F472342

General Info

Members Datasets Scaffolds Average Seq Length
648 395 634 300

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1004255|Ga0055526_10042555
Length 326
Sequence MGRQCTGAMPRCRFLRTMPAMTLTELRYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEEELDVKIFERGANEVTMTPLGEDIVRQAQSVIEQASAIKDIAKRGKDPLDGPLRLGIIYTIGPYLLPELVKHCIDLYPRMPLMLQENFTQKLLDMLRTGELDCAIMAEPFPDAGLAVAPLYDESFVVAVPAVHPLAKKPRISAEELKAETMLLLGNGHCFRDHVLEVCPEFARFSTDAEGIRKSFEGSSLETIKHMVASGMGVTVVPALSVPDHVPPHLRYVPFEEPAPTRRVVLAWRRTFTRYEAVAALRNAVYACTLKGVTLLS

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2643221656 Pelomonas sp. Root405 Isolate Unclassified
8 2738541337 Pelomonas sp. BT06 Isolate Unclassified
9 2738543013 Variovorax sp. BT01 Isolate Unclassified
10 2831864461 Roseateles noduli HZ7 Isolate Nodule
11 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
12 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
13 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
197 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
218 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
237 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
260 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
271 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
272 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
273 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
274 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
275 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
276 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
277 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
278 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
339 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
361 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
362 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
363 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
364 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
365 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
371 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
382 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
383 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
395 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.57
Nodule 0.46
Rhizoplane 2.78
Rhizosphere 77.16
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1015917 3300002705 Bacteria 1483
2 JGI25164J39214_1002878 3300002772 Bacteria 2382
3 JGI25406J46586_10026376 3300003203 Bacteria 2241
4 rootH2_10012361 3300003320 Bacteria 4999
5 rootL2_10005926 3300003322 Bacteria 13950
6 rootH1_10012808 3300003323 Bacteria 5897
7 Ga0055539_1000432 3300003752 Bacteria 14888
8 Ga0055533_1000026 3300003756 Bacteria 323407
9 Ga0055535_1000163 3300003761 Bacteria 71841
10 Ga0055529_1000278 3300003763 Bacteria 61095
11 Ga0055526_1004255 3300003771 Bacteria 8670
12 Ga0055524_1001100 3300003775 Bacteria 16457
13 Ga0055524_1002597 3300003775 Bacteria 9193
14 Ga0055528_1027970 3300003790 Bacteria 1567
15 Ga0055530_10030464 3300003791 Bacteria 1428
16 Ga0055531_10000031 3300003794 Bacteria 156686
17 Ga0055531_10001122 3300003794 Bacteria 20732
18 Ga0055531_10002152 3300003794 Bacteria 13461
19 Ga0065165_1000407 3300005262 Bacteria 68987
20 Ga0065165_1000455 3300005262 Bacteria 64259
21 Ga0065707_10087928 3300005295 Bacteria 4840
22 Ga0070658_10058973 3300005327 Bacteria 3125
23 Ga0070658_10198185 3300005327 Bacteria 1693
24 Ga0070676_10001356 3300005328 Bacteria 12320
25 Ga0070676_10049414 3300005328 Bacteria 2462
26 Ga0070676_10129177 3300005328 Bacteria 1596
27 Ga0070683_100083913 3300005329 Bacteria 2984
28 Ga0070683_100113954 3300005329 Bacteria 2552
29 Ga0070690_100000131 3300005330 Bacteria 38893
30 Ga0070670_100007040 3300005331 Bacteria 9532
31 Ga0070670_100105061 3300005331 Bacteria 2433
32 Ga0070670_100233873 3300005331 Bacteria 1599
33 Ga0070677_10006765 3300005333 Bacteria 3815
34 Ga0068869_100000526 3300005334 Bacteria 21336
35 Ga0068869_100002847 3300005334 Bacteria 10483
36 Ga0068869_100009625 3300005334 Bacteria 6277
37 Ga0068869_100051790 3300005334 Bacteria 2979
38 Ga0068869_100104802 3300005334 Bacteria 2144
39 Ga0070666_10142092 3300005335 Bacteria 1672
40 Ga0070666_10243675 3300005335 Bacteria 1271
41 Ga0070680_100008304 3300005336 Bacteria 7944
42 Ga0070680_100014274 3300005336 Bacteria 6204
43 Ga0070682_100003841 3300005337 Bacteria 8339
44 Ga0068868_100001473 3300005338 Bacteria 16252
45 Ga0068868_100001665 3300005338 Bacteria 15176
46 Ga0068868_100002887 3300005338 Bacteria 11929
47 Ga0070689_100001412 3300005340 Bacteria 15327
48 Ga0070689_100004173 3300005340 Bacteria 9738
49 Ga0070689_100050720 3300005340 Bacteria 3206
50 Ga0070691_10001649 3300005341 Bacteria 9679
51 Ga0070687_100000176 3300005343 Bacteria 22186
52 Ga0070668_100090644 3300005347 Bacteria 2409
53 Ga0070669_100028464 3300005353 Bacteria 4024
54 Ga0070675_100000289 3300005354 Bacteria 33460
55 Ga0070675_100002011 3300005354 Bacteria 15079
56 Ga0070675_100075040 3300005354 Bacteria 2810
57 Ga0070675_100081783 3300005354 Bacteria 2694
58 Ga0070675_100121182 3300005354 Bacteria 2222
59 Ga0070671_100021484 3300005355 Bacteria 5270
60 Ga0070671_100084088 3300005355 Bacteria 2661
61 Ga0070671_100125184 3300005355 Bacteria 2164
62 Ga0070671_100172752 3300005355 Bacteria 1828
63 Ga0070674_100140579 3300005356 Bacteria 1811
64 Ga0070674_100163900 3300005356 Bacteria 1689
65 Ga0070673_100011556 3300005364 Bacteria 6031
66 Ga0070673_100205029 3300005364 Bacteria 1700
67 Ga0070673_100282017 3300005364 Bacteria 1457
68 Ga0070688_100054248 3300005365 Bacteria 2510
69 Ga0070688_100148805 3300005365 Bacteria 1598
70 Ga0070659_100030016 3300005366 Bacteria 4205
71 Ga0070667_100003068 3300005367 Bacteria 14359
72 Ga0070667_100331694 3300005367 Bacteria 1374
