga0207642_10000130 | 3300025899 | Bacteria | 20678 |
| 248 | Ga0207688_10027052 | 3300025901 | Bacteria | 3155 |
| 249 | Ga0207688_10092177 | 3300025901 | Bacteria | 1741 |
| 250 | Ga0207688_10092622 | 3300025901 | Bacteria | 1737 |
| 251 | Ga0207645_10002661 | 3300025907 | Bacteria | 13901 |
| 252 | Ga0207645_10020578 | 3300025907 | Bacteria | 4317 |
| 253 | Ga0207645_10088136 | 3300025907 | Bacteria | 1995 |
| 254 | Ga0207645_10169783 | 3300025907 | Bacteria | 1429 |
| 255 | Ga0207684_10003451 | 3300025910 | Bacteria | 15417 |
| 256 | Ga0207654_10175090 | 3300025911 | Bacteria | 1396 |
| 257 | Ga0207695_10199060 | 3300025913 | Bacteria | 1918 |
| 258 | Ga0207671_10013996 | 3300025914 | Bacteria | 6363 |
| 259 | Ga0207660_10000756 | 3300025917 | Bacteria | 21503 |
| 260 | Ga0207662_10000095 | 3300025918 | Bacteria | 41923 |
| 261 | Ga0207657_10025263 | 3300025919 | Bacteria | 5481 |
| 262 | Ga0207657_10027983 | 3300025919 | Bacteria | 5151 |
| 263 | Ga0207652_10003750 | 3300025921 | Bacteria | 12466 |
| 264 | Ga0207652_10006460 | 3300025921 | Bacteria | 9456 |
| 265 | Ga0207694_10305317 | 3300025924 | Bacteria | 1311 |
| 266 | Ga0207650_10024375 | 3300025925 | Bacteria | 4300 |
| 267 | Ga0207650_10025621 | 3300025925 | Bacteria | 4202 |
| 268 | Ga0207650_10054164 | 3300025925 | Bacteria | 2975 |
| 269 | Ga0207650_10054446 | 3300025925 | Bacteria | 2967 |
| 270 | Ga0207659_10004686 | 3300025926 | Bacteria | 8282 |
| 271 | Ga0207659_10010803 | 3300025926 | Bacteria | 5747 |
| 272 | Ga0207659_10045916 | 3300025926 | Bacteria | 3082 |
| 273 | Ga0207687_10000432 | 3300025927 | Bacteria | 28412 |
| 274 | Ga0207687_10176511 | 3300025927 | Bacteria | 1652 |
| 275 | Ga0207687_10179336 | 3300025927 | Bacteria | 1640 |
| 276 | Ga0207644_10125793 | 3300025931 | Bacteria | 1956 |
| 277 | Ga0207644_10156182 | 3300025931 | Bacteria | 1769 |
| 278 | Ga0207644_10159112 | 3300025931 | Bacteria | 1754 |
| 279 | Ga0207690_10002793 | 3300025932 | Bacteria | 10532 |
| 280 | Ga0207706_10001138 | 3300025933 | Bacteria | 27072 |
| 281 | Ga0207706_10433855 | 3300025933 | Bacteria | 1138 |
| 282 | Ga0207686_10001368 | 3300025934 | Bacteria | 13851 |
| 283 | Ga0207709_10001646 | 3300025935 | Bacteria | 15123 |
| 284 | Ga0207709_10077836 | 3300025935 | Bacteria | 2127 |
| 285 | Ga0207670_10001616 | 3300025936 | Bacteria | 11754 |
| 286 | Ga0207670_10002845 | 3300025936 | Bacteria | 9135 |
| 287 | Ga0207670_10129667 | 3300025936 | Bacteria | 1845 |
| 288 | Ga0207669_10258435 | 3300025937 | Bacteria | 1301 |
| 289 | Ga0207669_10300632 | 3300025937 | Bacteria | 1219 |
| 290 | Ga0207704_10000281 | 3300025938 | Bacteria | 24286 |
| 291 | Ga0207665_10022676 | 3300025939 | Bacteria | 4133 |
| 292 | Ga0207691_10042365 | 3300025940 | Bacteria | 4198 |
| 293 | Ga0207691_10056935 | 3300025940 | Bacteria | 3560 |
| 294 | Ga0207691_10069374 | 3300025940 | Bacteria | 3184 |
| 295 | Ga0207691_10287236 | 3300025940 | Bacteria | 1415 |
| 296 | Ga0207711_10015447 | 3300025941 | Bacteria | 6337 |
| 297 | Ga0207711_10019702 | 3300025941 | Bacteria | 5618 |
| 298 | Ga0207689_10000784 | 3300025942 | Bacteria | 30501 |
| 299 | Ga0207689_10000977 | 3300025942 | Bacteria | 27402 |
| 300 | Ga0207689_10013759 | 3300025942 | Bacteria | 6894 |
| 301 | Ga0207689_10021436 | 3300025942 | Bacteria | 5431 |
| 302 | Ga0207661_10093957 | 3300025944 | Bacteria | 2504 |
| 303 | Ga0207661_10390379 | 3300025944 | Bacteria | 1261 |
| 304 | Ga0207667_10005008 | 3300025949 | Bacteria | 16189 |
| 305 | Ga0207667_10301784 | 3300025949 | Bacteria | 1636 |
| 306 | Ga0207651_10000437 | 3300025960 | Bacteria | 17592 |
| 307 | Ga0207651_10016907 | 3300025960 | Bacteria | 4292 |
| 308 | Ga0207651_10141390 | 3300025960 | Bacteria | 1859 |
| 309 | Ga0207712_10002627 | 3300025961 | Bacteria | 11512 |
| 310 | Ga0207668_10081409 | 3300025972 | Bacteria | 2349 |
| 311 | Ga0207640_10004566 | 3300025981 | Bacteria | 7511 |
| 312 | Ga0207640_10151912 | 3300025981 | Bacteria | 1702 |
| 313 | Ga0207658_10037856 | 3300025986 | Bacteria | 3470 |
| 314 | Ga0207658_10381645 | 3300025986 | Bacteria | 1234 |
| 315 | Ga0207677_10001302 | 3300026023 | Bacteria | 13399 |
| 316 | Ga0207677_10002945 | 3300026023 | Bacteria | 8991 |
| 317 | Ga0207677_10003436 | 3300026023 | Bacteria | 8392 |
| 318 | Ga0207677_10066210 | 3300026023 | Bacteria | 2525 |
| 319 | Ga0207677_10138733 | 3300026023 | Bacteria | 1858 |
| 320 | Ga0207703_10000970 | 3300026035 | Bacteria | 27674 |
| 321 | Ga0207703_10132339 | 3300026035 | Bacteria | 2155 |
| 322 | Ga0207639_10005501 | 3300026041 | Bacteria | 8564 |
| 323 | Ga0207639_10095797 | 3300026041 | Bacteria | 2386 |
| 324 | Ga0207639_10353206 | 3300026041 | Bacteria | 1313 |
| 325 | Ga0207678_10012814 | 3300026067 | Bacteria | 7362 |
| 326 | Ga0207708_10000551 | 3300026075 | Bacteria | 28958 |
| 327 | Ga0207702_10008590 | 3300026078 | Bacteria | 8612 |
| 328 | Ga0207702_10061074 | 3300026078 | Bacteria | 3214 |
| 329 | Ga0207641_10013074 | 3300026088 | Bacteria | 6808 |
| 330 | Ga0207648_10000513 | 3300026089 | Bacteria | 43298 |
| 331 | Ga0207648_10003056 | 3300026089 | Bacteria | 17699 |
| 332 | Ga0207648_10032485 | 3300026089 | Bacteria | 4607 |
| 333 | Ga0207648_10064887 | 3300026089 | Bacteria | 3183 |
| 334 | Ga0207648_10101947 | 3300026089 | Bacteria | 2515 |
| 335 | Ga0207648_10131048 | 3300026089 | Bacteria | 2207 |
| 336 | Ga0207648_10336188 | 3300026089 | Bacteria | 1359 |
| 337 | Ga0207676_10001334 | 3300026095 | Bacteria | 18375 |
| 338 | Ga0207676_10002611 | 3300026095 | Bacteria | 12848 |
| 339 | Ga0207676_10006862 | 3300026095 | Bacteria | 8065 |
| 340 | Ga0207676_10039746 | 3300026095 | Bacteria | 3601 |
| 341 | Ga0207674_10011502 | 3300026116 | Bacteria | 9940 |
| 342 | Ga0207674_10032551 | 3300026116 | Bacteria | 5468 |
| 343 | Ga0207674_10235513 | 3300026116 | Bacteria | 1778 |
| 344 | Ga0207675_100001063 | 3300026118 | Bacteria | 27254 |
| 345 | Ga0207675_100002446 | 3300026118 | Bacteria | 18392 |
| 346 | Ga0207683_10009863 | 3300026121 | Bacteria | 8146 |
| 347 | Ga0207683_10270134 | 3300026121 | Bacteria | 1553 |
| 348 | Ga0207698_10002384 | 3300026142 | Bacteria | 11130 |
| 349 | Ga0207698_10043542 | 3300026142 | Bacteria | 3364 |
| 350 | Ga0209389_1000268 | 3300027296 | Bacteria | 32841 |
| 351 | Ga0209969_1005553 | 3300027360 | Bacteria | 1772 |
| 352 | Ga0209981_1001462 | 3300027378 | Bacteria | 2977 |
| 353 | Ga0209968_1003104 | 3300027526 | Bacteria | 2491 |
| 354 | Ga0209588_1003962 | 3300027671 | Bacteria | 4141 |
| 355 | Ga0209813_10080709 | 3300027866 | Bacteria | 1075 |
| 356 | Ga0207428_10036572 | 3300027907 | Bacteria | 4003 |
| 357 | Ga0268265_10006650 | 3300028380 | Bacteria | 7822 |
| 358 | Ga0268264_10000827 | 3300028381 | Bacteria | 33217 |
| 359 | Ga0268264_10107323 | 3300028381 | Bacteria | 2439 |
| 360 | Ga0307517_10001696 | 3300028786 | Bacteria | 36406 |
| 361 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 362 | Ga0307515_10000374 | 3300028794 | Bacteria | 109304 |
| 363 | Ga0307515_10000585 | 3300028794 | Bacteria | 85580 |
| 364 | Ga0307515_10038455 | 3300028794 | Bacteria | 7653 |
| 365 | Ga0307515_10119226 | 3300028794 | Bacteria | 3003 |
| 366 | Ga0307515_10130291 | 3300028794 | Bacteria | 2776 |
| 367 | Ga0307511_10077454 | 3300030521 | Bacteria | 2367 |
| 368 | Ga0307512_10134715 | 3300030522 | Bacteria | 1535 |
| 369 | Ga0265330_10000012 | 3300031235 | Bacteria | 180837 |
| 370 | Ga0265332_10000012 | 3300031238 | Bacteria | 272641 |
| 371 | Ga0265332_10000026 | 3300031238 | Bacteria | 193153 |
| 372 | Ga0265332_10011489 | 3300031238 | Bacteria | 3934 |
| 373 | Ga0265325_10030143 | 3300031241 | Bacteria | 2911 |
| 374 | Ga0307513_10026352 | 3300031456 | Bacteria | 6704 |
| 375 | Ga0307513_10213533 | 3300031456 | Bacteria | 1758 |
| 376 | Ga0307513_10238751 | 3300031456 | Bacteria | 1624 |
| 377 | Ga0307509_10001996 | 3300031507 | Bacteria | 33693 |
| 378 | Ga0307509_10006059 | 3300031507 | Bacteria | 16481 |
| 379 | Ga0307509_10008945 | 3300031507 | Bacteria | 12627 |
| 380 | Ga0307509_10032771 | 3300031507 | Bacteria | 5724 |
| 381 | Ga0307509_10078389 | 3300031507 | Bacteria | 3423 |
| 382 | Ga0307408_100227071 | 3300031548 | Bacteria | 1527 |
| 383 | Ga0307508_10000222 | 3300031616 | Bacteria | 69029 |
| 384 | Ga0307508_10000940 | 3300031616 | Bacteria | 33950 |
| 385 | Ga0307514_10000420 | 3300031649 | Bacteria | 94078 |
| 386 | Ga0307514_10005696 | 3300031649 | Bacteria | 11025 |
| 387 | Ga0307514_10059056 | 3300031649 | Bacteria | 2932 |
| 388 | Ga0307514_10080818 | 3300031649 | Bacteria | 2404 |
| 389 | Ga0316575_10002559 | 3300031665 | Bacteria | 6113 |
| 390 | Ga0316575_10011575 | 3300031665 | Bacteria | 3266 |
| 391 | Ga0316579_10008116 | 3300031691 | Bacteria | 4364 |
| 392 | Ga0265314_10000029 | 3300031711 | Bacteria | 272506 |
| 393 | Ga0316576_10012981 | 3300031727 | Bacteria | 5517 |
| 394 | Ga0316578_10138337 | 3300031728 | Bacteria | 1466 |
| 395 | Ga0307516_10004842 | 3300031730 | Bacteria | 16393 |