73 Ga0070701_10000060 3300005438 Bacteria 29083
74 Ga0070705_100000431 3300005440 Bacteria 24090
75 Ga0070705_100069781 3300005440 Bacteria 2120
76 Ga0070700_100001389 3300005441 Bacteria 12021
77 Ga0070694_100000136 3300005444 Bacteria 36787
78 Ga0070663_100008955 3300005455 Bacteria 6180
79 Ga0070663_100069192 3300005455 Bacteria 2564
80 Ga0070678_100000935 3300005456 Bacteria 14981
81 Ga0070662_100003340 3300005457 Bacteria 10008
82 Ga0070662_100033338 3300005457 Bacteria 3625
83 Ga0070662_100178683 3300005457 Bacteria 1672
84 Ga0070681_10150400 3300005458 Bacteria 2255
85 Ga0068867_100002957 3300005459 Bacteria 11965
86 Ga0068867_100039231 3300005459 Bacteria 3452
87 Ga0068867_100049225 3300005459 Bacteria 3102
88 Ga0068867_100086853 3300005459 Bacteria 2367
89 Ga0070706_100002267 3300005467 Bacteria 19485
90 Ga0070699_100200789 3300005518 Bacteria 1773
91 Ga0070679_100002086 3300005530 Bacteria 17991
92 Ga0070679_100004158 3300005530 Bacteria 13341
93 Ga0068853_100027475 3300005539 Bacteria 4780
94 Ga0068853_100367368 3300005539 Bacteria 1342
95 Ga0070672_100033043 3300005543 Bacteria 3914
96 Ga0070672_100160270 3300005543 Bacteria 1866
97 Ga0070672_100265837 3300005543 Bacteria 1447
98 Ga0070686_100000285 3300005544 Bacteria 34108
99 Ga0070686_100007857 3300005544 Bacteria 5962
100 Ga0070695_100001799 3300005545 Bacteria 12087
101 Ga0070695_100085907 3300005545 Bacteria 2090
102 Ga0070696_100001197 3300005546 Bacteria 16837
103 Ga0070693_100000507 3300005547 Bacteria 17464
104 Ga0070693_100326626 3300005547 Bacteria 1043
105 Ga0070704_100000103 3300005549 Bacteria 29844
106 Ga0068855_100001779 3300005563 Bacteria 26944
107 Ga0068855_100032621 3300005563 Bacteria 6218
108 Ga0068857_100019546 3300005577 Bacteria 5949
109 Ga0068857_100369928 3300005577 Bacteria 1330
110 Ga0068854_100110033 3300005578 Bacteria 2077
111 Ga0068856_100025363 3300005614 Bacteria 5780
112 Ga0068856_100032369 3300005614 Bacteria 5119
113 Ga0070702_100000039 3300005615 Bacteria 35203
114 Ga0068852_100003362 3300005616 Bacteria 11162
115 Ga0068852_100043355 3300005616 Bacteria 3816
116 Ga0068852_100172996 3300005616 Bacteria 2026
117 Ga0068859_100000420 3300005617 Bacteria 42401
118 Ga0068859_100001930 3300005617 Bacteria 21145
119 Ga0068859_100547422 3300005617 Bacteria 1252
120 Ga0068864_100000799 3300005618 Bacteria 26376
121 Ga0068864_100131830 3300005618 Bacteria 2246
122 Ga0068866_10000153 3300005718 Bacteria 31527
123 Ga0068866_10159631 3300005718 Bacteria 1313
124 Ga0068866_10209654 3300005718 Bacteria 1169
125 Ga0068861_100000987 3300005719 Bacteria 17369
126 Ga0068861_100004849 3300005719 Bacteria 9048
127 Ga0068851_10008715 3300005834 Bacteria 4697
128 Ga0068851_10045224 3300005834 Bacteria 2224
129 Ga0068863_100014630 3300005841 Bacteria 7554
130 Ga0068863_100015891 3300005841 Bacteria 7220
131 Ga0068863_100459917 3300005841 Bacteria 1250
132 Ga0068863_100509302 3300005841 Bacteria 1186
133 Ga0068858_100000259 3300005842 Bacteria 56570
134 Ga0068858_100024401 3300005842 Bacteria 5634
135 Ga0068858_100423931 3300005842 Bacteria 1280
136 Ga0068860_100002022 3300005843 Bacteria 21401
137 Ga0068860_100080262 3300005843 Bacteria 3102
138 Ga0068862_100004968 3300005844 Bacteria 11195
139 Ga0081539_10000668 3300005985 Bacteria 68754
140 Ga0075365_10078643 3300006038 Bacteria 2230
141 Ga0075368_10048102 3300006042 Bacteria 1689
142 Ga0075362_10008340 3300006177 Bacteria 3958
143 Ga0075362_10028980 3300006177 Bacteria 2382
144 Ga0075367_10003732 3300006178 Bacteria 7328
145 Ga0075367_10062680 3300006178 Bacteria 2221
146 Ga0075367_10064275 3300006178 Bacteria 2195
147 Ga0075367_10160334 3300006178 Bacteria 1398
148 Ga0075369_10004347 3300006186 Bacteria 5225
149 Ga0075366_10000934 3300006195 Bacteria 14194
150 Ga0075366_10005540 3300006195 Bacteria 6842
151 Ga0075366_10006445 3300006195 Bacteria 6431
152 Ga0075366_10013063 3300006195 Bacteria 4722
153 Ga0075366_10020955 3300006195 Bacteria 3798
154 Ga0075366_10071147 3300006195 Bacteria 2072
155 Ga0097621_100004055 3300006237 Bacteria 10159
156 Ga0097621_100006968 3300006237 Bacteria 8050
157 Ga0097621_100024370 3300006237 Bacteria 4725
158 Ga0097621_100198317 3300006237 Bacteria 1741
159 Ga0097621_100297473 3300006237 Bacteria 1425
160 Ga0075370_10003984 3300006353 Bacteria 7095
161 Ga0075370_10047254 3300006353 Bacteria 2437
162 Ga0075370_10105697 3300006353 Bacteria 1632
163 Ga0075370_10115134 3300006353 Bacteria 1563
164 Ga0068871_100001023 3300006358 Bacteria 18737
165 Ga0068871_100001380 3300006358 Bacteria 16255
166 Ga0068871_100011400 3300006358 Bacteria 6518
167 Ga0068871_100051115 3300006358 Bacteria 3345
168 Ga0068871_100284424 3300006358 Bacteria 1447
169 Ga0068871_100303230 3300006358 Bacteria 1402
170 Ga0075428_100000109 3300006844 Bacteria 69948
171 Ga0075430_100052839 3300006846 Bacteria 3421
172 Ga0075430_100094035 3300006846 Bacteria 2506
173 Ga0075433_10026884 3300006852 Bacteria 4876
174 Ga0075434_100001188 3300006871 Bacteria 21590
175 Ga0075434_100010325 3300006871 Bacteria 8754
176 Ga0068865_100006284 3300006881 Bacteria 7233
177 Ga0075436_100000075 3300006914 Bacteria 59554
178 Ga0097620_100000420 3300006931 Bacteria 42401
179 Ga0097620_100001930 3300006931 Bacteria 21145
180 Ga0097620_100547347 3300006931 Bacteria 1252
181 Ga0099823_1000003 3300006944 Bacteria 189058
182 Ga0075435_100000116 3300007076 Bacteria 44259
183 Ga0075435_100003441 3300007076 Bacteria 10738
184 Ga0099794_10040059 3300007265 Bacteria 2226
185 Ga0105240_10415310 3300009093 Bacteria 1513
186 Ga0105240_10426591 3300009093 Bacteria 1489
187 Ga0111539_10109921 3300009094 Bacteria 3235
188 Ga0105245_10000533 3300009098 Bacteria 34922
189 Ga0105245_10124707 3300009098 Bacteria 2409
190 Ga0105247_10084472 3300009101 Bacteria 2006
191 Ga0114129_10061813 3300009147 Bacteria 5234
192 Ga0105243_10000495 3300009148 Bacteria 40193
193 Ga0105243_10069162 3300009148 Bacteria 2847
194 Ga0105241_10214946 3300009174 Bacteria 1613
195 Ga0105242_10000248 3300009176 Bacteria 42523
196 Ga0105242_10147911 3300009176 Bacteria 2045
197 Ga0105248_10007056 3300009177 Bacteria 12308
198 Ga0105248_10015976 3300009177 Bacteria 8264
199 Ga0105248_10074684 3300009177 Bacteria 3810
200 Ga0105237_10043340 3300009545 Bacteria 4533
201 Ga0105237_10521258 3300009545 Bacteria 1195
202 Ga0105249_10012063 3300009553 Bacteria 7607
203 Ga0105239_10072973 3300010375 Bacteria 3774
204 Ga0157319_1000002 3300012497 Bacteria 410803
205 Ga0157371_10028746 3300013102 Bacteria 4024
206 Ga0157374_10004892 3300013296 Bacteria 11240
207 Ga0157378_10000387 3300013297 Bacteria 43542
208 Ga0163162_10011233 3300013306 Bacteria 8730
209 Ga0157372_10041512 3300013307 Bacteria 5087
210 Ga0157375_10452315 3300013308 Bacteria 1450
211 Ga0157375_10545374 3300013308 Bacteria 1322
212 Ga0157380_10074896 3300014326 Bacteria 2750
213 Ga0157377_10054727 3300014745 Bacteria 2260
214 Ga0157379_10009677 3300014968 Bacteria 8390
215 Ga0157379_10182479 3300014968 Bacteria 1896
216 Ga0157376_10019230 3300014969 Bacteria 5259
217 Ga0157376_10079824 3300014969 Bacteria 2805
218 Ga0163161_10073015 3300017792 Bacteria 2513
219 Ga0213872_10000022 3300021361 Bacteria 158011
220 Ga0213872_10000039 3300021361 Bacteria 123507
221 Ga0213872_10002263 3300021361 Bacteria 11482
222 Ga0209674_100024 3300025226 Bacteria 535481
223 Ga0209563_100069 3300025230 Bacteria 253154
224 Ga0207427_100422 3300025231 Bacteria 24068
225 Ga0209258_100080 3300025242 Bacteria 255287
226 Ga0209677_100048 3300025253 Bacteria 183563
227 Ga0209148_1004019 3300025254 Bacteria 3761
228 Ga0209759_1000207 3300025256 Bacteria 91180
229 Ga0209759_1000925 3300025256 Bacteria 21323
230 Ga0209455_1000030 3300025272 Bacteria 533479
231 Ga0209673_1004160 3300025273 Bacteria 7912
232 Ga0209673_1009288 3300025273 Bacteria 4282
233 Ga0209564_1000030 3300025295 Bacteria 503296
234 Ga0209050_1006312 3300025298 Bacteria 7062
235 Ga0209050_1014557 3300025298 Bacteria 3379
236 Ga0209256_1002110 3300025299 Bacteria 17294
237 Ga0209256_1002225 3300025299 Bacteria 16565
238 Ga0209051_1001516 3300025303 Bacteria 19358
239 Ga0209051_1008898 3300025303 Bacteria 5247
240 Ga0209257_1000016 3300025304 Bacteria 908015
241 Ga0209257_1001314 3300025304 Bacteria 30250
242 Ga0209257_1003977 3300025304 Bacteria 11958
243 Ga0207656_10008247 3300025321 Bacteria 3825
244 Ga0207656_10118584 3300025321 Bacteria 1230
245 Ga0207682_10012083 3300025893 Bacteria 3373
246 Ga0207682_10125522 3300025893 Bacteria 1142
247 Ga0207642_10000130 3300025899 Bacteria 20678
248 Ga0207688_10027052 3300025901 Bacteria 3155
249 Ga0207688_10092177 3300025901 Bacteria 1741
250 Ga0207688_10092622 3300025901 Bacteria 1737
251 Ga0207645_10002661 3300025907 Bacteria 13901
252 Ga0207645_10020578 3300025907 Bacteria 4317
253 Ga0207645_10088136 3300025907 Bacteria 1995
254 Ga0207645_10169783 3300025907 Bacteria 1429
255 Ga0207684_10003451 3300025910 Bacteria 15417
256 Ga0207654_10175090 3300025911 Bacteria 1396
257 Ga0207695_10199060 3300025913 Bacteria 1918
258 Ga0207671_10013996 3300025914 Bacteria 6363
259 Ga0207660_10000756 3300025917 Bacteria 21503
260 Ga0207662_10000095 3300025918 Bacteria 41923
261 Ga0207657_10025263 3300025919 Bacteria 5481
262 Ga0207657_10027983 3300025919 Bacteria 5151
263 Ga0207652_10003750 3300025921 Bacteria 12466
264 Ga0207652_10006460 3300025921 Bacteria 9456
265 Ga0207694_10305317 3300025924 Bacteria 1311
266 Ga0207650_10024375 3300025925 Bacteria 4300
267 Ga0207650_10025621 3300025925 Bacteria 4202
268 Ga0207650_10054164 3300025925 Bacteria 2975
269 Ga0207650_10054446 3300025925 Bacteria 2967
270 Ga0207659_10004686 3300025926 Bacteria 8282
271 Ga0207659_10010803 3300025926 Bacteria 5747
272 Ga0207659_10045916 3300025926 Bacteria 3082
273 Ga0207687_10000432 3300025927 Bacteria 28412
274 Ga0207687_10176511 3300025927 Bacteria 1652
275 Ga0207687_10179336 3300025927 Bacteria 1640
276 Ga0207644_10125793 3300025931 Bacteria 1956
277 Ga0207644_10156182 3300025931 Bacteria 1769
278 Ga0207644_10159112 3300025931 Bacteria 1754
279 Ga0207690_10002793 3300025932 Bacteria 10532
280 Ga0207706_10001138 3300025933 Bacteria 27072
281 Ga0207706_10433855 3300025933 Bacteria 1138
282 Ga0207686_10001368 3300025934 Bacteria 13851
283 Ga0207709_10001646 3300025935 Bacteria 15123
284 Ga0207709_10077836 3300025935 Bacteria 2127
285 Ga0207670_10001616 3300025936 Bacteria 11754
286 Ga0207670_10002845 3300025936 Bacteria 9135
287 Ga0207670_10129667 3300025936 Bacteria 1845
288 Ga0207669_10258435 3300025937 Bacteria 1301
289 Ga0207669_10300632 3300025937 Bacteria 1219
290 Ga0207704_10000281 3300025938 Bacteria 24286
291 Ga0207665_10022676 3300025939 Bacteria 4133
292 Ga0207691_10042365 3300025940 Bacteria 4198
293 Ga0207691_10056935 3300025940 Bacteria 3560
294 Ga0207691_10069374 3300025940 Bacteria 3184
295 Ga0207691_10287236 3300025940 Bacteria 1415
296 Ga0207711_10015447 3300025941 Bacteria 6337
297 Ga0207711_10019702 3300025941 Bacteria 5618
298 Ga0207689_10000784 3300025942 Bacteria 30501
299 Ga0207689_10000977 3300025942 Bacteria 27402
300 Ga0207689_10013759 3300025942 Bacteria 6894
301 Ga0207689_10021436 3300025942 Bacteria 5431
302 Ga0207661_10093957 3300025944 Bacteria 2504
303 Ga0207661_10390379 3300025944 Bacteria 1261
304 Ga0207667_10005008 3300025949 Bacteria 16189
305 Ga0207667_10301784 3300025949 Bacteria 1636
306 Ga0207651_10000437 3300025960 Bacteria 17592
307 Ga0207651_10016907 3300025960 Bacteria 4292
308 Ga0207651_10141390 3300025960 Bacteria 1859
309 Ga0207712_10002627 3300025961 Bacteria 11512
310 Ga0207668_10081409 3300025972 Bacteria 2349