| 396 | Ga0316577_10011701 | 3300031733 | Bacteria | 4760 |
| 397 | Ga0307413_10127242 | 3300031824 | Bacteria | 1737 |
| 398 | Ga0307410_10204464 | 3300031852 | Bacteria | 1510 |
| 399 | Ga0307406_10118157 | 3300031901 | Bacteria | 1838 |
| 400 | Ga0307412_10009393 | 3300031911 | Bacteria | 5611 |
| 401 | Ga0307409_100043535 | 3300031995 | Bacteria | 3372 |
| 402 | Ga0307416_100008542 | 3300032002 | Bacteria | 6618 |
| 403 | Ga0307416_100283942 | 3300032002 | Bacteria | 1634 |
| 404 | Ga0307414_10008560 | 3300032004 | Bacteria | 5813 |
| 405 | Ga0307411_10000222 | 3300032005 | Bacteria | 18412 |
| 406 | Ga0307411_10139246 | 3300032005 | Bacteria | 1787 |
| 407 | Ga0307415_100001343 | 3300032126 | Bacteria | 11689 |
| 408 | Ga0316583_10034490 | 3300032133 | Bacteria | 1796 |
| 409 | Ga0307507_10012802 | 3300033179 | Bacteria | 10294 |
| 410 | Ga0307507_10065720 | 3300033179 | Bacteria | 3332 |
| 411 | Ga0307510_10001144 | 3300033180 | Bacteria | 28515 |
| 412 | Ga0307510_10079929 | 3300033180 | Bacteria | 3183 |
| 413 | Ga0373948_0002485 | 3300034817 | Bacteria | 2732 |
| 414 | Ga0373948_0002608 | 3300034817 | Bacteria | 2684 |
| 415 | Ga0373938_0018084 | 3300034957 | Bacteria | 1395 |
| 416 | Ga0373926_0002214 | 3300035083 | Bacteria | 6137 |
| 417 | Ga0373929_0029969 | 3300035085 | Bacteria | 1158 |
| 418 | Ga0373940_0033745 | 3300035088 | Bacteria | 1378 |
| 419 | Ga0373944_0102750 | 3300035089 | Bacteria | 967 |
| 420 | Ga0373936_0009128 | 3300035113 | Bacteria | 3737 |
| 421 | Ga0373939_0000003 | 3300035114 | Bacteria | 111914 |
| 422 | Ga0373941_0042060 | 3300035115 | Bacteria | 1417 |
| 423 | Ga0373945_0012050 | 3300035116 | Bacteria | 2866 |
| 424 | Ga0373953_0034556 | 3300035117 | Bacteria | 1982 |
| 425 | Ga0373954_0000012 | 3300035118 | Bacteria | 73616 |
| 426 | Ga0373960_0000945 | 3300035121 | Bacteria | 6229 |
| 427 | Ga0373960_0030396 | 3300035121 | Bacteria | 1504 |
| 428 | Ga0373955_0136469 | 3300035172 | Bacteria | 1435 |
| 429 | Ga0373942_0004661 | 3300035207 | Bacteria | 3175 |
| 430 | Ga0373961_0032709 | 3300035241 | Bacteria | 1460 |
| 431 | Ga0316574_0145691 | 3300035398 | Bacteria | 1526 |
| 432 | Ga0316574_0166704 | 3300035398 | Bacteria | 1419 |
| 433 | Ga0373924_0005626 | 3300035410 | Bacteria | 4442 |
| 434 | Ga0373931_0000512 | 3300035691 | Bacteria | 15883 |
| 435 | Ga0373931_0011038 | 3300035691 | Bacteria | 4355 |
| 436 | Ga0373931_0012262 | 3300035691 | Bacteria | 4150 |
| 437 | Ga0373931_0033076 | 3300035691 | Bacteria | 2678 |
| 438 | Ga0373931_0066263 | 3300035691 | Bacteria | 1959 |
| 439 | Ga0373935_0012567 | 3300035692 | Bacteria | 5095 |
| 440 | Ga0373933_0014633 | 3300035724 | Bacteria | 4367 |
| 441 | Ga0373947_0011345 | 3300035725 | Bacteria | 5115 |
| 442 | Ga0373937_0001168 | 3300036401 | Bacteria | 22061 |
| 443 | Ga0373937_0003159 | 3300036401 | Bacteria | 13788 |
| 444 | Ga0373937_0245271 | 3300036401 | Bacteria | 1688 |
| 445 | Ga0316582_0015425 | 3300036647 | Bacteria | 4370 |
| 446 | Ga0316584_0007667 | 3300036712 | Bacteria | 7406 |
| 447 | Ga0316584_0100553 | 3300036712 | Bacteria | 2165 |
| 448 | Ga0316584_0219175 | 3300036712 | Bacteria | 1398 |
| 449 | Ga0373925_0012696 | 3300037068 | Bacteria | 6101 |
| 450 | Ga0373925_0048251 | 3300037068 | Bacteria | 3172 |
| 451 | Ga0395900_0000147 | 3300037418 | Bacteria | 118678 |
| 452 | Ga0395898_0000747 | 3300037466 | Bacteria | 56704 |
| 453 | Ga0395905_0015871 | 3300037471 | Bacteria | 7155 |
| 454 | Ga0395905_0056089 | 3300037471 | Bacteria | 3687 |
| 455 | Ga0395905_0097275 | 3300037471 | Bacteria | 2763 |
| 456 | Ga0436364_0691409 | 3300037853 | Bacteria | 1370 |
| 457 | Ga0400483_275507 | 3300039062 | Bacteria | 3349 |
| 458 | Ga0436361_0577165 | 3300039447 | Bacteria | 73575 |
| 459 | Ga0436361_0675000 | 3300039447 | Bacteria | 73288 |
| 460 | Ga0436361_0727288 | 3300039447 | Bacteria | 2511 |
| 461 | Ga0436361_1070817 | 3300039447 | Bacteria | 30666 |
| 462 | Ga0451793_0507773 | 3300041452 | Bacteria | 1004 |
| 463 | Ga0451853_2571749 | 3300041512 | Bacteria | 1062 |
| 464 | Ga0450911_000637 | 3300042115 | Bacteria | 10552 |
| 465 | Ga0450917_000728 | 3300042120 | Bacteria | 2429 |
| 466 | Ga0450888_000488 | 3300042126 | Bacteria | 3749 |
| 467 | Ga0450890_000757 | 3300042127 | Bacteria | 4678 |
| 468 | Ga0450890_002578 | 3300042127 | Bacteria | 2476 |
| 469 | Ga0450891_001217 | 3300042129 | Bacteria | 2679 |
| 470 | Ga0450892_001368 | 3300042130 | Bacteria | 2424 |
| 471 | Ga0450889_000444 | 3300042144 | Bacteria | 4580 |
| 472 | Ga0439459_0000831 | 3300042438 | Bacteria | 4313 |
| 473 | Ga0439459_0022777 | 3300042438 | Bacteria | 1215 |
| 474 | Ga0450893_0001683 | 3300042532 | Bacteria | 3399 |
| 475 | Ga0451577_0002674 | 3300042876 | Bacteria | 20811 |
| 476 | Ga0451577_0006991 | 3300042876 | Bacteria | 11146 |
| 477 | Ga0451577_0075638 | 3300042876 | Bacteria | 3002 |
| 478 | Ga0451577_0111584 | 3300042876 | Bacteria | 2446 |
| 479 | Ga0466969_0000156 | 3300044656 | Bacteria | 37057 |
| 480 | Ga0466965_0005277 | 3300044683 | Bacteria | 5812 |
| 481 | Ga0466966_0001886 | 3300044684 | Bacteria | 13605 |
| 482 | Ga0466966_0008995 | 3300044684 | Bacteria | 6618 |
| 483 | Ga0466961_0011166 | 3300044693 | Bacteria | 5741 |
| 484 | Ga0466964_0035787 | 3300044706 | Bacteria | 1987 |
| 485 | Ga0453684_0235914 | 3300044712 | Bacteria | 2109 |
| 486 | Ga0466971_0049868 | 3300044719 | Bacteria | 1883 |
| 487 | Ga0466957_0003723 | 3300044842 | Bacteria | 8427 |
| 488 | Ga0466960_0007896 | 3300044901 | Bacteria | 4342 |
| 489 | Ga0466959_0032871 | 3300045049 | Bacteria | 3839 |
| 490 | Ga0451576_0018377 | 3300045051 | Bacteria | 7665 |
| 491 | Ga0451576_0042791 | 3300045051 | Bacteria | 4782 |
| 492 | Ga0451576_0057691 | 3300045051 | Bacteria | 4058 |
| 493 | Ga0451576_0197311 | 3300045051 | Bacteria | 2102 |
| 494 | Ga0466958_0017396 | 3300045836 | Bacteria | 4154 |
| 495 | Ga0495592_0003983 | 3300046454 | Bacteria | 10710 |
| 496 | Ga0495592_0004109 | 3300046454 | Bacteria | 10588 |
| 497 | Ga0495590_0011883 | 3300046457 | Bacteria | 3244 |
| 498 | Ga0495638_0147302 | 3300046460 | Bacteria | 1368 |
| 499 | Ga0495580_0000775 | 3300046472 | Bacteria | 27515 |
| 500 | Ga0495582_0031960 | 3300046473 | Bacteria | 2895 |
| 501 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 502 | Ga0495606_0002246 | 3300046507 | Bacteria | 22999 |
| 503 | Ga0495631_0035448 | 3300046518 | Bacteria | 2231 |
| 504 | Ga0495632_0017704 | 3300046519 | Bacteria | 3927 |
| 505 | Ga0495643_0000158 | 3300046522 | Bacteria | 110592 |
| 506 | Ga0495666_0017977 | 3300046526 | Bacteria | 3521 |
| 507 | Ga0495665_0037165 | 3300046531 | Bacteria | 2599 |
| 508 | Ga0495586_0002945 | 3300046535 | Bacteria | 9183 |
| 509 | Ga0495621_0006717 | 3300046539 | Bacteria | 3372 |
| 510 | Ga0495597_0006336 | 3300046542 | Bacteria | 6130 |
| 511 | Ga0495645_0008312 | 3300046543 | Bacteria | 7245 |
| 512 | Ga0495667_0078284 | 3300046559 | Bacteria | 2150 |
| 513 | Ga0495667_0130254 | 3300046559 | Bacteria | 1623 |
| 514 | Ga0495656_0002800 | 3300046615 | Bacteria | 5830 |
| 515 | Ga0495588_0007312 | 3300046674 | Bacteria | 5020 |
| 516 | Ga0495647_0001391 | 3300046681 | Bacteria | 7459 |
| 517 | Ga0495658_0053604 | 3300046683 | Bacteria | 2291 |
| 518 | Ga0495649_0001129 | 3300046694 | Bacteria | 20775 |
| 519 | Ga0495649_0007532 | 3300046694 | Bacteria | 6625 |
| 520 | Ga0495589_0007409 | 3300046794 | Bacteria | 5747 |
| 521 | Ga0495660_0029786 | 3300046810 | Bacteria | 3078 |
| 522 | Ga0495636_0080201 | 3300047318 | Bacteria | 1404 |
| 523 | Ga0495674_0194269 | 3300047319 | Bacteria | 1686 |
| 524 | Ga0495680_0037346 | 3300047322 | Bacteria | 3891 |
| 525 | Ga0495687_000161 | 3300047443 | Bacteria | 100635 |
| 526 | Ga0495684_0052721 | 3300047471 | Bacteria | 3104 |
| 527 | Ga0496100_0136337 | 3300048903 | Bacteria | 1734 |
| 528 | Ga0496101_0019920 | 3300048904 | Bacteria | 4588 |
| 529 | Ga0496102_0004032 | 3300048905 | Bacteria | 12444 |
| 530 | Ga0496104_0059372 | 3300048907 | Bacteria | 3621 |
| 531 | Ga0496104_0108248 | 3300048907 | Bacteria | 2663 |
| 532 | Ga0496106_0013057 | 3300048909 | Bacteria | 6129 |
| 533 | Ga0496107_0012808 | 3300048910 | Bacteria | 5860 |
| 534 | Ga0496108_0112062 | 3300048911 | Bacteria | 2334 |
| 535 | Ga0496109_0032510 | 3300048912 | Bacteria | 4690 |
| 536 | Ga0496110_0010280 | 3300048913 | Bacteria | 7604 |
| 537 | Ga0496110_0345583 | 3300048913 | Bacteria | 1355 |
| 538 | Ga0496111_0037819 | 3300048914 | Bacteria | 3455 |
| 539 | Ga0496111_0148093 | 3300048914 | Bacteria | 1741 |
| 540 | Ga0496113_0065043 | 3300048916 | Bacteria | 2759 |
| 541 | Ga0496114_0055681 | 3300048917 | Bacteria | 3299 |
| 542 | Ga0496114_0071935 | 3300048917 | Bacteria | 2907 |
| 543 | Ga0496115_0112257 | 3300048918 | Bacteria | 2239 |
| 544 | Ga0496121_0005083 | 3300048924 | Bacteria | 17156 |
| 545 | Ga0496124_0000089 | 3300048927 | Bacteria | 192423 |
| 546 | Ga0496124_0030268 | 3300048927 | Bacteria | 4807 |
| 547 | Ga0496125_0008827 | 3300048928 | Bacteria | 10479 |