311 Ga0207640_10004566 3300025981 Bacteria 7511
312 Ga0207640_10151912 3300025981 Bacteria 1702
313 Ga0207658_10037856 3300025986 Bacteria 3470
314 Ga0207658_10381645 3300025986 Bacteria 1234
315 Ga0207677_10001302 3300026023 Bacteria 13399
316 Ga0207677_10002945 3300026023 Bacteria 8991
317 Ga0207677_10003436 3300026023 Bacteria 8392
318 Ga0207677_10066210 3300026023 Bacteria 2525
319 Ga0207677_10138733 3300026023 Bacteria 1858
320 Ga0207703_10000970 3300026035 Bacteria 27674
321 Ga0207703_10132339 3300026035 Bacteria 2155
322 Ga0207639_10005501 3300026041 Bacteria 8564
323 Ga0207639_10095797 3300026041 Bacteria 2386
324 Ga0207639_10353206 3300026041 Bacteria 1313
325 Ga0207678_10012814 3300026067 Bacteria 7362
326 Ga0207708_10000551 3300026075 Bacteria 28958
327 Ga0207702_10008590 3300026078 Bacteria 8612
328 Ga0207702_10061074 3300026078 Bacteria 3214
329 Ga0207641_10013074 3300026088 Bacteria 6808
330 Ga0207648_10000513 3300026089 Bacteria 43298
331 Ga0207648_10003056 3300026089 Bacteria 17699
332 Ga0207648_10032485 3300026089 Bacteria 4607
333 Ga0207648_10064887 3300026089 Bacteria 3183
334 Ga0207648_10101947 3300026089 Bacteria 2515
335 Ga0207648_10131048 3300026089 Bacteria 2207
336 Ga0207648_10336188 3300026089 Bacteria 1359
337 Ga0207676_10001334 3300026095 Bacteria 18375
338 Ga0207676_10002611 3300026095 Bacteria 12848
339 Ga0207676_10006862 3300026095 Bacteria 8065
340 Ga0207676_10039746 3300026095 Bacteria 3601
341 Ga0207674_10011502 3300026116 Bacteria 9940
342 Ga0207674_10032551 3300026116 Bacteria 5468
343 Ga0207674_10235513 3300026116 Bacteria 1778
344 Ga0207675_100001063 3300026118 Bacteria 27254
345 Ga0207675_100002446 3300026118 Bacteria 18392
346 Ga0207683_10009863 3300026121 Bacteria 8146
347 Ga0207683_10270134 3300026121 Bacteria 1553
348 Ga0207698_10002384 3300026142 Bacteria 11130
349 Ga0207698_10043542 3300026142 Bacteria 3364
350 Ga0209389_1000268 3300027296 Bacteria 32841
351 Ga0209969_1005553 3300027360 Bacteria 1772
352 Ga0209981_1001462 3300027378 Bacteria 2977
353 Ga0209968_1003104 3300027526 Bacteria 2491
354 Ga0209588_1003962 3300027671 Bacteria 4141
355 Ga0209813_10080709 3300027866 Bacteria 1075
356 Ga0207428_10036572 3300027907 Bacteria 4003
357 Ga0268265_10006650 3300028380 Bacteria 7822
358 Ga0268264_10000827 3300028381 Bacteria 33217
359 Ga0268264_10107323 3300028381 Bacteria 2439
360 Ga0307517_10001696 3300028786 Bacteria 36406
361 Ga0307515_10000037 3300028794 Bacteria 331970
362 Ga0307515_10000374 3300028794 Bacteria 109304
363 Ga0307515_10000585 3300028794 Bacteria 85580
364 Ga0307515_10038455 3300028794 Bacteria 7653
365 Ga0307515_10119226 3300028794 Bacteria 3003
366 Ga0307515_10130291 3300028794 Bacteria 2776
367 Ga0307511_10077454 3300030521 Bacteria 2367
368 Ga0307512_10134715 3300030522 Bacteria 1535
369 Ga0265330_10000012 3300031235 Bacteria 180837
370 Ga0265332_10000012 3300031238 Bacteria 272641
371 Ga0265332_10000026 3300031238 Bacteria 193153
372 Ga0265332_10011489 3300031238 Bacteria 3934
373 Ga0265325_10030143 3300031241 Bacteria 2911
374 Ga0307513_10026352 3300031456 Bacteria 6704
375 Ga0307513_10213533 3300031456 Bacteria 1758
376 Ga0307513_10238751 3300031456 Bacteria 1624
377 Ga0307509_10001996 3300031507 Bacteria 33693
378 Ga0307509_10006059 3300031507 Bacteria 16481
379 Ga0307509_10008945 3300031507 Bacteria 12627
380 Ga0307509_10032771 3300031507 Bacteria 5724
381 Ga0307509_10078389 3300031507 Bacteria 3423
382 Ga0307408_100227071 3300031548 Bacteria 1527
383 Ga0307508_10000222 3300031616 Bacteria 69029
384 Ga0307508_10000940 3300031616 Bacteria 33950
385 Ga0307514_10000420 3300031649 Bacteria 94078
386 Ga0307514_10005696 3300031649 Bacteria 11025
387 Ga0307514_10059056 3300031649 Bacteria 2932
388 Ga0307514_10080818 3300031649 Bacteria 2404
389 Ga0316575_10002559 3300031665 Bacteria 6113
390 Ga0316575_10011575 3300031665 Bacteria 3266
391 Ga0316579_10008116 3300031691 Bacteria 4364
392 Ga0265314_10000029 3300031711 Bacteria 272506
393 Ga0316576_10012981 3300031727 Bacteria 5517
394 Ga0316578_10138337 3300031728 Bacteria 1466
395 Ga0307516_10004842 3300031730 Bacteria 16393
396 Ga0316577_10011701 3300031733 Bacteria 4760
397 Ga0307413_10127242 3300031824 Bacteria 1737
398 Ga0307410_10204464 3300031852 Bacteria 1510
399 Ga0307406_10118157 3300031901 Bacteria 1838
400 Ga0307412_10009393 3300031911 Bacteria 5611
401 Ga0307409_100043535 3300031995 Bacteria 3372
402 Ga0307416_100008542 3300032002 Bacteria 6618
403 Ga0307416_100283942 3300032002 Bacteria 1634
404 Ga0307414_10008560 3300032004 Bacteria 5813
405 Ga0307411_10000222 3300032005 Bacteria 18412
406 Ga0307411_10139246 3300032005 Bacteria 1787
407 Ga0307415_100001343 3300032126 Bacteria 11689
408 Ga0316583_10034490 3300032133 Bacteria 1796
409 Ga0307507_10012802 3300033179 Bacteria 10294
410 Ga0307507_10065720 3300033179 Bacteria 3332
411 Ga0307510_10001144 3300033180 Bacteria 28515
412 Ga0307510_10079929 3300033180 Bacteria 3183
413 Ga0373948_0002485 3300034817 Bacteria 2732
414 Ga0373948_0002608 3300034817 Bacteria 2684
415 Ga0373938_0018084 3300034957 Bacteria 1395
416 Ga0373926_0002214 3300035083 Bacteria 6137
417 Ga0373929_0029969 3300035085 Bacteria 1158
418 Ga0373940_0033745 3300035088 Bacteria 1378
419 Ga0373944_0102750 3300035089 Bacteria 967
420 Ga0373936_0009128 3300035113 Bacteria 3737
421 Ga0373939_0000003 3300035114 Bacteria 111914
422 Ga0373941_0042060 3300035115 Bacteria 1417
423 Ga0373945_0012050 3300035116 Bacteria 2866
424 Ga0373953_0034556 3300035117 Bacteria 1982
425 Ga0373954_0000012 3300035118 Bacteria 73616
426 Ga0373960_0000945 3300035121 Bacteria 6229
427 Ga0373960_0030396 3300035121 Bacteria 1504
428 Ga0373955_0136469 3300035172 Bacteria 1435
429 Ga0373942_0004661 3300035207 Bacteria 3175
430 Ga0373961_0032709 3300035241 Bacteria 1460
431 Ga0316574_0145691 3300035398 Bacteria 1526
432 Ga0316574_0166704 3300035398 Bacteria 1419
433 Ga0373924_0005626 3300035410 Bacteria 4442
434 Ga0373931_0000512 3300035691 Bacteria 15883
435 Ga0373931_0011038 3300035691 Bacteria 4355
436 Ga0373931_0012262 3300035691 Bacteria 4150
437 Ga0373931_0033076 3300035691 Bacteria 2678
438 Ga0373931_0066263 3300035691 Bacteria 1959
439 Ga0373935_0012567 3300035692 Bacteria 5095
440 Ga0373933_0014633 3300035724 Bacteria 4367
441 Ga0373947_0011345 3300035725 Bacteria 5115
442 Ga0373937_0001168 3300036401 Bacteria 22061
443 Ga0373937_0003159 3300036401 Bacteria 13788
444 Ga0373937_0245271 3300036401 Bacteria 1688
445 Ga0316582_0015425 3300036647 Bacteria 4370
446 Ga0316584_0007667 3300036712 Bacteria 7406
447 Ga0316584_0100553 3300036712 Bacteria 2165
448 Ga0316584_0219175 3300036712 Bacteria 1398
449 Ga0373925_0012696 3300037068 Bacteria 6101
450 Ga0373925_0048251 3300037068 Bacteria 3172
451 Ga0395900_0000147 3300037418 Bacteria 118678
452 Ga0395898_0000747 3300037466 Bacteria 56704
453 Ga0395905_0015871 3300037471 Bacteria 7155
454 Ga0395905_0056089 3300037471 Bacteria 3687
455 Ga0395905_0097275 3300037471 Bacteria 2763
456 Ga0436364_0691409 3300037853 Bacteria 1370
457 Ga0400483_275507 3300039062 Bacteria 3349
458 Ga0436361_0577165 3300039447 Bacteria 73575
459 Ga0436361_0675000 3300039447 Bacteria 73288
460 Ga0436361_0727288 3300039447 Bacteria 2511
461 Ga0436361_1070817 3300039447 Bacteria 30666
462 Ga0451793_0507773 3300041452 Bacteria 1004
463 Ga0451853_2571749 3300041512 Bacteria 1062
464 Ga0450911_000637 3300042115 Bacteria 10552
465 Ga0450917_000728 3300042120 Bacteria 2429
466 Ga0450888_000488 3300042126 Bacteria 3749
467 Ga0450890_000757 3300042127 Bacteria 4678
468 Ga0450890_002578 3300042127 Bacteria 2476
469 Ga0450891_001217 3300042129 Bacteria 2679
470 Ga0450892_001368 3300042130 Bacteria 2424
471 Ga0450889_000444 3300042144 Bacteria 4580
472 Ga0439459_0000831 3300042438 Bacteria 4313
473 Ga0439459_0022777 3300042438 Bacteria 1215
474 Ga0450893_0001683 3300042532 Bacteria 3399
475 Ga0451577_0002674 3300042876 Bacteria 20811
476 Ga0451577_0006991 3300042876 Bacteria 11146
477 Ga0451577_0075638 3300042876 Bacteria 3002
478 Ga0451577_0111584 3300042876 Bacteria 2446
479 Ga0466969_0000156 3300044656 Bacteria 37057
480 Ga0466965_0005277 3300044683 Bacteria 5812
481 Ga0466966_0001886 3300044684 Bacteria 13605
482 Ga0466966_0008995 3300044684 Bacteria 6618
483 Ga0466961_0011166 3300044693 Bacteria 5741
484 Ga0466964_0035787 3300044706 Bacteria 1987
485 Ga0453684_0235914 3300044712 Bacteria 2109
486 Ga0466971_0049868 3300044719 Bacteria 1883
487 Ga0466957_0003723 3300044842 Bacteria 8427
488 Ga0466960_0007896 3300044901 Bacteria 4342
489 Ga0466959_0032871 3300045049 Bacteria 3839
490 Ga0451576_0018377 3300045051 Bacteria 7665
491 Ga0451576_0042791 3300045051 Bacteria 4782
492 Ga0451576_0057691 3300045051 Bacteria 4058
493 Ga0451576_0197311 3300045051 Bacteria 2102
494 Ga0466958_0017396 3300045836 Bacteria 4154
495 Ga0495592_0003983 3300046454 Bacteria 10710
496 Ga0495592_0004109 3300046454 Bacteria 10588
497 Ga0495590_0011883 3300046457 Bacteria 3244
498 Ga0495638_0147302 3300046460 Bacteria 1368
499 Ga0495580_0000775 3300046472 Bacteria 27515
500 Ga0495582_0031960 3300046473 Bacteria 2895
501 Ga0495583_0000022 3300046506 Bacteria 282544
502 Ga0495606_0002246 3300046507 Bacteria 22999
503 Ga0495631_0035448 3300046518 Bacteria 2231
504 Ga0495632_0017704 3300046519 Bacteria 3927
505 Ga0495643_0000158 3300046522 Bacteria 110592
506 Ga0495666_0017977 3300046526 Bacteria 3521
507 Ga0495665_0037165 3300046531 Bacteria 2599
508 Ga0495586_0002945 3300046535 Bacteria 9183
509 Ga0495621_0006717 3300046539 Bacteria 3372
510 Ga0495597_0006336 3300046542 Bacteria 6130
511 Ga0495645_0008312 3300046543 Bacteria 7245
512 Ga0495667_0078284 3300046559 Bacteria 2150
513 Ga0495667_0130254 3300046559 Bacteria 1623
514 Ga0495656_0002800 3300046615 Bacteria 5830
515 Ga0495588_0007312 3300046674 Bacteria 5020
516 Ga0495647_0001391 3300046681 Bacteria 7459
517 Ga0495658_0053604 3300046683 Bacteria 2291
518 Ga0495649_0001129 3300046694 Bacteria 20775
519 Ga0495649_0007532 3300046694 Bacteria 6625
520 Ga0495589_0007409 3300046794 Bacteria 5747
521 Ga0495660_0029786 3300046810 Bacteria 3078
522 Ga0495636_0080201 3300047318 Bacteria 1404
523 Ga0495674_0194269 3300047319 Bacteria 1686
524 Ga0495680_0037346 3300047322 Bacteria 3891
525 Ga0495687_000161 3300047443 Bacteria 100635
526 Ga0495684_0052721 3300047471 Bacteria 3104
527 Ga0496100_0136337 3300048903 Bacteria 1734
528 Ga0496101_0019920 3300048904 Bacteria 4588
529 Ga0496102_0004032 3300048905 Bacteria 12444
530 Ga0496104_0059372 3300048907 Bacteria 3621
531 Ga0496104_0108248 3300048907 Bacteria 2663
532 Ga0496106_0013057 3300048909 Bacteria 6129
533 Ga0496107_0012808 3300048910 Bacteria 5860
534 Ga0496108_0112062 3300048911 Bacteria 2334
535 Ga0496109_0032510 3300048912 Bacteria 4690
536 Ga0496110_0010280 3300048913 Bacteria 7604
537 Ga0496110_0345583 3300048913 Bacteria 1355
538 Ga0496111_0037819 3300048914 Bacteria 3455
539 Ga0496111_0148093 3300048914 Bacteria 1741
540 Ga0496113_0065043 3300048916 Bacteria 2759
541 Ga0496114_0055681 3300048917 Bacteria 3299
542 Ga0496114_0071935 3300048917 Bacteria 2907
543 Ga0496115_0112257 3300048918 Bacteria 2239
544 Ga0496121_0005083 3300048924 Bacteria 17156
545 Ga0496124_0000089 3300048927 Bacteria 192423
546 Ga0496124_0030268 3300048927 Bacteria 4807
547 Ga0496125_0008827 3300048928 Bacteria 10479
548 Ga0496126_0048406 3300048929 Bacteria 3885
549 Ga0501291_003448 3300049514 Bacteria 1967
550 Ga0501300_000901 3300049523 Bacteria 4527
551 Ga0501031_0033630 3300049568 Bacteria 3346
552 Ga0501032_0074856 3300049569 Bacteria 2256
553 Ga0501033_0006678 3300049570 Bacteria 9014