| 548 | Ga0496126_0048406 | 3300048929 | Bacteria | 3885 |
| 549 | Ga0501291_003448 | 3300049514 | Bacteria | 1967 |
| 550 | Ga0501300_000901 | 3300049523 | Bacteria | 4527 |
| 551 | Ga0501031_0033630 | 3300049568 | Bacteria | 3346 |
| 552 | Ga0501032_0074856 | 3300049569 | Bacteria | 2256 |
| 553 | Ga0501033_0006678 | 3300049570 | Bacteria | 9014 |
| 554 | Ga0501036_0000760 | 3300049572 | Bacteria | 23911 |
| 555 | Ga0501037_0120796 | 3300049573 | Bacteria | 1884 |
| 556 | Ga0501038_0005214 | 3300049574 | Bacteria | 12095 |
| 557 | Ga0501039_0001574 | 3300049575 | Bacteria | 16794 |
| 558 | Ga0501040_0002582 | 3300049576 | Bacteria | 11679 |
| 559 | Ga0501040_0118345 | 3300049576 | Bacteria | 1858 |
| 560 | Ga0501041_0001594 | 3300049577 | Bacteria | 12648 |
| 561 | Ga0501041_0067404 | 3300049577 | Bacteria | 2194 |
| 562 | Ga0501042_0000914 | 3300049578 | Bacteria | 16545 |
| 563 | Ga0501042_0177272 | 3300049578 | Bacteria | 1537 |
| 564 | Ga0501046_0001076 | 3300049580 | Bacteria | 26793 |
| 565 | Ga0501048_0000114 | 3300049582 | Bacteria | 45735 |
| 566 | Ga0501069_0095774 | 3300049585 | Bacteria | 1681 |
| 567 | Ga0501070_0012966 | 3300049586 | Bacteria | 7025 |
| 568 | Ga0501071_0114787 | 3300049587 | Bacteria | 1992 |
| 569 | Ga0501071_0139234 | 3300049587 | Bacteria | 1807 |
| 570 | Ga0501072_0026758 | 3300049588 | Bacteria | 4499 |
| 571 | Ga0501072_0116170 | 3300049588 | Bacteria | 2131 |
| 572 | Ga0501072_0315282 | 3300049588 | Bacteria | 1243 |
| 573 | Ga0501074_0088082 | 3300049590 | Bacteria | 2223 |
| 574 | Ga0501075_0001864 | 3300049591 | Bacteria | 13903 |
| 575 | Ga0501075_0113706 | 3300049591 | Bacteria | 2058 |
| 576 | Ga0501076_0000342 | 3300049592 | Bacteria | 28723 |
| 577 | Ga0501077_0005888 | 3300049593 | Bacteria | 7475 |
| 578 | Ga0501077_0124661 | 3300049593 | Bacteria | 1633 |
| 579 | Ga0501198_000009 | 3300049649 | Bacteria | 122302 |
| 580 | Ga0501201_001318 | 3300049651 | Bacteria | 2328 |
| 581 | Ga0501207_005485 | 3300049654 | Bacteria | 1758 |
| 582 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 583 | Ga0501222_000657 | 3300049662 | Bacteria | 5052 |
| 584 | Ga0501235_017149 | 3300049669 | Bacteria | 1601 |
| 585 | Ga0501225_0030493 | 3300049705 | Bacteria | 1483 |
| 586 | Ga0501079_0003775 | 3300049741 | Bacteria | 11188 |
| 587 | Ga0501079_0216082 | 3300049741 | Bacteria | 1498 |
| 588 | Ga0501080_0051259 | 3300049742 | Bacteria | 3840 |
| 589 | Ga0501080_0065374 | 3300049742 | Bacteria | 3383 |
| 590 | Ga0501081_0001324 | 3300049743 | Bacteria | 15124 |
| 591 | Ga0501083_0062122 | 3300049744 | Bacteria | 2493 |
| 592 | Ga0501267_000705 | 3300049764 | Bacteria | 2681 |
| 593 | Ga0501272_000660 | 3300049769 | Bacteria | 3086 |
| 594 | Ga0501035_0027192 | 3300049822 | Bacteria | 5229 |
| 595 | Ga0501035_0348861 | 3300049822 | Bacteria | 1239 |
| 596 | Ga0501045_0014839 | 3300049824 | Bacteria | 5526 |
| 597 | nmdc:mga03n38_33634_c1 | 3300050490 | Bacteria | 2183 |
| 598 | nmdc:mga0k408_12731_c1 | 3300050493 | Bacteria | 4600 |
| 599 | nmdc:mga0k408_165997_c1 | 3300050493 | Bacteria | 1315 |
| 600 | nmdc:mga0k408_19320_c1 | 3300050493 | Bacteria | 3807 |
| 601 | nmdc:mga0k408_34713_c1 | 3300050493 | Bacteria | 2889 |
| 602 | nmdc:mga0k408_35286_c1 | 3300050493 | Bacteria | 2868 |
| 603 | nmdc:mga0k408_467_c1 | 3300050493 | Bacteria | 22231 |
| 604 | nmdc:mga06z11_30492_c1 | 3300050494 | Bacteria | 2610 |
| 605 | nmdc:mga07m45_11565_c1 | 3300050496 | Bacteria | 4642 |
| 606 | nmdc:mga07m45_12060_c1 | 3300050496 | Bacteria | 4558 |
| 607 | nmdc:mga07m45_2794_c1 | 3300050496 | Bacteria | 8255 |
| 608 | nmdc:mga07m45_3661_c1 | 3300050496 | Bacteria | 7424 |
| 609 | nmdc:mga07m45_44925_c1 | 3300050496 | Bacteria | 2480 |
| 610 | nmdc:mga09592_259_c1 | 3300050508 | Bacteria | 38550 |
| 611 | nmdc:mga09592_462082_c1 | 3300050508 | Bacteria | 1095 |
| 612 | nmdc:mga09592_753_c1 | 3300050508 | Bacteria | 24879 |
| 613 | nmdc:mga0qj67_13066_c1 | 3300050509 | Bacteria | 6271 |
| 614 | nmdc:mga08y16_3602_c1 | 3300050511 | Bacteria | 16080 |
| 615 | nmdc:mga0n895_114768_c1 | 3300050512 | Bacteria | 2711 |
| 616 | nmdc:mga0n895_24790_c1 | 3300050512 | Bacteria | 5658 |
| 617 | nmdc:mga0n895_5415_c1 | 3300050512 | Bacteria | 10663 |
| 618 | nmdc:mga0rr50_505_c1 | 3300050513 | Bacteria | 20786 |
| 619 | nmdc:mga08x19_205057_c1 | 3300050514 | Bacteria | 1352 |
| 620 | nmdc:mga08x19_2237_c1 | 3300050514 | Bacteria | 11817 |
| 621 | nmdc:mga0a205_1519_c1 | 3300050515 | Bacteria | 19827 |
| 622 | nmdc:mga0a205_69598_c1 | 3300050515 | Bacteria | 3397 |
| 623 | nmdc:mga0sz30_14435_c1 | 3300050516 | Bacteria | 3109 |
| 624 | nmdc:mga0sz30_46433_c1 | 3300050516 | Bacteria | 1834 |
| 625 | Ga0500635_0000032 | 3300053080 | Bacteria | 98869 |
| 626 | Ga0500651_0145825 | 3300053093 | Bacteria | 1424 |
| 627 | Ga0500608_088520 | 3300053122 | Bacteria | 1451 |
| 628 | Ga0500658_0002556 | 3300053134 | Bacteria | 7042 |
| 629 | Ga0500616_0028967 | 3300053153 | Bacteria | 3049 |
| 630 | Ga0500622_0018407 | 3300053156 | Bacteria | 3714 |
| 631 | Ga0501084_0000653 | 3300054114 | Bacteria | 26449 |
| 632 | Ga0501084_0178297 | 3300054114 | Bacteria | 1794 |
| 633 | Ga0501082_0007474 | 3300060353 | Bacteria | 9428 |
| 634 | Ga0530510_0000053 | 3300061734 | Bacteria | 54605 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_2571749 | Ga0451853_2571749_10_771 | 230 |
| 2 | 3300050508 | nmdc:mga09592_462082_c1 | nmdc:mga09592_462082_c1_223_1068 | 250 |
| 3 | 3300049741 | Ga0501079_0216082 | Ga0501079_0216082_639_1484 | 265 |
| 4 | 3300007076 | Ga0075435_100003441 | Ga0075435_1000034413 | 266 |
| 5 | 3300050515 | nmdc:mga0a205_69598_c1 | nmdc:mga0a205_69598_c1_2052_2978 | 266 |
| 6 | 3300035117 | Ga0373953_0034556 | Ga0373953_0034556_804_1727 | 272 |
| 7 | 3300035172 | Ga0373955_0136469 | Ga0373955_0136469_384_1307 | 272 |
| 8 | 3300035410 | Ga0373924_0005626 | Ga0373924_0005626_2685_3608 | 272 |
| 9 | 3300035724 | Ga0373933_0014633 | Ga0373933_0014633_679_1602 | 272 |
| 10 | 3300036401 | Ga0373937_0003159 | Ga0373937_0003159_11397_12320 | 272 |
| 11 | 3300046559 | Ga0495667_0078284 | Ga0495667_0078284_550_1473 | 272 |
| 12 | 3300047322 | Ga0495680_0037346 | Ga0495680_0037346_425_1348 | 272 |
| 13 | 3300025986 | Ga0207658_10381645 | Ga0207658_103816451 | 274 |
| 14 | 3300006846 | Ga0075430_100052839 | Ga0075430_1000528394 | 275 |
| 15 | 3300049568 | Ga0501031_0033630 | Ga0501031_0033630_1672_2595 | 275 |
| 16 | 3300049569 | Ga0501032_0074856 | Ga0501032_0074856_318_1241 | 275 |
| 17 | 3300049570 | Ga0501033_0006678 | Ga0501033_0006678_6559_7482 | 275 |
| 18 | 3300049572 | Ga0501036_0000760 | Ga0501036_0000760_5145_6068 | 275 |
| 19 | 3300049573 | Ga0501037_0120796 | Ga0501037_0120796_306_1229 | 275 |
| 20 | 3300049574 | Ga0501038_0005214 | Ga0501038_0005214_10451_11374 | 275 |
| 21 | 3300049575 | Ga0501039_0001574 | Ga0501039_0001574_11036_11959 | 275 |
| 22 | 3300049576 | Ga0501040_0002582 | Ga0501040_0002582_4018_4941 | 275 |
| 23 | 3300049577 | Ga0501041_0001594 | Ga0501041_0001594_4357_5280 | 275 |
| 24 | 3300049578 | Ga0501042_0000914 | Ga0501042_0000914_655_1578 | 275 |
| 25 | 3300049580 | Ga0501046_0001076 | Ga0501046_0001076_11008_11931 | 275 |
| 26 | 3300049582 | Ga0501048_0000114 | Ga0501048_0000114_44693_45616 | 275 |
| 27 | 3300049587 | Ga0501071_0114787 | Ga0501071_0114787_971_1894 | 275 |
| 28 | 3300049588 | Ga0501072_0026758 | Ga0501072_0026758_2490_3413 | 275 |
| 29 | 3300049590 | Ga0501074_0088082 | Ga0501074_0088082_452_1375 | 275 |
| 30 | 3300049591 | Ga0501075_0001864 | Ga0501075_0001864_6722_7645 | 275 |
| 31 | 3300049592 | Ga0501076_0000342 | Ga0501076_0000342_3815_4738 | 275 |
| 32 | 3300049593 | Ga0501077_0005888 | Ga0501077_0005888_5769_6692 | 275 |
| 33 | 3300049741 | Ga0501079_0003775 | Ga0501079_0003775_1740_2663 | 275 |
| 34 | 3300049742 | Ga0501080_0065374 | Ga0501080_0065374_1742_2665 | 275 |
| 35 | 3300049743 | Ga0501081_0001324 | Ga0501081_0001324_365_1288 | 275 |
| 36 | 3300049744 | Ga0501083_0062122 | Ga0501083_0062122_783_1706 | 275 |
| 37 | 3300049822 | Ga0501035_0027192 | Ga0501035_0027192_3617_4540 | 275 |
| 38 | 3300049824 | Ga0501045_0014839 | Ga0501045_0014839_2889_3812 | 275 |
| 39 | 3300050496 | nmdc:mga07m45_12060_c1 | nmdc:mga07m45_12060_c1_46_873 | 275 |
| 40 | 3300050509 | nmdc:mga0qj67_13066_c1 | nmdc:mga0qj67_13066_c1_4406_5329 | 275 |
| 41 | 3300054114 | Ga0501084_0000653 | Ga0501084_0000653_18120_19043 | 275 |
| 42 | 3300060353 | Ga0501082_0007474 | Ga0501082_0007474_6788_7711 | 275 |
| 43 | 3300061734 | Ga0530510_0000053 | Ga0530510_0000053_28546_29469 | 275 |
| 44 | 3300005340 | Ga0070689_100050720 | Ga0070689_1000507202 | 276 |
| 45 | 3300005354 | Ga0070675_100075040 | Ga0070675_1000750402 | 276 |
| 46 | 3300005365 | Ga0070688_100148805 | Ga0070688_1001488052 | 276 |
| 47 | 3300014326 | Ga0157380_10074896 | Ga0157380_100748962 | 276 |
| 48 | 3300025926 | Ga0207659_10010803 | Ga0207659_100108032 | 276 |
| 49 | 3300025936 | Ga0207670_10129667 | Ga0207670_101296672 | 276 |
| 50 | 3300025942 | Ga0207689_10021436 | Ga0207689_100214366 | 276 |
| 51 | 3300035118 | Ga0373954_0000012 | Ga0373954_0000012_43027_43941 | 276 |
| 52 | 3300036401 | Ga0373937_0001168 | Ga0373937_0001168_12248_13162 | 276 |
| 53 | 3300049593 | Ga0501077_0124661 | Ga0501077_0124661_675_1595 | 277 |
| 54 | 3300003203 | JGI25406J46586_10026376 | JGI25406J46586_100263762 | 278 |
| 55 | 3300005985 | Ga0081539_10000668 | Ga0081539_1000066826 | 278 |
| 56 | 3300007265 | Ga0099794_10040059 | Ga0099794_100400593 | 278 |
| 57 | 3300035083 | Ga0373926_0002214 | Ga0373926_0002214_2328_3245 | 278 |
| 58 | 3300035089 | Ga0373944_0102750 | Ga0373944_0102750_39_956 | 278 |
| 59 | 3300035113 | Ga0373936_0009128 | Ga0373936_0009128_1875_2792 | 278 |
| 60 | 3300035116 | Ga0373945_0012050 | Ga0373945_0012050_694_1611 | 278 |
| 61 | 3300035692 | Ga0373935_0012567 | Ga0373935_0012567_3143_4060 | 278 |
| 62 | 3300035725 | Ga0373947_0011345 | Ga0373947_0011345_1730_2647 | 278 |
| 63 | 3300037068 | Ga0373925_0048251 | Ga0373925_0048251_878_1795 | 278 |
| 64 | 3300046472 | Ga0495580_0000775 | Ga0495580_0000775_15491_16408 | 278 |
| 65 | 3300046473 | Ga0495582_0031960 | Ga0495582_0031960_774_1691 | 278 |
| 66 | 3300046526 | Ga0495666_0017977 | Ga0495666_0017977_1298_2215 | 278 |
| 67 | 3300046531 | Ga0495665_0037165 | Ga0495665_0037165_444_1361 | 278 |
| 68 | 3300046535 | Ga0495586_0002945 | Ga0495586_0002945_773_1690 | 278 |
| 69 | 3300046674 | Ga0495588_0007312 | Ga0495588_0007312_2266_3183 | 278 |
| 70 | 3300046681 | Ga0495647_0001391 | Ga0495647_0001391_5677_6594 | 278 |
| 71 | 3300046683 | Ga0495658_0053604 | Ga0495658_0053604_1248_2165 | 278 |
| 72 | 3300005329 | Ga0070683_100113954 | Ga0070683_1001139542 | 279 |
| 73 | 3300005544 | Ga0070686_100007857 | Ga0070686_1000078575 | 279 |
| 74 | 3300005545 | Ga0070695_100085907 | Ga0070695_1000859072 | 279 |
| 75 | 3300005617 | Ga0068859_100547422 | Ga0068859_1005474222 | 279 |
| 76 | 3300005618 | Ga0068864_100131830 | Ga0068864_1001318302 | 279 |
| 77 | 3300005841 | Ga0068863_100509302 | Ga0068863_1005093022 | 279 |
| 78 | 3300006237 | Ga0097621_100006968 | Ga0097621_1000069689 | 279 |
| 79 | 3300006358 | Ga0068871_100001023 | Ga0068871_1000010235 | 279 |
| 80 | 3300006852 | Ga0075433_10026884 | Ga0075433_100268843 | 279 |
| 81 | 3300006871 | Ga0075434_100001188 | Ga0075434_10000118824 | 279 |
| 82 | 3300006871 | Ga0075434_100010325 | Ga0075434_1000103257 | 279 |
| 83 | 3300006914 | Ga0075436_100000075 | Ga0075436_10000007527 | 279 |
| 84 | 3300006931 | Ga0097620_100547347 | Ga0097620_1005473472 | 279 |
| 85 | 3300007076 | Ga0075435_100000116 | Ga0075435_10000011647 | 279 |
| 86 | 3300009094 | Ga0111539_10109921 | Ga0111539_101099213 | 279 |
| 87 | 3300025944 | Ga0207661_10093957 | Ga0207661_100939572 | 279 |
| 88 | 3300026095 | Ga0207676_10039746 | Ga0207676_100397462 | 279 |
| 89 | 3300035088 | Ga0373940_0033745 | Ga0373940_0033745_215_1132 | 279 |
| 90 | 3300035241 | Ga0373961_0032709 | Ga0373961_0032709_204_1124 | 279 |
| 91 | 3300046454 | Ga0495592_0003983 | Ga0495592_0003983_73_1002 | 279 |
| 92 | 3300050511 | nmdc:mga08y16_3602_c1 | nmdc:mga08y16_3602_c1_951_1868 | 279 |
| 93 | 3300050512 | nmdc:mga0n895_24790_c1 | nmdc:mga0n895_24790_c1_484_1413 | 279 |
| 94 | 3300050512 | nmdc:mga0n895_5415_c1 | nmdc:mga0n895_5415_c1_591_1508 | 279 |
| 95 | 3300050513 | nmdc:mga0rr50_505_c1 | nmdc:mga0rr50_505_c1_16073_16990 | 279 |
| 96 | 3300050514 | nmdc:mga08x19_2237_c1 | nmdc:mga08x19_2237_c1_2547_3464 | 279 |
| 97 | 3300050515 | nmdc:mga0a205_1519_c1 | nmdc:mga0a205_1519_c1_9965_10882 | 279 |
| 98 | 3300047318 | Ga0495636_0080201 | Ga0495636_0080201_415_1335 | 280 |
| 99 | 3300005330 | Ga0070690_100000131 | Ga0070690_10000013141 | 281 |
| 100 | 3300005334 | Ga0068869_100002847 | Ga0068869_1000028473 | 281 |
| 101 | 3300005335 | Ga0070666_10142092 | Ga0070666_101420922 | 281 |
| 102 | 3300005336 | Ga0070680_100014274 | Ga0070680_1000142743 | 281 |
| 103 | 3300005337 | Ga0070682_100003841 | Ga0070682_1000038412 | 281 |
| 104 | 3300005338 | Ga0068868_100001473 | Ga0068868_1000014732 | 281 |
| 105 | 3300005340 | Ga0070689_100001412 | Ga0070689_10000141210 | 281 |
| 106 | 3300005341 | Ga0070691_10001649 | Ga0070691_100016493 | 281 |
| 107 | 3300005343 | Ga0070687_100000176 | Ga0070687_10000017617 | 281 |
| 108 | 3300005355 | Ga0070671_100172752 | Ga0070671_1001727522 | 281 |
| 109 | 3300005365 | Ga0070688_100054248 | Ga0070688_1000542483 | 281 |
| 110 | 3300005438 | Ga0070701_10000060 | Ga0070701_1000006016 | 281 |
| 111 | 3300005440 | Ga0070705_100000431 | Ga0070705_10000043126 | 281 |
| 112 | 3300005440 | Ga0070705_100069781 | Ga0070705_1000697811 | 281 |
| 113 | 3300005441 | Ga0070700_100001389 | Ga0070700_1000013897 | 281 |
| 114 | 3300005444 | Ga0070694_100000136 | Ga0070694_1000001364 | 281 |
| 115 | 3300005457 | Ga0070662_100178683 | Ga0070662_1001786832 | 281 |
| 116 | 3300005459 | Ga0068867_100002957 | Ga0068867_10000295710 | 281 |
| 117 | 3300005518 | Ga0070699_100200789 | Ga0070699_1002007892 | 281 |
| 118 | 3300005530 | Ga0070679_100002086 | Ga0070679_10000208617 | 281 |
| 119 | 3300005539 | Ga0068853_100367368 | Ga0068853_1003673682 | 281 |
| 120 | 3300005544 | Ga0070686_100000285 | Ga0070686_1000002859 | 281 |
| 121 | 3300005545 | Ga0070695_100001799 | Ga0070695_1000017994 | 281 |
| 122 | 3300005546 | Ga0070696_100001197 | Ga0070696_10000119714 | 281 |
| 123 | 3300005547 | Ga0070693_100000507 | Ga0070693_10000050714 | 281 |
| 124 | 3300005549 | Ga0070704_100000103 | Ga0070704_10000010334 | 281 |
| 125 | 3300005563 | Ga0068855_100001779 | Ga0068855_10000177914 | 281 |
| 126 | 3300005614 | Ga0068856_100032369 | Ga0068856_1000323693 | 281 |
| 127 | 3300005615 | Ga0070702_100000039 | Ga0070702_10000003934 | 281 |
| 128 | 3300005617 | Ga0068859_100000420 | Ga0068859_10000042015 | 281 |
| 129 | 3300005718 | Ga0068866_10000153 | Ga0068866_1000015315 | 281 |
| 130 | 3300005719 | Ga0068861_100000987 | Ga0068861_1000009872 | 281 |
| 131 | 3300005842 | Ga0068858_100024401 | Ga0068858_1000244013 | 281 |
| 132 | 3300005843 | Ga0068860_100002022 | Ga0068860_10000202210 | 281 |
| 133 | 3300005844 | Ga0068862_100004968 | Ga0068862_1000049687 | 281 |
| 134 | 3300006237 | Ga0097621_100004055 | Ga0097621_1000040559 | 281 |
| 135 | 3300006358 | Ga0068871_100001380 | Ga0068871_10000138011 | 281 |
| 136 | 3300006844 | Ga0075428_100000109 | Ga0075428_10000010959 | 281 |
| 137 | 3300006881 | Ga0068865_100006284 | Ga0068865_1000062843 | 281 |
| 138 | 3300006931 | Ga0097620_100000420 | Ga0097620_10000042015 | 281 |
| 139 | 3300009098 | Ga0105245_10000533 | Ga0105245_1000053326 | 281 |
| 140 | 3300009147 | Ga0114129_10061813 | Ga0114129_100618133 | 281 |
| 141 | 3300009148 | Ga0105243_10000495 | Ga0105243_1000049515 | 281 |
| 142 | 3300009174 | Ga0105241_10214946 | Ga0105241_102149462 | 281 |
| 143 | 3300009176 | Ga0105242_10000248 | Ga0105242_1000024816 | 281 |
| 144 | 3300009177 | Ga0105248_10074684 | Ga0105248_100746845 | 281 |
| 145 | 3300009553 | Ga0105249_10012063 | Ga0105249_100120634 | 281 |
| 146 | 3300010375 | Ga0105239_10072973 | Ga0105239_100729733 | 281 |
| 147 | 3300013297 | Ga0157378_10000387 | Ga0157378_1000038718 | 281 |
| 148 | 3300014745 | Ga0157377_10054727 | Ga0157377_100547272 | 281 |
| 149 | 3300014968 | Ga0157379_10182479 | Ga0157379_101824792 | 281 |
| 150 | 3300025899 | Ga0207642_10000130 | Ga0207642_1000013028 | 281 |
| 151 | 3300025917 | Ga0207660_10000756 | Ga0207660_100007562 | 281 |
| 152 | 3300025918 | Ga0207662_10000095 | Ga0207662_1000009535 | 281 |
| 153 | 3300025921 | Ga0207652_10003750 | Ga0207652_100037509 | 281 |
| 154 | 3300025927 | Ga0207687_10000432 | Ga0207687_1000043214 | 281 |
| 155 | 3300025934 | Ga0207686_10001368 | Ga0207686_1000136814 | 281 |
| 156 | 3300025935 | Ga0207709_10001646 | Ga0207709_100016463 | 281 |
| 157 | 3300025936 | Ga0207670_10002845 | Ga0207670_100028452 | 281 |
| 158 | 3300025938 | Ga0207704_10000281 | Ga0207704_1000028111 | 281 |
| 159 | 3300025942 | Ga0207689_10000977 | Ga0207689_100009772 | 281 |
| 160 | 3300025949 | Ga0207667_10005008 | Ga0207667_1000500810 | 281 |
| 161 | 3300025961 | Ga0207712_10002627 | Ga0207712_100026272 | 281 |
| 162 | 3300025981 | Ga0207640_10004566 | Ga0207640_1000456610 | 281 |
| 163 | 3300026023 | Ga0207677_10002945 | Ga0207677_100029452 | 281 |
| 164 | 3300026035 | Ga0207703_10132339 | Ga0207703_101323392 | 281 |
| 165 | 3300026041 | Ga0207639_10353206 | Ga0207639_103532061 | 281 |
| 166 | 3300026075 | Ga0207708_10000551 | Ga0207708_100005512 | 281 |
| 167 | 3300026078 | Ga0207702_10061074 | Ga0207702_100610742 | 281 |
| 168 | 3300026089 | Ga0207648_10000513 | Ga0207648_1000051317 | 281 |
| 169 | 3300026118 | Ga0207675_100001063 | Ga0207675_1000010632 | 281 |
| 170 | 3300027907 | Ga0207428_10036572 | Ga0207428_100365721 | 281 |
| 171 | 3300028380 | Ga0268265_10006650 | Ga0268265_1000665010 | 281 |
| 172 | 3300028381 | Ga0268264_10000827 | Ga0268264_1000082717 | 281 |