554 Ga0501036_0000760 3300049572 Bacteria 23911
555 Ga0501037_0120796 3300049573 Bacteria 1884
556 Ga0501038_0005214 3300049574 Bacteria 12095
557 Ga0501039_0001574 3300049575 Bacteria 16794
558 Ga0501040_0002582 3300049576 Bacteria 11679
559 Ga0501040_0118345 3300049576 Bacteria 1858
560 Ga0501041_0001594 3300049577 Bacteria 12648
561 Ga0501041_0067404 3300049577 Bacteria 2194
562 Ga0501042_0000914 3300049578 Bacteria 16545
563 Ga0501042_0177272 3300049578 Bacteria 1537
564 Ga0501046_0001076 3300049580 Bacteria 26793
565 Ga0501048_0000114 3300049582 Bacteria 45735
566 Ga0501069_0095774 3300049585 Bacteria 1681
567 Ga0501070_0012966 3300049586 Bacteria 7025
568 Ga0501071_0114787 3300049587 Bacteria 1992
569 Ga0501071_0139234 3300049587 Bacteria 1807
570 Ga0501072_0026758 3300049588 Bacteria 4499
571 Ga0501072_0116170 3300049588 Bacteria 2131
572 Ga0501072_0315282 3300049588 Bacteria 1243
573 Ga0501074_0088082 3300049590 Bacteria 2223
574 Ga0501075_0001864 3300049591 Bacteria 13903
575 Ga0501075_0113706 3300049591 Bacteria 2058
576 Ga0501076_0000342 3300049592 Bacteria 28723
577 Ga0501077_0005888 3300049593 Bacteria 7475
578 Ga0501077_0124661 3300049593 Bacteria 1633
579 Ga0501198_000009 3300049649 Bacteria 122302
580 Ga0501201_001318 3300049651 Bacteria 2328
581 Ga0501207_005485 3300049654 Bacteria 1758
582 Ga0501222_000001 3300049662 Bacteria 307689
583 Ga0501222_000657 3300049662 Bacteria 5052
584 Ga0501235_017149 3300049669 Bacteria 1601
585 Ga0501225_0030493 3300049705 Bacteria 1483
586 Ga0501079_0003775 3300049741 Bacteria 11188
587 Ga0501079_0216082 3300049741 Bacteria 1498
588 Ga0501080_0051259 3300049742 Bacteria 3840
589 Ga0501080_0065374 3300049742 Bacteria 3383
590 Ga0501081_0001324 3300049743 Bacteria 15124
591 Ga0501083_0062122 3300049744 Bacteria 2493
592 Ga0501267_000705 3300049764 Bacteria 2681
593 Ga0501272_000660 3300049769 Bacteria 3086
594 Ga0501035_0027192 3300049822 Bacteria 5229
595 Ga0501035_0348861 3300049822 Bacteria 1239
596 Ga0501045_0014839 3300049824 Bacteria 5526
597 nmdc:mga03n38_33634_c1 3300050490 Bacteria 2183
598 nmdc:mga0k408_12731_c1 3300050493 Bacteria 4600
599 nmdc:mga0k408_165997_c1 3300050493 Bacteria 1315
600 nmdc:mga0k408_19320_c1 3300050493 Bacteria 3807
601 nmdc:mga0k408_34713_c1 3300050493 Bacteria 2889
602 nmdc:mga0k408_35286_c1 3300050493 Bacteria 2868
603 nmdc:mga0k408_467_c1 3300050493 Bacteria 22231
604 nmdc:mga06z11_30492_c1 3300050494 Bacteria 2610
605 nmdc:mga07m45_11565_c1 3300050496 Bacteria 4642
606 nmdc:mga07m45_12060_c1 3300050496 Bacteria 4558
607 nmdc:mga07m45_2794_c1 3300050496 Bacteria 8255
608 nmdc:mga07m45_3661_c1 3300050496 Bacteria 7424
609 nmdc:mga07m45_44925_c1 3300050496 Bacteria 2480
610 nmdc:mga09592_259_c1 3300050508 Bacteria 38550
611 nmdc:mga09592_462082_c1 3300050508 Bacteria 1095
612 nmdc:mga09592_753_c1 3300050508 Bacteria 24879
613 nmdc:mga0qj67_13066_c1 3300050509 Bacteria 6271
614 nmdc:mga08y16_3602_c1 3300050511 Bacteria 16080
615 nmdc:mga0n895_114768_c1 3300050512 Bacteria 2711
616 nmdc:mga0n895_24790_c1 3300050512 Bacteria 5658
617 nmdc:mga0n895_5415_c1 3300050512 Bacteria 10663
618 nmdc:mga0rr50_505_c1 3300050513 Bacteria 20786
619 nmdc:mga08x19_205057_c1 3300050514 Bacteria 1352
620 nmdc:mga08x19_2237_c1 3300050514 Bacteria 11817
621 nmdc:mga0a205_1519_c1 3300050515 Bacteria 19827
622 nmdc:mga0a205_69598_c1 3300050515 Bacteria 3397
623 nmdc:mga0sz30_14435_c1 3300050516 Bacteria 3109
624 nmdc:mga0sz30_46433_c1 3300050516 Bacteria 1834
625 Ga0500635_0000032 3300053080 Bacteria 98869
626 Ga0500651_0145825 3300053093 Bacteria 1424
627 Ga0500608_088520 3300053122 Bacteria 1451
628 Ga0500658_0002556 3300053134 Bacteria 7042
629 Ga0500616_0028967 3300053153 Bacteria 3049
630 Ga0500622_0018407 3300053156 Bacteria 3714
631 Ga0501084_0000653 3300054114 Bacteria 26449
632 Ga0501084_0178297 3300054114 Bacteria 1794
633 Ga0501082_0007474 3300060353 Bacteria 9428
634 Ga0530510_0000053 3300061734 Bacteria 54605

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_2571749 Ga0451853_2571749_10_771 230
2 3300050508 nmdc:mga09592_462082_c1 nmdc:mga09592_462082_c1_223_1068 250
3 3300049741 Ga0501079_0216082 Ga0501079_0216082_639_1484 265
4 3300007076 Ga0075435_100003441 Ga0075435_1000034413 266
5 3300050515 nmdc:mga0a205_69598_c1 nmdc:mga0a205_69598_c1_2052_2978 266
6 3300035117 Ga0373953_0034556 Ga0373953_0034556_804_1727 272
7 3300035172 Ga0373955_0136469 Ga0373955_0136469_384_1307 272
8 3300035410 Ga0373924_0005626 Ga0373924_0005626_2685_3608 272
9 3300035724 Ga0373933_0014633 Ga0373933_0014633_679_1602 272
10 3300036401 Ga0373937_0003159 Ga0373937_0003159_11397_12320 272
11 3300046559 Ga0495667_0078284 Ga0495667_0078284_550_1473 272
12 3300047322 Ga0495680_0037346 Ga0495680_0037346_425_1348 272
13 3300025986 Ga0207658_10381645 Ga0207658_103816451 274
14 3300006846 Ga0075430_100052839 Ga0075430_1000528394 275
15 3300049568 Ga0501031_0033630 Ga0501031_0033630_1672_2595 275
16 3300049569 Ga0501032_0074856 Ga0501032_0074856_318_1241 275
17 3300049570 Ga0501033_0006678 Ga0501033_0006678_6559_7482 275
18 3300049572 Ga0501036_0000760 Ga0501036_0000760_5145_6068 275
19 3300049573 Ga0501037_0120796 Ga0501037_0120796_306_1229 275
20 3300049574 Ga0501038_0005214 Ga0501038_0005214_10451_11374 275
21 3300049575 Ga0501039_0001574 Ga0501039_0001574_11036_11959 275
22 3300049576 Ga0501040_0002582 Ga0501040_0002582_4018_4941 275
23 3300049577 Ga0501041_0001594 Ga0501041_0001594_4357_5280 275
24 3300049578 Ga0501042_0000914 Ga0501042_0000914_655_1578 275
25 3300049580 Ga0501046_0001076 Ga0501046_0001076_11008_11931 275
26 3300049582 Ga0501048_0000114 Ga0501048_0000114_44693_45616 275
27 3300049587 Ga0501071_0114787 Ga0501071_0114787_971_1894 275
28 3300049588 Ga0501072_0026758 Ga0501072_0026758_2490_3413 275