| 173 | 3300034817 | Ga0373948_0002608 | Ga0373948_0002608_334_1251 | 281 |
| 174 | 3300035085 | Ga0373929_0029969 | Ga0373929_0029969_138_1055 | 281 |
| 175 | 3300035207 | Ga0373942_0004661 | Ga0373942_0004661_930_1847 | 281 |
| 176 | 3300035691 | Ga0373931_0011038 | Ga0373931_0011038_115_1032 | 281 |
| 177 | 3300035691 | Ga0373931_0012262 | Ga0373931_0012262_81_998 | 281 |
| 178 | 3300035691 | Ga0373931_0066263 | Ga0373931_0066263_734_1651 | 281 |
| 179 | 3300044712 | Ga0453684_0235914 | Ga0453684_0235914_205_1122 | 281 |
| 180 | 3300045051 | Ga0451576_0018377 | Ga0451576_0018377_4471_5388 | 281 |
| 181 | 3300045051 | Ga0451576_0057691 | Ga0451576_0057691_791_1708 | 281 |
| 182 | 3300045051 | Ga0451576_0197311 | Ga0451576_0197311_1037_1954 | 281 |
| 183 | 3300046518 | Ga0495631_0035448 | Ga0495631_0035448_30_893 | 281 |
| 184 | 3300050508 | nmdc:mga09592_259_c1 | nmdc:mga09592_259_c1_36305_37222 | 281 |
| 185 | 3300035121 | Ga0373960_0030396 | Ga0373960_0030396_439_1359 | 282 |
| 186 | 3300049822 | Ga0501035_0348861 | Ga0501035_0348861_290_1210 | 282 |
| 187 | 3300027671 | Ga0209588_1003962 | Ga0209588_10039625 | 283 |
| 188 | 3300046615 | Ga0495656_0002800 | Ga0495656_0002800_2779_3696 | 283 |
| 189 | 3300049588 | Ga0501072_0315282 | Ga0501072_0315282_46_972 | 284 |
| 190 | 3300049587 | Ga0501071_0139234 | Ga0501071_0139234_513_1430 | 285 |
| 191 | 3300049577 | Ga0501041_0067404 | Ga0501041_0067404_186_1103 | 286 |
| 192 | 3300049578 | Ga0501042_0177272 | Ga0501042_0177272_35_952 | 286 |
| 193 | 3300049588 | Ga0501072_0116170 | Ga0501072_0116170_528_1445 | 286 |
| 194 | 3300049591 | Ga0501075_0113706 | Ga0501075_0113706_611_1528 | 286 |
| 195 | 3300054114 | Ga0501084_0178297 | Ga0501084_0178297_794_1711 | 286 |
| 196 | 3300027360 | Ga0209969_1005553 | Ga0209969_10055532 | 287 |
| 197 | 3300027378 | Ga0209981_1001462 | Ga0209981_10014624 | 287 |
| 198 | 3300027526 | Ga0209968_1003104 | Ga0209968_10031042 | 287 |
| 199 | 3300037471 | Ga0395905_0056089 | Ga0395905_0056089_838_1761 | 287 |
| 200 | 3300037418 | Ga0395900_0000147 | Ga0395900_0000147_41676_42698 | 288 |
| 201 | 3300037466 | Ga0395898_0000747 | Ga0395898_0000747_55142_56164 | 288 |
| 202 | 3300037471 | Ga0395905_0015871 | Ga0395905_0015871_3786_4709 | 288 |
| 203 | 3300044684 | Ga0466966_0008995 | Ga0466966_0008995_1693_2616 | 288 |
| 204 | 3300044901 | Ga0466960_0007896 | Ga0466960_0007896_3361_4284 | 288 |
| 205 | 3300049576 | Ga0501040_0118345 | Ga0501040_0118345_472_1395 | 288 |
| 206 | 3300026089 | Ga0207648_10336188 | Ga0207648_103361881 | 289 |
| 207 | 3300005347 | Ga0070668_100090644 | Ga0070668_1000906442 | 290 |
| 208 | 3300005353 | Ga0070669_100028464 | Ga0070669_1000284641 | 290 |
| 209 | 3300005356 | Ga0070674_100140579 | Ga0070674_1001405791 | 290 |
| 210 | 3300014968 | Ga0157379_10009677 | Ga0157379_100096776 | 290 |
| 211 | 3300025937 | Ga0207669_10258435 | Ga0207669_102584351 | 290 |
| 212 | 3300025972 | Ga0207668_10081409 | Ga0207668_100814092 | 290 |
| 213 | 3300031665 | Ga0316575_10011575 | Ga0316575_100115754 | 290 |
| 214 | 3300031691 | Ga0316579_10008116 | Ga0316579_100081163 | 290 |
| 215 | 3300031727 | Ga0316576_10012981 | Ga0316576_100129813 | 290 |
| 216 | 3300031728 | Ga0316578_10138337 | Ga0316578_101383372 | 290 |
| 217 | 3300031733 | Ga0316577_10011701 | Ga0316577_100117011 | 290 |
| 218 | 3300032002 | Ga0307416_100283942 | Ga0307416_1002839422 | 290 |
| 219 | 3300032133 | Ga0316583_10034490 | Ga0316583_100344902 | 290 |
| 220 | 3300036712 | Ga0316584_0219175 | Ga0316584_0219175_191_1153 | 290 |
| 221 | 3300046539 | Ga0495621_0006717 | Ga0495621_0006717_584_1507 | 290 |
| 222 | 3300048927 | Ga0496124_0000089 | Ga0496124_0000089_174135_175058 | 290 |
| 223 | 3300031649 | Ga0307514_10000420 | Ga0307514_1000042033 | 291 |
| 224 | 3300028794 | Ga0307515_10000037 | Ga0307515_1000003734 | 292 |
| 225 | 3300042876 | Ga0451577_0002674 | Ga0451577_0002674_19297_20217 | 292 |
| 226 | 3300044656 | Ga0466969_0000156 | Ga0466969_0000156_35865_36788 | 295 |
| 227 | 3300028794 | Ga0307515_10000585 | Ga0307515_1000058558 | 296 |
| 228 | 3300031616 | Ga0307508_10000940 | Ga0307508_1000094023 | 296 |
| 229 | 3300031649 | Ga0307514_10005696 | Ga0307514_100056966 | 296 |
| 230 | 3300033179 | Ga0307507_10012802 | Ga0307507_100128029 | 296 |
| 231 | 3300036647 | Ga0316582_0015425 | Ga0316582_0015425_3307_4242 | 296 |
| 232 | 3300036712 | Ga0316584_0100553 | Ga0316584_0100553_129_1064 | 296 |
| 233 | 3300042876 | Ga0451577_0006991 | Ga0451577_0006991_2989_3912 | 296 |
| 234 | iso_pu_bacteria | 2547132512 | 2548847179 | 296 |
| 235 | iso_pu_bacteria | 2574179768 | 2574429732 | 296 |
| 236 | iso_pu_bacteria | 2891633521 | 2891635113 | 296 |
| 237 | iso_pu_bacteria | 639633007 | 639785200 | 296 |
| 238 | 3300035398 | Ga0316574_0166704 | Ga0316574_0166704_68_1024 | 297 |
| 239 | 3300006195 | Ga0075366_10013063 | Ga0075366_100130632 | 298 |
| 240 | 3300042876 | Ga0451577_0075638 | Ga0451577_0075638_922_1875 | 298 |
| 241 | 3300005328 | Ga0070676_10001356 | Ga0070676_100013563 | 299 |
| 242 | 3300005334 | Ga0068869_100009625 | Ga0068869_1000096255 | 299 |
| 243 | 3300005354 | Ga0070675_100081783 | Ga0070675_1000817832 | 299 |
| 244 | 3300005355 | Ga0070671_100125184 | Ga0070671_1001251843 | 299 |
| 245 | 3300005364 | Ga0070673_100205029 | Ga0070673_1002050292 | 299 |
| 246 | 3300005543 | Ga0070672_100160270 | Ga0070672_1001602702 | 299 |
| 247 | 3300009098 | Ga0105245_10124707 | Ga0105245_101247073 | 299 |
| 248 | 3300025893 | Ga0207682_10125522 | Ga0207682_101255222 | 299 |
| 249 | 3300025907 | Ga0207645_10002661 | Ga0207645_100026618 | 299 |
| 250 | 3300025926 | Ga0207659_10045916 | Ga0207659_100459162 | 299 |
| 251 | 3300025927 | Ga0207687_10179336 | Ga0207687_101793362 | 299 |
| 252 | 3300025931 | Ga0207644_10159112 | Ga0207644_101591122 | 299 |
| 253 | 3300025940 | Ga0207691_10056935 | Ga0207691_100569353 | 299 |
| 254 | 3300025942 | Ga0207689_10013759 | Ga0207689_100137592 | 299 |
| 255 | 3300025960 | Ga0207651_10016907 | Ga0207651_100169073 | 299 |
| 256 | 3300026023 | Ga0207677_10138733 | Ga0207677_101387332 | 299 |
| 257 | 3300026089 | Ga0207648_10003056 | Ga0207648_1000305616 | 299 |
| 258 | 3300026116 | Ga0207674_10011502 | Ga0207674_100115025 | 299 |
| 259 | 3300026121 | Ga0207683_10270134 | Ga0207683_102701342 | 299 |
| 260 | 3300031507 | Ga0307509_10006059 | Ga0307509_1000605914 | 299 |
| 261 | 3300031649 | Ga0307514_10059056 | Ga0307514_100590563 | 299 |
| 262 | 3300033180 | Ga0307510_10001144 | Ga0307510_1000114418 | 299 |
| 263 | 3300046454 | Ga0495592_0004109 | Ga0495592_0004109_4974_5897 | 299 |
| 264 | 3300006846 | Ga0075430_100094035 | Ga0075430_1000940353 | 300 |
| 265 | 3300031238 | Ga0265332_10000026 | Ga0265332_1000002678 | 300 |
| 266 | 3300031238 | Ga0265332_10011489 | Ga0265332_100114891 | 300 |
| 267 | 3300035691 | Ga0373931_0033076 | Ga0373931_0033076_526_1449 | 300 |
| 268 | 3300006195 | Ga0075366_10000934 | Ga0075366_1000093410 | 302 |
| 269 | 3300035398 | Ga0316574_0145691 | Ga0316574_0145691_53_1015 | 302 |
| 270 | 3300050493 | nmdc:mga0k408_467_c1 | nmdc:mga0k408_467_c1_9340_10263 | 302 |
| 271 | iso_pu_bacteria | 2643221544 | 2643744297 | 302 |
| 272 | iso_pu_bacteria | 2643221585 | 2643934838 | 302 |
| 273 | iso_pu_bacteria | 2643221656 | 2644316325 | 302 |
| 274 | iso_pu_bacteria | 2738541337 | 2739053786 | 302 |
| 275 | iso_pu_bacteria | 2831864461 | 2831864720 | 302 |
| 276 | iso_pu_bacteria | 2886848708 | 2886852515 | 302 |
| 277 | 3300039062 | Ga0400483_275507 | Ga0400483_275507_655_1581 | 303 |
| 278 | iso_pu_bacteria | 2643221639 | 2644220603 | 303 |
| 279 | iso_pu_bacteria | 2643221646 | 2644259526 | 303 |
| 280 | 3300005356 | Ga0070674_100163900 | Ga0070674_1001639002 | 304 |
| 281 | 3300005459 | Ga0068867_100039231 | Ga0068867_1000392312 | 304 |
| 282 | 3300049585 | Ga0501069_0095774 | Ga0501069_0095774_309_1250 | 304 |
| 283 | 3300049586 | Ga0501070_0012966 | Ga0501070_0012966_2035_2976 | 304 |
| 284 | 3300049742 | Ga0501080_0051259 | Ga0501080_0051259_913_1854 | 304 |
| 285 | 3300021361 | Ga0213872_10000022 | Ga0213872_1000002289 | 305 |
| 286 | 3300021361 | Ga0213872_10002263 | Ga0213872_100022635 | 305 |
| 287 | 3300039447 | Ga0436361_0675000 | Ga0436361_0675000_43028_43945 | 305 |
| 288 | 3300039447 | Ga0436361_1070817 | Ga0436361_1070817_5238_6155 | 305 |
| 289 | iso_pu_bacteria | 2881101125 | 2881104330 | 305 |
| 290 | 3300003320 | rootH2_10012361 | rootH2_100123616 | 306 |
| 291 | 3300003322 | rootL2_10005926 | rootL2_100059266 | 306 |
| 292 | 3300003323 | rootH1_10012808 | rootH1_100128084 | 306 |
| 293 | 3300003771 | Ga0055526_1004255 | Ga0055526_10042555 | 306 |
| 294 | 3300003775 | Ga0055524_1001100 | Ga0055524_100110010 | 306 |
| 295 | 3300003775 | Ga0055524_1002597 | Ga0055524_10025978 | 306 |
| 296 | 3300003790 | Ga0055528_1027970 | Ga0055528_10279702 | 306 |
| 297 | 3300003791 | Ga0055530_10030464 | Ga0055530_100304641 | 306 |
| 298 | 3300003794 | Ga0055531_10000031 | Ga0055531_100000317 | 306 |