29 3300049590 Ga0501074_0088082 Ga0501074_0088082_452_1375 275
30 3300049591 Ga0501075_0001864 Ga0501075_0001864_6722_7645 275
31 3300049592 Ga0501076_0000342 Ga0501076_0000342_3815_4738 275
32 3300049593 Ga0501077_0005888 Ga0501077_0005888_5769_6692 275
33 3300049741 Ga0501079_0003775 Ga0501079_0003775_1740_2663 275
34 3300049742 Ga0501080_0065374 Ga0501080_0065374_1742_2665 275
35 3300049743 Ga0501081_0001324 Ga0501081_0001324_365_1288 275
36 3300049744 Ga0501083_0062122 Ga0501083_0062122_783_1706 275
37 3300049822 Ga0501035_0027192 Ga0501035_0027192_3617_4540 275
38 3300049824 Ga0501045_0014839 Ga0501045_0014839_2889_3812 275
39 3300050496 nmdc:mga07m45_12060_c1 nmdc:mga07m45_12060_c1_46_873 275
40 3300050509 nmdc:mga0qj67_13066_c1 nmdc:mga0qj67_13066_c1_4406_5329 275
41 3300054114 Ga0501084_0000653 Ga0501084_0000653_18120_19043 275
42 3300060353 Ga0501082_0007474 Ga0501082_0007474_6788_7711 275
43 3300061734 Ga0530510_0000053 Ga0530510_0000053_28546_29469 275
44 3300005340 Ga0070689_100050720 Ga0070689_1000507202 276
45 3300005354 Ga0070675_100075040 Ga0070675_1000750402 276
46 3300005365 Ga0070688_100148805 Ga0070688_1001488052 276
47 3300014326 Ga0157380_10074896 Ga0157380_100748962 276
48 3300025926 Ga0207659_10010803 Ga0207659_100108032 276
49 3300025936 Ga0207670_10129667 Ga0207670_101296672 276
50 3300025942 Ga0207689_10021436 Ga0207689_100214366 276
51 3300035118 Ga0373954_0000012 Ga0373954_0000012_43027_43941 276
52 3300036401 Ga0373937_0001168 Ga0373937_0001168_12248_13162 276
53 3300049593 Ga0501077_0124661 Ga0501077_0124661_675_1595 277
54 3300003203 JGI25406J46586_10026376 JGI25406J46586_100263762 278
55 3300005985 Ga0081539_10000668 Ga0081539_1000066826 278
56 3300007265 Ga0099794_10040059 Ga0099794_100400593 278
57 3300035083 Ga0373926_0002214 Ga0373926_0002214_2328_3245 278
58 3300035089 Ga0373944_0102750 Ga0373944_0102750_39_956 278
59 3300035113 Ga0373936_0009128 Ga0373936_0009128_1875_2792 278
60 3300035116 Ga0373945_0012050 Ga0373945_0012050_694_1611 278
61 3300035692 Ga0373935_0012567 Ga0373935_0012567_3143_4060 278
62 3300035725 Ga0373947_0011345 Ga0373947_0011345_1730_2647 278
63 3300037068 Ga0373925_0048251 Ga0373925_0048251_878_1795 278
64 3300046472 Ga0495580_0000775 Ga0495580_0000775_15491_16408 278
65 3300046473 Ga0495582_0031960 Ga0495582_0031960_774_1691 278
66 3300046526 Ga0495666_0017977 Ga0495666_0017977_1298_2215 278
67 3300046531 Ga0495665_0037165 Ga0495665_0037165_444_1361 278
68 3300046535 Ga0495586_0002945 Ga0495586_0002945_773_1690 278
69 3300046674 Ga0495588_0007312 Ga0495588_0007312_2266_3183 278
70 3300046681 Ga0495647_0001391 Ga0495647_0001391_5677_6594 278
71 3300046683 Ga0495658_0053604 Ga0495658_0053604_1248_2165 278
72 3300005329 Ga0070683_100113954 Ga0070683_1001139542 279
73 3300005544 Ga0070686_100007857 Ga0070686_1000078575 279
74 3300005545 Ga0070695_100085907 Ga0070695_1000859072 279
75 3300005617 Ga0068859_100547422 Ga0068859_1005474222 279
76 3300005618 Ga0068864_100131830 Ga0068864_1001318302 279
77 3300005841 Ga0068863_100509302 Ga0068863_1005093022 279
78 3300006237 Ga0097621_100006968 Ga0097621_1000069689 279
79 3300006358 Ga0068871_100001023 Ga0068871_1000010235 279
80 3300006852 Ga0075433_10026884 Ga0075433_100268843 279
81 3300006871 Ga0075434_100001188 Ga0075434_10000118824 279
82 3300006871 Ga0075434_100010325 Ga0075434_1000103257 279
83 3300006914 Ga0075436_100000075 Ga0075436_10000007527 279
84 3300006931 Ga0097620_100547347 Ga0097620_1005473472 279
85 3300007076 Ga0075435_100000116 Ga0075435_10000011647 279
86 3300009094 Ga0111539_10109921 Ga0111539_101099213 279
87 3300025944 Ga0207661_10093957 Ga0207661_100939572 279
88 3300026095 Ga0207676_10039746 Ga0207676_100397462 279
89 3300035088 Ga0373940_0033745 Ga0373940_0033745_215_1132 279
90 3300035241 Ga0373961_0032709 Ga0373961_0032709_204_1124 279
91 3300046454 Ga0495592_0003983 Ga0495592_0003983_73_1002 279
92 3300050511 nmdc:mga08y16_3602_c1 nmdc:mga08y16_3602_c1_951_1868 279
93 3300050512 nmdc:mga0n895_24790_c1 nmdc:mga0n895_24790_c1_484_1413 279
94 3300050512 nmdc:mga0n895_5415_c1 nmdc:mga0n895_5415_c1_591_1508 279
95 3300050513 nmdc:mga0rr50_505_c1 nmdc:mga0rr50_505_c1_16073_16990 279
96 3300050514 nmdc:mga08x19_2237_c1 nmdc:mga08x19_2237_c1_2547_3464 279
97 3300050515 nmdc:mga0a205_1519_c1 nmdc:mga0a205_1519_c1_9965_10882 279
98 3300047318 Ga0495636_0080201 Ga0495636_0080201_415_1335 280
99 3300005330 Ga0070690_100000131 Ga0070690_10000013141 281
100 3300005334 Ga0068869_100002847 Ga0068869_1000028473 281
101 3300005335 Ga0070666_10142092 Ga0070666_101420922 281
102 3300005336 Ga0070680_100014274 Ga0070680_1000142743 281
103 3300005337 Ga0070682_100003841 Ga0070682_1000038412 281
104 3300005338 Ga0068868_100001473 Ga0068868_1000014732 281
105 3300005340 Ga0070689_100001412 Ga0070689_10000141210 281
106 3300005341 Ga0070691_10001649 Ga0070691_100016493 281
107 3300005343 Ga0070687_100000176 Ga0070687_10000017617 281
108 3300005355 Ga0070671_100172752 Ga0070671_1001727522 281
109 3300005365 Ga0070688_100054248 Ga0070688_1000542483 281
110 3300005438 Ga0070701_10000060 Ga0070701_1000006016 281
111 3300005440 Ga0070705_100000431 Ga0070705_10000043126 281
112 3300005440 Ga0070705_100069781 Ga0070705_1000697811 281
113 3300005441 Ga0070700_100001389 Ga0070700_1000013897 281
114 3300005444 Ga0070694_100000136 Ga0070694_1000001364 281
115 3300005457 Ga0070662_100178683 Ga0070662_1001786832 281
116 3300005459 Ga0068867_100002957 Ga0068867_10000295710 281
117 3300005518 Ga0070699_100200789 Ga0070699_1002007892 281
118 3300005530 Ga0070679_100002086 Ga0070679_10000208617 281
119 3300005539 Ga0068853_100367368 Ga0068853_1003673682 281
120 3300005544 Ga0070686_100000285 Ga0070686_1000002859 281
121 3300005545 Ga0070695_100001799 Ga0070695_1000017994 281