| 299 | 3300003794 | Ga0055531_10001122 | Ga0055531_100011226 | 306 |
| 300 | 3300003794 | Ga0055531_10002152 | Ga0055531_1000215211 | 306 |
| 301 | 3300005262 | Ga0065165_1000407 | Ga0065165_100040734 | 306 |
| 302 | 3300005262 | Ga0065165_1000455 | Ga0065165_100045518 | 306 |
| 303 | 3300005295 | Ga0065707_10087928 | Ga0065707_100879282 | 306 |
| 304 | 3300005327 | Ga0070658_10198185 | Ga0070658_101981852 | 306 |
| 305 | 3300005331 | Ga0070670_100007040 | Ga0070670_1000070402 | 306 |
| 306 | 3300005354 | Ga0070675_100121182 | Ga0070675_1001211822 | 306 |
| 307 | 3300005364 | Ga0070673_100282017 | Ga0070673_1002820172 | 306 |
| 308 | 3300005367 | Ga0070667_100003068 | Ga0070667_10000306813 | 306 |
| 309 | 3300005367 | Ga0070667_100331694 | Ga0070667_1003316941 | 306 |
| 310 | 3300005455 | Ga0070663_100069192 | Ga0070663_1000691922 | 306 |
| 311 | 3300005457 | Ga0070662_100033338 | Ga0070662_1000333383 | 306 |
| 312 | 3300005467 | Ga0070706_100002267 | Ga0070706_10000226712 | 306 |
| 313 | 3300005543 | Ga0070672_100265837 | Ga0070672_1002658372 | 306 |
| 314 | 3300005577 | Ga0068857_100019546 | Ga0068857_1000195464 | 306 |
| 315 | 3300005841 | Ga0068863_100459917 | Ga0068863_1004599171 | 306 |
| 316 | 3300005842 | Ga0068858_100423931 | Ga0068858_1004239311 | 306 |
| 317 | 3300006177 | Ga0075362_10028980 | Ga0075362_100289802 | 306 |
| 318 | 3300006178 | Ga0075367_10003732 | Ga0075367_100037326 | 306 |
| 319 | 3300006178 | Ga0075367_10062680 | Ga0075367_100626802 | 306 |
| 320 | 3300006178 | Ga0075367_10064275 | Ga0075367_100642752 | 306 |
| 321 | 3300006186 | Ga0075369_10004347 | Ga0075369_100043475 | 306 |
| 322 | 3300006195 | Ga0075366_10005540 | Ga0075366_100055405 | 306 |
| 323 | 3300006195 | Ga0075366_10006445 | Ga0075366_100064453 | 306 |
| 324 | 3300006195 | Ga0075366_10020955 | Ga0075366_100209553 | 306 |
| 325 | 3300006195 | Ga0075366_10071147 | Ga0075366_100711472 | 306 |
| 326 | 3300006237 | Ga0097621_100198317 | Ga0097621_1001983172 | 306 |
| 327 | 3300006237 | Ga0097621_100297473 | Ga0097621_1002974732 | 306 |
| 328 | 3300006353 | Ga0075370_10003984 | Ga0075370_100039843 | 306 |
| 329 | 3300006353 | Ga0075370_10047254 | Ga0075370_100472542 | 306 |
| 330 | 3300006353 | Ga0075370_10105697 | Ga0075370_101056973 | 306 |
| 331 | 3300006358 | Ga0068871_100284424 | Ga0068871_1002844242 | 306 |
| 332 | 3300006944 | Ga0099823_1000003 | Ga0099823_10000036 | 306 |
| 333 | 3300012497 | Ga0157319_1000002 | Ga0157319_1000002143 | 306 |
| 334 | 3300013308 | Ga0157375_10452315 | Ga0157375_104523152 | 306 |
| 335 | 3300014969 | Ga0157376_10079824 | Ga0157376_100798243 | 306 |
| 336 | 3300025273 | Ga0209673_1004160 | Ga0209673_10041605 | 306 |
| 337 | 3300025273 | Ga0209673_1009288 | Ga0209673_10092883 | 306 |
| 338 | 3300025295 | Ga0209564_1000030 | Ga0209564_1000030408 | 306 |
| 339 | 3300025298 | Ga0209050_1006312 | Ga0209050_10063128 | 306 |
| 340 | 3300025298 | Ga0209050_1014557 | Ga0209050_10145572 | 306 |
| 341 | 3300025299 | Ga0209256_1002110 | Ga0209256_100211011 | 306 |
| 342 | 3300025299 | Ga0209256_1002225 | Ga0209256_10022258 | 306 |
| 343 | 3300025303 | Ga0209051_1001516 | Ga0209051_100151617 | 306 |
| 344 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016690 | 306 |
| 345 | 3300025304 | Ga0209257_1001314 | Ga0209257_100131416 | 306 |
| 346 | 3300025304 | Ga0209257_1003977 | Ga0209257_10039779 | 306 |
| 347 | 3300025901 | Ga0207688_10092622 | Ga0207688_100926222 | 306 |
| 348 | 3300025910 | Ga0207684_10003451 | Ga0207684_100034515 | 306 |
| 349 | 3300025914 | Ga0207671_10013996 | Ga0207671_100139963 | 306 |
| 350 | 3300025925 | Ga0207650_10025621 | Ga0207650_100256211 | 306 |
| 351 | 3300025940 | Ga0207691_10287236 | Ga0207691_102872362 | 306 |
| 352 | 3300025960 | Ga0207651_10141390 | Ga0207651_101413902 | 306 |
| 353 | 3300026041 | Ga0207639_10095797 | Ga0207639_100957973 | 306 |
| 354 | 3300026095 | Ga0207676_10006862 | Ga0207676_100068622 | 306 |
| 355 | 3300026116 | Ga0207674_10032551 | Ga0207674_100325514 | 306 |
| 356 | 3300027296 | Ga0209389_1000268 | Ga0209389_100026829 | 306 |
| 357 | 3300027866 | Ga0209813_10080709 | Ga0209813_100807091 | 306 |
| 358 | 3300028786 | Ga0307517_10001696 | Ga0307517_1000169619 | 306 |
| 359 | 3300028794 | Ga0307515_10000374 | Ga0307515_1000037458 | 306 |
| 360 | 3300030522 | Ga0307512_10134715 | Ga0307512_101347152 | 306 |
| 361 | 3300031456 | Ga0307513_10026352 | Ga0307513_100263524 | 306 |
| 362 | 3300031456 | Ga0307513_10213533 | Ga0307513_102135332 | 306 |
| 363 | 3300031456 | Ga0307513_10238751 | Ga0307513_102387511 | 306 |
| 364 | 3300031507 | Ga0307509_10001996 | Ga0307509_1000199617 | 306 |
| 365 | 3300031507 | Ga0307509_10008945 | Ga0307509_100089452 | 306 |
| 366 | 3300031507 | Ga0307509_10032771 | Ga0307509_100327716 | 306 |
| 367 | 3300031507 | Ga0307509_10078389 | Ga0307509_100783892 | 306 |
| 368 | 3300031616 | Ga0307508_10000222 | Ga0307508_1000022254 | 306 |
| 369 | 3300031649 | Ga0307514_10080818 | Ga0307514_100808183 | 306 |
| 370 | 3300031665 | Ga0316575_10002559 | Ga0316575_100025592 | 306 |
| 371 | 3300032004 | Ga0307414_10008560 | Ga0307414_100085602 | 306 |
| 372 | 3300032005 | Ga0307411_10000222 | Ga0307411_100002229 | 306 |
| 373 | 3300033179 | Ga0307507_10065720 | Ga0307507_100657203 | 306 |
| 374 | 3300033180 | Ga0307510_10079929 | Ga0307510_100799292 | 306 |
| 375 | 3300034957 | Ga0373938_0018084 | Ga0373938_0018084_11_934 | 306 |
| 376 | 3300035115 | Ga0373941_0042060 | Ga0373941_0042060_285_1208 | 306 |
| 377 | 3300036712 | Ga0316584_0007667 | Ga0316584_0007667_2605_3555 | 306 |
| 378 | 3300037068 | Ga0373925_0012696 | Ga0373925_0012696_4378_5301 | 306 |
| 379 | 3300039447 | Ga0436361_0727288 | Ga0436361_0727288_1082_2011 | 306 |
| 380 | 3300041452 | Ga0451793_0507773 | Ga0451793_0507773_31_951 | 306 |
| 381 | 3300042120 | Ga0450917_000728 | Ga0450917_000728_134_1054 | 306 |
| 382 | 3300042126 | Ga0450888_000488 | Ga0450888_000488_1315_2235 | 306 |
| 383 | 3300042127 | Ga0450890_000757 | Ga0450890_000757_2488_3408 | 306 |
| 384 | 3300042127 | Ga0450890_002578 | Ga0450890_002578_967_1887 | 306 |
| 385 | 3300042129 | Ga0450891_001217 | Ga0450891_001217_577_1497 | 306 |
| 386 | 3300042130 | Ga0450892_001368 | Ga0450892_001368_1152_2072 | 306 |
| 387 | 3300042144 | Ga0450889_000444 | Ga0450889_000444_2199_3119 | 306 |
| 388 | 3300042438 | Ga0439459_0000831 | Ga0439459_0000831_1040_1960 | 306 |
| 389 | 3300042438 | Ga0439459_0022777 | Ga0439459_0022777_139_1059 | 306 |
| 390 | 3300042532 | Ga0450893_0001683 | Ga0450893_0001683_1538_2458 | 306 |
| 391 | 3300042876 | Ga0451577_0111584 | Ga0451577_0111584_987_2015 | 306 |
| 392 | 3300046460 | Ga0495638_0147302 | Ga0495638_0147302_406_1329 | 306 |
| 393 | 3300046519 | Ga0495632_0017704 | Ga0495632_0017704_2613_3533 | 306 |
| 394 | 3300046542 | Ga0495597_0006336 | Ga0495597_0006336_3535_4455 | 306 |
| 395 | 3300046694 | Ga0495649_0007532 | Ga0495649_0007532_2696_3616 | 306 |
| 396 | 3300046810 | Ga0495660_0029786 | Ga0495660_0029786_1745_2665 | 306 |
| 397 | 3300047443 | Ga0495687_000161 | Ga0495687_000161_41457_42377 | 306 |
| 398 | 3300048927 | Ga0496124_0030268 | Ga0496124_0030268_3014_3985 | 306 |
| 399 | 3300048929 | Ga0496126_0048406 | Ga0496126_0048406_1658_2578 | 306 |
| 400 | 3300049514 | Ga0501291_003448 | Ga0501291_003448_44_964 | 306 |
| 401 | 3300049523 | Ga0501300_000901 | Ga0501300_000901_945_1865 | 306 |
| 402 | 3300049651 | Ga0501201_001318 | Ga0501201_001318_371_1291 | 306 |
| 403 | 3300049654 | Ga0501207_005485 | Ga0501207_005485_442_1362 | 306 |
| 404 | 3300049662 | Ga0501222_000657 | Ga0501222_000657_1682_2602 | 306 |
| 405 | 3300049669 | Ga0501235_017149 | Ga0501235_017149_158_1078 | 306 |
| 406 | 3300049705 | Ga0501225_0030493 | Ga0501225_0030493_109_1029 | 306 |
| 407 | 3300049764 | Ga0501267_000705 | Ga0501267_000705_1439_2359 | 306 |
| 408 | 3300049769 | Ga0501272_000660 | Ga0501272_000660_1173_2093 | 306 |
| 409 | 3300050490 | nmdc:mga03n38_33634_c1 | nmdc:mga03n38_33634_c1_426_1346 | 306 |
| 410 | 3300050493 | nmdc:mga0k408_12731_c1 | nmdc:mga0k408_12731_c1_3622_4542 | 306 |
| 411 | 3300050493 | nmdc:mga0k408_19320_c1 | nmdc:mga0k408_19320_c1_1885_2805 | 306 |
| 412 | 3300050493 | nmdc:mga0k408_34713_c1 | nmdc:mga0k408_34713_c1_740_1660 | 306 |
| 413 | 3300050493 | nmdc:mga0k408_35286_c1 | nmdc:mga0k408_35286_c1_1554_2474 | 306 |
| 414 | 3300050494 | nmdc:mga06z11_30492_c1 | nmdc:mga06z11_30492_c1_1325_2245 | 306 |
| 415 | 3300050496 | nmdc:mga07m45_11565_c1 | nmdc:mga07m45_11565_c1_1341_2261 | 306 |
| 416 | 3300050496 | nmdc:mga07m45_2794_c1 | nmdc:mga07m45_2794_c1_4601_5521 | 306 |
| 417 | 3300050496 | nmdc:mga07m45_44925_c1 | nmdc:mga07m45_44925_c1_826_1746 | 306 |
| 418 | 3300050514 | nmdc:mga08x19_205057_c1 | nmdc:mga08x19_205057_c1_40_963 | 306 |
| 419 | 3300050516 | nmdc:mga0sz30_14435_c1 | nmdc:mga0sz30_14435_c1_1932_2852 | 306 |
| 420 | 3300050516 | nmdc:mga0sz30_46433_c1 | nmdc:mga0sz30_46433_c1_660_1580 | 306 |