122 3300005546 Ga0070696_100001197 Ga0070696_10000119714 281
123 3300005547 Ga0070693_100000507 Ga0070693_10000050714 281
124 3300005549 Ga0070704_100000103 Ga0070704_10000010334 281
125 3300005563 Ga0068855_100001779 Ga0068855_10000177914 281
126 3300005614 Ga0068856_100032369 Ga0068856_1000323693 281
127 3300005615 Ga0070702_100000039 Ga0070702_10000003934 281
128 3300005617 Ga0068859_100000420 Ga0068859_10000042015 281
129 3300005718 Ga0068866_10000153 Ga0068866_1000015315 281
130 3300005719 Ga0068861_100000987 Ga0068861_1000009872 281
131 3300005842 Ga0068858_100024401 Ga0068858_1000244013 281
132 3300005843 Ga0068860_100002022 Ga0068860_10000202210 281
133 3300005844 Ga0068862_100004968 Ga0068862_1000049687 281
134 3300006237 Ga0097621_100004055 Ga0097621_1000040559 281
135 3300006358 Ga0068871_100001380 Ga0068871_10000138011 281
136 3300006844 Ga0075428_100000109 Ga0075428_10000010959 281
137 3300006881 Ga0068865_100006284 Ga0068865_1000062843 281
138 3300006931 Ga0097620_100000420 Ga0097620_10000042015 281
139 3300009098 Ga0105245_10000533 Ga0105245_1000053326 281
140 3300009147 Ga0114129_10061813 Ga0114129_100618133 281
141 3300009148 Ga0105243_10000495 Ga0105243_1000049515 281
142 3300009174 Ga0105241_10214946 Ga0105241_102149462 281
143 3300009176 Ga0105242_10000248 Ga0105242_1000024816 281
144 3300009177 Ga0105248_10074684 Ga0105248_100746845 281
145 3300009553 Ga0105249_10012063 Ga0105249_100120634 281
146 3300010375 Ga0105239_10072973 Ga0105239_100729733 281
147 3300013297 Ga0157378_10000387 Ga0157378_1000038718 281
148 3300014745 Ga0157377_10054727 Ga0157377_100547272 281
149 3300014968 Ga0157379_10182479 Ga0157379_101824792 281
150 3300025899 Ga0207642_10000130 Ga0207642_1000013028 281
151 3300025917 Ga0207660_10000756 Ga0207660_100007562 281
152 3300025918 Ga0207662_10000095 Ga0207662_1000009535 281
153 3300025921 Ga0207652_10003750 Ga0207652_100037509 281
154 3300025927 Ga0207687_10000432 Ga0207687_1000043214 281
155 3300025934 Ga0207686_10001368 Ga0207686_1000136814 281
156 3300025935 Ga0207709_10001646 Ga0207709_100016463 281
157 3300025936 Ga0207670_10002845 Ga0207670_100028452 281
158 3300025938 Ga0207704_10000281 Ga0207704_1000028111 281
159 3300025942 Ga0207689_10000977 Ga0207689_100009772 281
160 3300025949 Ga0207667_10005008 Ga0207667_1000500810 281
161 3300025961 Ga0207712_10002627 Ga0207712_100026272 281
162 3300025981 Ga0207640_10004566 Ga0207640_1000456610 281
163 3300026023 Ga0207677_10002945 Ga0207677_100029452 281
164 3300026035 Ga0207703_10132339 Ga0207703_101323392 281
165 3300026041 Ga0207639_10353206 Ga0207639_103532061 281
166 3300026075 Ga0207708_10000551 Ga0207708_100005512 281
167 3300026078 Ga0207702_10061074 Ga0207702_100610742 281
168 3300026089 Ga0207648_10000513 Ga0207648_1000051317 281
169 3300026118 Ga0207675_100001063 Ga0207675_1000010632 281
170 3300027907 Ga0207428_10036572 Ga0207428_100365721 281
171 3300028380 Ga0268265_10006650 Ga0268265_1000665010 281
172 3300028381 Ga0268264_10000827 Ga0268264_1000082717 281
173 3300034817 Ga0373948_0002608 Ga0373948_0002608_334_1251 281
174 3300035085 Ga0373929_0029969 Ga0373929_0029969_138_1055 281
175 3300035207 Ga0373942_0004661 Ga0373942_0004661_930_1847 281
176 3300035691 Ga0373931_0011038 Ga0373931_0011038_115_1032 281
177 3300035691 Ga0373931_0012262 Ga0373931_0012262_81_998 281
178 3300035691 Ga0373931_0066263 Ga0373931_0066263_734_1651 281
179 3300044712 Ga0453684_0235914 Ga0453684_0235914_205_1122 281
180 3300045051 Ga0451576_0018377 Ga0451576_0018377_4471_5388 281
181 3300045051 Ga0451576_0057691 Ga0451576_0057691_791_1708 281
182 3300045051 Ga0451576_0197311 Ga0451576_0197311_1037_1954 281
183 3300046518 Ga0495631_0035448 Ga0495631_0035448_30_893 281
184 3300050508 nmdc:mga09592_259_c1 nmdc:mga09592_259_c1_36305_37222 281
185 3300035121 Ga0373960_0030396 Ga0373960_0030396_439_1359 282
186 3300049822 Ga0501035_0348861 Ga0501035_0348861_290_1210 282
187 3300027671 Ga0209588_1003962 Ga0209588_10039625 283
188 3300046615 Ga0495656_0002800 Ga0495656_0002800_2779_3696 283
189 3300049588 Ga0501072_0315282 Ga0501072_0315282_46_972 284
190 3300049587 Ga0501071_0139234 Ga0501071_0139234_513_1430 285
191 3300049577 Ga0501041_0067404 Ga0501041_0067404_186_1103 286
192 3300049578 Ga0501042_0177272 Ga0501042_0177272_35_952 286
193 3300049588 Ga0501072_0116170 Ga0501072_0116170_528_1445 286
194 3300049591 Ga0501075_0113706 Ga0501075_0113706_611_1528 286
195 3300054114 Ga0501084_0178297 Ga0501084_0178297_794_1711 286
196 3300027360 Ga0209969_1005553 Ga0209969_10055532 287
197 3300027378 Ga0209981_1001462 Ga0209981_10014624 287
198 3300027526 Ga0209968_1003104 Ga0209968_10031042 287
199 3300037471 Ga0395905_0056089 Ga0395905_0056089_838_1761 287
200 3300037418 Ga0395900_0000147 Ga0395900_0000147_41676_42698 288
201 3300037466 Ga0395898_0000747 Ga0395898_0000747_55142_56164 288
202 3300037471 Ga0395905_0015871 Ga0395905_0015871_3786_4709 288
203 3300044684 Ga0466966_0008995 Ga0466966_0008995_1693_2616 288
204 3300044901 Ga0466960_0007896 Ga0466960_0007896_3361_4284 288
205 3300049576 Ga0501040_0118345 Ga0501040_0118345_472_1395 288
206 3300026089 Ga0207648_10336188 Ga0207648_103361881 289
207 3300005347 Ga0070668_100090644 Ga0070668_1000906442 290
208 3300005353 Ga0070669_100028464 Ga0070669_1000284641 290
209 3300005356 Ga0070674_100140579 Ga0070674_1001405791 290
210 3300014968 Ga0157379_10009677 Ga0157379_100096776 290
211 3300025937 Ga0207669_10258435 Ga0207669_102584351 290
212 3300025972 Ga0207668_10081409 Ga0207668_100814092 290
213 3300031665 Ga0316575_10011575 Ga0316575_100115754 290
214 3300031691 Ga0316579_10008116 Ga0316579_100081163 290
215 3300031727 Ga0316576_10012981 Ga0316576_100129813 290
216 3300031728 Ga0316578_10138337 Ga0316578_101383372 290
217 3300031733 Ga0