| 421 | 3300053093 | Ga0500651_0145825 | Ga0500651_0145825_329_1381 | 306 |
| 422 | 3300053134 | Ga0500658_0002556 | Ga0500658_0002556_741_1661 | 306 |
| 423 | 3300053156 | Ga0500622_0018407 | Ga0500622_0018407_2773_3696 | 306 |
| 424 | iso_pu_bacteria | 2738543013 | 2739251108 | 306 |
| 425 | 3300005328 | Ga0070676_10129177 | Ga0070676_101291772 | 307 |
| 426 | 3300005329 | Ga0070683_100083913 | Ga0070683_1000839132 | 307 |
| 427 | 3300005331 | Ga0070670_100233873 | Ga0070670_1002338732 | 307 |
| 428 | 3300005333 | Ga0070677_10006765 | Ga0070677_100067653 | 307 |
| 429 | 3300005334 | Ga0068869_100000526 | Ga0068869_1000005265 | 307 |
| 430 | 3300005334 | Ga0068869_100051790 | Ga0068869_1000517903 | 307 |
| 431 | 3300005334 | Ga0068869_100104802 | Ga0068869_1001048021 | 307 |
| 432 | 3300005335 | Ga0070666_10243675 | Ga0070666_102436752 | 307 |
| 433 | 3300005336 | Ga0070680_100008304 | Ga0070680_1000083046 | 307 |
| 434 | 3300005338 | Ga0068868_100001665 | Ga0068868_10000166515 | 307 |
| 435 | 3300005338 | Ga0068868_100002887 | Ga0068868_1000028876 | 307 |
| 436 | 3300005340 | Ga0070689_100004173 | Ga0070689_1000041739 | 307 |
| 437 | 3300005354 | Ga0070675_100000289 | Ga0070675_10000028921 | 307 |
| 438 | 3300005354 | Ga0070675_100002011 | Ga0070675_10000201111 | 307 |
| 439 | 3300005355 | Ga0070671_100084088 | Ga0070671_1000840882 | 307 |
| 440 | 3300005364 | Ga0070673_100011556 | Ga0070673_1000115566 | 307 |
| 441 | 3300005366 | Ga0070659_100030016 | Ga0070659_1000300162 | 307 |
| 442 | 3300005455 | Ga0070663_100008955 | Ga0070663_1000089551 | 307 |
| 443 | 3300005456 | Ga0070678_100000935 | Ga0070678_1000009355 | 307 |
| 444 | 3300005457 | Ga0070662_100003340 | Ga0070662_1000033404 | 307 |
| 445 | 3300005458 | Ga0070681_10150400 | Ga0070681_101504002 | 307 |
| 446 | 3300005459 | Ga0068867_100086853 | Ga0068867_1000868532 | 307 |
| 447 | 3300005530 | Ga0070679_100004158 | Ga0070679_1000041588 | 307 |
| 448 | 3300005539 | Ga0068853_100027475 | Ga0068853_1000274752 | 307 |
| 449 | 3300005543 | Ga0070672_100033043 | Ga0070672_1000330432 | 307 |
| 450 | 3300005547 | Ga0070693_100326626 | Ga0070693_1003266261 | 307 |
| 451 | 3300005563 | Ga0068855_100032621 | Ga0068855_1000326216 | 307 |
| 452 | 3300005577 | Ga0068857_100369928 | Ga0068857_1003699281 | 307 |
| 453 | 3300005578 | Ga0068854_100110033 | Ga0068854_1001100332 | 307 |
| 454 | 3300005614 | Ga0068856_100025363 | Ga0068856_1000253634 | 307 |
| 455 | 3300005616 | Ga0068852_100003362 | Ga0068852_1000033626 | 307 |
| 456 | 3300005616 | Ga0068852_100043355 | Ga0068852_1000433553 | 307 |
| 457 | 3300005617 | Ga0068859_100001930 | Ga0068859_1000019307 | 307 |
| 458 | 3300005618 | Ga0068864_100000799 | Ga0068864_10000079913 | 307 |
| 459 | 3300005718 | Ga0068866_10159631 | Ga0068866_101596312 | 307 |
| 460 | 3300005718 | Ga0068866_10209654 | Ga0068866_102096542 | 307 |
| 461 | 3300005719 | Ga0068861_100004849 | Ga0068861_1000048496 | 307 |
| 462 | 3300005834 | Ga0068851_10008715 | Ga0068851_100087152 | 307 |
| 463 | 3300005834 | Ga0068851_10045224 | Ga0068851_100452242 | 307 |
| 464 | 3300005841 | Ga0068863_100014630 | Ga0068863_1000146303 | 307 |
| 465 | 3300005841 | Ga0068863_100015891 | Ga0068863_1000158915 | 307 |
| 466 | 3300005842 | Ga0068858_100000259 | Ga0068858_10000025940 | 307 |
| 467 | 3300005843 | Ga0068860_100080262 | Ga0068860_1000802624 | 307 |
| 468 | 3300006237 | Ga0097621_100024370 | Ga0097621_1000243703 | 307 |
| 469 | 3300006353 | Ga0075370_10115134 | Ga0075370_101151342 | 307 |
| 470 | 3300006358 | Ga0068871_100011400 | Ga0068871_1000114004 | 307 |
| 471 | 3300006358 | Ga0068871_100051115 | Ga0068871_1000511153 | 307 |
| 472 | 3300006358 | Ga0068871_100303230 | Ga0068871_1003032302 | 307 |
| 473 | 3300006931 | Ga0097620_100001930 | Ga0097620_1000019307 | 307 |
| 474 | 3300009093 | Ga0105240_10426591 | Ga0105240_104265912 | 307 |
| 475 | 3300009101 | Ga0105247_10084472 | Ga0105247_100844722 | 307 |
| 476 | 3300009148 | Ga0105243_10069162 | Ga0105243_100691621 | 307 |
| 477 | 3300009176 | Ga0105242_10147911 | Ga0105242_101479113 | 307 |
| 478 | 3300009177 | Ga0105248_10007056 | Ga0105248_100070568 | 307 |
| 479 | 3300009177 | Ga0105248_10015976 | Ga0105248_100159767 | 307 |
| 480 | 3300009545 | Ga0105237_10043340 | Ga0105237_100433402 | 307 |
| 481 | 3300013102 | Ga0157371_10028746 | Ga0157371_100287464 | 307 |
| 482 | 3300013296 | Ga0157374_10004892 | Ga0157374_100048926 | 307 |
| 483 | 3300013306 | Ga0163162_10011233 | Ga0163162_100112334 | 307 |
| 484 | 3300013307 | Ga0157372_10041512 | Ga0157372_100415124 | 307 |
| 485 | 3300013308 | Ga0157375_10545374 | Ga0157375_105453742 | 307 |
| 486 | 3300014969 | Ga0157376_10019230 | Ga0157376_100192303 | 307 |
| 487 | 3300017792 | Ga0163161_10073015 | Ga0163161_100730152 | 307 |
| 488 | 3300021361 | Ga0213872_10000039 | Ga0213872_1000003999 | 307 |
| 489 | 3300025321 | Ga0207656_10008247 | Ga0207656_100082474 | 307 |
| 490 | 3300025321 | Ga0207656_10118584 | Ga0207656_101185841 | 307 |
| 491 | 3300025893 | Ga0207682_10012083 | Ga0207682_100120832 | 307 |
| 492 | 3300025901 | Ga0207688_10027052 | Ga0207688_100270522 | 307 |
| 493 | 3300025901 | Ga0207688_10092177 | Ga0207688_100921771 | 307 |
| 494 | 3300025907 | Ga0207645_10088136 | Ga0207645_100881362 | 307 |
| 495 | 3300025907 | Ga0207645_10169783 | Ga0207645_101697831 | 307 |
| 496 | 3300025911 | Ga0207654_10175090 | Ga0207654_101750902 | 307 |
| 497 | 3300025919 | Ga0207657_10025263 | Ga0207657_100252633 | 307 |
| 498 | 3300025921 | Ga0207652_10006460 | Ga0207652_100064603 | 307 |
| 499 | 3300025925 | Ga0207650_10024375 | Ga0207650_100243753 | 307 |
| 500 | 3300025925 | Ga0207650_10054446 | Ga0207650_100544462 | 307 |
| 501 | 3300025926 | Ga0207659_10004686 | Ga0207659_100046863 | 307 |
| 502 | 3300025927 | Ga0207687_10176511 | Ga0207687_101765112 | 307 |
| 503 | 3300025931 | Ga0207644_10125793 | Ga0207644_101257932 | 307 |
| 504 | 3300025932 | Ga0207690_10002793 | Ga0207690_1000279310 | 307 |
| 505 | 3300025933 | Ga0207706_10001138 | Ga0207706_1000113816 | 307 |
| 506 | 3300025933 | Ga0207706_10433855 | Ga0207706_104338551 | 307 |
| 507 | 3300025936 | Ga0207670_10001616 | Ga0207670_100016162 | 307 |
| 508 | 3300025937 | Ga0207669_10300632 | Ga0207669_103006321 | 307 |
| 509 | 3300025939 | Ga0207665_10022676 | Ga0207665_100226764 | 307 |
| 510 | 3300025940 | Ga0207691_10042365 | Ga0207691_100423654 | 307 |
| 511 | 3300025940 | Ga0207691_10069374 | Ga0207691_100693742 | 307 |
| 512 | 3300025941 | Ga0207711_10015447 | Ga0207711_100154476 | 307 |
| 513 | 3300025941 | Ga0207711_10019702 | Ga0207711_100197023 | 307 |
| 514 | 3300025942 | Ga0207689_10000784 | Ga0207689_1000078412 | 307 |
| 515 | 3300025944 | Ga0207661_10390379 | Ga0207661_103903792 | 307 |
| 516 | 3300025949 | Ga0207667_10301784 | Ga0207667_103017842 | 307 |
| 517 | 3300025960 | Ga0207651_10000437 | Ga0207651_100004376 | 307 |
| 518 | 3300025981 | Ga0207640_10151912 | Ga0207640_101519122 | 307 |
| 519 | 3300025986 | Ga0207658_10037856 | Ga0207658_100378562 | 307 |
| 520 | 3300026023 | Ga0207677_10001302 | Ga0207677_1000130212 | 307 |
| 521 | 3300026023 | Ga0207677_10003436 | Ga0207677_100034363 | 307 |
| 522 | 3300026023 | Ga0207677_10066210 | Ga0207677_100662102 | 307 |
| 523 | 3300026035 | Ga0207703_10000970 | Ga0207703_1000097018 | 307 |
| 524 | 3300026041 | Ga0207639_10005501 | Ga0207639_100055016 | 307 |
| 525 | 3300026067 | Ga0207678_10012814 | Ga0207678_100128144 | 307 |
| 526 | 3300026078 | Ga0207702_10008590 | Ga0207702_100085906 | 307 |
| 527 | 3300026088 | Ga0207641_10013074 | Ga0207641_100130743 | 307 |
| 528 | 3300026089 | Ga0207648_10032485 | Ga0207648_100324852 | 307 |
| 529 | 3300026089 | Ga0207648_10131048 | Ga0207648_101310483 | 307 |
| 530 | 3300026095 | Ga0207676_10001334 | Ga0207676_1000133418 | 307 |
| 531 | 3300026095 | Ga0207676_10002611 | Ga0207676_1000261110 | 307 |
| 532 | 3300026116 | Ga0207674_10235513 | Ga0207674_102355132 | 307 |
| 533 | 3300026118 | Ga0207675_100002446 | Ga0207675_10000244618 | 307 |
| 534 | 3300026121 | Ga0207683_10009863 | Ga0207683_100098635 | 307 |
| 535 | 3300026142 | Ga0207698_10002384 | Ga0207698_100023848 | 307 |
| 536 | 3300026142 | Ga0207698_10043542 | Ga0207698_100435422 | 307 |
| 537 | 3300028381 | Ga0268264_10107323 | Ga0268264_101073232 | 307 |
| 538 | 3300028794 | Ga0307515_10038455 | Ga0307515_100384556 | 307 |
| 539 | 3300028794 | Ga0307515_10119226 | Ga0307515_101192263 | 307 |
| 540 | 3300031824 | Ga0307413_10127242 | Ga0307413_101272422 | 307 |
| 541 | 3300031852 | Ga0307410_10204464 | Ga0307410_102044642 | 307 |
| 542 | 3300031901 | Ga0307406_10118157 | Ga0307406_101181572 | 307 |
| 543 | 3300031911 | Ga0307412_10009393 | Ga0307412_100093932 | 307 |
| 544 | 3300031995 | Ga0307409_100043535 | Ga0307409_1000435352 | 307 |
| 545 | 3300032002 | Ga0307416_100008542 | Ga0307416_1000085422 | 307 |
| 546 | 3300032005 | Ga0307411_10139246 | Ga0307411_101392462 | 307 |
| 547 | 3300032126 | Ga0307415_100001343 | Ga0307415_1000013437 | 307 |
| 548 | 3300034817 | Ga0373948_0002485 | Ga0373948_0002485_1645_2568 | 307 |
| 549 | 3300035114 | Ga0373939_0000003 | Ga0373939_0000003_1224_2147 | 307 |
| 550 | 3300035121 | Ga0373960_0000945 | Ga0373960_0000945_2071_2994 | 307 |
| 551 | 3300035691 | Ga0373931_0000512 | Ga0373931_0000512_9189_10115 | 307 |
| 552 | 3300036401 | Ga0373937_0245271 | Ga0373937_0245271_693_1619 | 307 |
| 553 | 3300037471 | Ga0395905_0097275 | Ga0395905_0097275_1776_2699 | 307 |
| 554 | 3300037853 | Ga0436364_0691409 | Ga0436364_0691409_267_1190 | 307 |
| 555 | 3300039447 | Ga0436361_0577165 | Ga0436361_0577165_63808_64731 | 307 |
| 556 | 3300046457 | Ga0495590_0011883 | Ga0495590_0011883_141_1064 | 307 |
| 557 | 3300046522 | Ga0495643_0000158 | Ga0495643_0000158_97341_98282 | 307 |
| 558 | 3300046543 | Ga0495645_0008312 | Ga0495645_0008312_1435_2361 | 307 |
| 559 | 3300046559 | Ga0495667_0130254 | Ga0495667_0130254_598_1524 | 307 |
| 560 | 3300047319 | Ga0495674_0194269 | Ga0495674_0194269_52_978 | 307 |
| 561 | 3300047471 | Ga0495684_0052721 | Ga0495684_0052721_1509_2435 | 307 |
| 562 | 3300048903 | Ga0496100_0136337 | Ga0496100_0136337_543_1469 | 307 |
| 563 | 3300048904 | Ga0496101_0019920 | Ga0496101_0019920_3486_4412 | 307 |
| 564 | 3300048905 | Ga0496102_0004032 | Ga0496102_0004032_7425_8351 | 307 |
| 565 | 3300048907 | Ga0496104_0059372 | Ga0496104_0059372_2660_3586 | 307 |
| 566 | 3300048907 | Ga0496104_0108248 | Ga0496104_0108248_563_1489 | 307 |
| 567 | 3300048909 | Ga0496106_0013057 | Ga0496106_0013057_2119_3045 | 307 |
| 568 | 3300048910 | Ga0496107_0012808 | Ga0496107_0012808_3143_4069 | 307 |
| 569 | 3300048912 | Ga0496109_0032510 | Ga0496109_0032510_751_1677 | 307 |
| 570 | 3300048913 | Ga0496110_0010280 | Ga0496110_0010280_3377_4303 | 307 |
| 571 | 3300048913 | Ga0496110_0345583 | Ga0496110_0345583_259_1185 | 307 |
| 572 | 3300048914 | Ga0496111_0037819 | Ga0496111_0037819_2226_3152 | 307 |
| 573 | 3300048914 | Ga0496111_0148093 | Ga0496111_0148093_399_1325 | 307 |
| 574 | 3300048916 | Ga0496113_0065043 | Ga0496113_0065043_259_1185 | 307 |
| 575 | 3300048917 | Ga0496114_0055681 | Ga0496114_0055681_403_1329 | 307 |
| 576 | 3300048917 | Ga0496114_0071935 | Ga0496114_0071935_1717_2643 | 307 |
| 577 | 3300048918 | Ga0496115_0112257 | Ga0496115_0112257_419_1345 | 307 |
| 578 | 3300048924 | Ga0496121_0005083 | Ga0496121_0005083_930_1853 | 307 |
| 579 | 3300049649 | Ga0501198_000009 | Ga0501198_000009_30823_31746 | 307 |
| 580 | 3300049662 | Ga0501222_000001 | Ga0501222_000001_153213_154136 | 307 |
| 581 | 3300050496 | nmdc:mga07m45_3661_c1 | nmdc:mga07m45_3661_c1_393_1316 | 307 |
| 582 | 3300050508 | nmdc:mga09592_753_c1 | nmdc:mga09592_753_c1_15431_16354 | 307 |
| 583 | 3300050512 | nmdc:mga0n895_114768_c1 | nmdc:mga0n895_114768_c1_1687_2613 | 307 |
| 584 | 3300005328 | Ga0070676_10049414 | Ga0070676_100494141 | 309 |
| 585 | 3300005331 | Ga0070670_100105061 | Ga0070670_1001050612 | 309 |
| 586 | 3300005355 | Ga0070671_100021484 | Ga0070671_1000214844 | 309 |
| 587 | 3300005459 | Ga0068867_100049225 | Ga0068867_1000492252 | 309 |
| 588 | 3300005616 | Ga0068852_100172996 | Ga0068852_1001729961 | 309 |
| 589 | 3300006038 | Ga0075365_10078643 | Ga0075365_100786432 | 309 |
| 590 | 3300006042 | Ga0075368_10048102 | Ga0075368_100481022 | 309 |
| 591 | 3300006177 | Ga0075362_10008340 | Ga0075362_100083404 | 309 |
| 592 | 3300006178 | Ga0075367_10160334 | Ga0075367_101603341 | 309 |
| 593 | 3300025907 | Ga0207645_10020578 | Ga0207645_100205783 | 309 |
| 594 | 3300025925 | Ga0207650_10054164 | Ga0207650_100541643 | 309 |
| 595 | 3300025931 | Ga0207644_10156182 | Ga0207644_101561822 | 309 |
| 596 | 3300026089 | Ga0207648_10064887 | Ga0207648_100648873 | 309 |
| 597 | 3300028794 | Ga0307515_10130291 | Ga0307515_101302913 | 309 |
| 598 | 3300031548 | Ga0307408_100227071 | Ga0307408_1002270712 | 309 |
| 599 | 3300042115 | Ga0450911_000637 | Ga0450911_000637_8596_9549 | 309 |
| 600 | 3300048928 | Ga0496125_0008827 | Ga0496125_0008827_3528_4481 | 309 |
| 601 | 3300050493 | nmdc:mga0k408_165997_c1 | nmdc:mga0k408_165997_c1_75_1028 | 309 |
| 602 | 3300053153 | Ga0500616_0028967 | Ga0500616_0028967_1796_2749 | 309 |
| 603 | 3300031235 | Ga0265330_10000012 | Ga0265330_1000001252 | 310 |
| 604 | 3300031238 | Ga0265332_10000012 | Ga0265332_1000001252 | 310 |
| 605 | 3300031241 | Ga0265325_10030143 | Ga0265325_100301434 | 310 |
| 606 | 3300031711 | Ga0265314_10000029 | Ga0265314_10000029206 | 310 |
| 607 | 3300045051 | Ga0451576_0042791 | Ga0451576_0042791_3584_4564 | 311 |
| 608 | 3300002705 | JGI25156J39149_1015917 | JGI25156J39149_10159171 | 312 |
| 609 | 3300002772 | JGI25164J39214_1002878 | JGI25164J39214_10028781 | 312 |
| 610 | 3300003752 | Ga0055539_1000432 | Ga0055539_10004322 | 312 |
| 611 | 3300003756 | Ga0055533_1000026 | Ga0055533_1000026109 | 312 |
| 612 | 3300003761 | Ga0055535_1000163 | Ga0055535_100016338 | 312 |
| 613 | 3300003763 | Ga0055529_1000278 | Ga0055529_100027853 | 312 |
| 614 | 3300005327 | Ga0070658_10058973 | Ga0070658_100589732 | 312 |
| 615 | 3300009093 | Ga0105240_10415310 | Ga0105240_104153102 | 312 |
| 616 | 3300009545 | Ga0105237_10521258 | Ga0105237_105212581 | 312 |
| 617 | 3300025226 | Ga0209674_100024 | Ga0209674_100024191 | 312 |
| 618 | 3300025230 | Ga0209563_100069 | Ga0209563_100069191 | 312 |
| 619 | 3300025231 | Ga0207427_100422 | Ga0207427_1004225 | 312 |
| 620 | 3300025242 | Ga0209258_100080 | Ga0209258_100080135 | 312 |
| 621 | 3300025253 | Ga0209677_100048 | Ga0209677_10004880 | 312 |
| 622 | 3300025254 | Ga0209148_1004019 | Ga0209148_10040192 | 312 |
| 623 | 3300025256 | Ga0209759_1000207 | Ga0209759_10002073 | 312 |
| 624 | 3300025256 | Ga0209759_1000925 | Ga0209759_100092511 | 312 |
| 625 | 3300025272 | Ga0209455_1000030 | Ga0209455_1000030364 | 312 |
| 626 | 3300025303 | Ga0209051_1008898 | Ga0209051_10088981 | 312 |
| 627 | 3300025913 | Ga0207695_10199060 | Ga0207695_101990602 | 312 |
| 628 | 3300025919 | Ga0207657_10027983 | Ga0207657_100279832 | 312 |
| 629 | 3300025924 | Ga0207694_10305317 | Ga0207694_103053171 | 312 |
| 630 | 3300025935 | Ga0207709_10077836 | Ga0207709_100778362 | 312 |
| 631 | 3300026089 | Ga0207648_10101947 | Ga0207648_101019472 | 312 |
| 632 | 3300030521 | Ga0307511_10077454 | Ga0307511_100774541 | 312 |
| 633 | 3300031730 | Ga0307516_10004842 | Ga0307516_100048424 | 312 |
| 634 | 3300044683 | Ga0466965_0005277 | Ga0466965_0005277_3251_4234 | 312 |
| 635 | 3300044684 | Ga0466966_0001886 | Ga0466966_0001886_1230_2213 | 312 |
| 636 | 3300044693 | Ga0466961_0011166 | Ga0466961_0011166_3118_4101 | 312 |
| 637 | 3300044706 | Ga0466964_0035787 | Ga0466964_0035787_343_1326 | 312 |
| 638 | 3300044719 | Ga0466971_0049868 | Ga0466971_0049868_111_1094 | 312 |
| 639 | 3300044842 | Ga0466957_0003723 | Ga0466957_0003723_4038_5021 | 312 |
| 640 | 3300045049 | Ga0466959_0032871 | Ga0466959_0032871_14_997 | 312 |
| 641 | 3300045836 | Ga0466958_0017396 | Ga0466958_0017396_3123_4106 | 312 |
| 642 | 3300046506 | Ga0495583_0000022 | Ga0495583_0000022_82231_83169 | 312 |
| 643 | 3300046507 | Ga0495606_0002246 | Ga0495606_0002246_16425_17363 | 312 |
| 644 | 3300046694 | Ga0495649_0001129 | Ga0495649_0001129_9867_10805 | 312 |
| 645 | 3300046794 | Ga0495589_0007409 | Ga0495589_0007409_1545_2483 | 312 |
| 646 | 3300048911 | Ga0496108_0112062 | Ga0496108_0112062_64_1002 | 312 |
| 647 | 3300053080 | Ga0500635_0000032 | Ga0500635_0000032_85931_86869 | 312 |
| 648 | 3300053122 | Ga0500608_088520 | Ga0500608_088520_113_1051 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9607 | 1 | 84 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9607 | 1 | 84 |
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9603 | 1 | 84 |
| 4iht-assembly2.cif.gz_C | crystal structure of benm_dbd/bena site 1 dna complex | 0.9596 | 1 | 84 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.9582 | 1 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0C6_1_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9795 | 1 | 80 | 1.10.10.10 |
| af_P77309_1_86_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9729 | 1 | 81 | 1.10.10.10 |
| af_P77744_4_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9723 | 2 | 86 | 1.10.10.10 |
| 4x6gE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9694 | 1 | 84 | 1.10.10.10 |
| af_P05827_1_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9673 | 1 | 82 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3T3C9-F1-model_v4 | LysR family transcriptional regulator | 0.8282 | 67 | 301 |
GO:0000976
GO:0006355 |
| AF-A0A7Z0D4P5-F1-model_v4 | DNA-binding transcriptional LysR family regulator | 0.8127 | 86 | 311 |
GO:0000976
GO:0006355 |
| AF-A0A2P4UH63-F1-model_v4 | Transcriptional regulator CysB-like protein | 0.8109 | 95 | 298 |
GO:0003677
GO:0003700 GO:0032993 |
| AF-A0A7C3T3C9-F1-model_v4 | LysR family transcriptional regulator | 0.8059 | 67 | 301 |
GO:0000976
GO:0006355 |
| AF-A0A4Q5W9K1-F1-model_v4 | deleted | 0.8051 | 93 | 303 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar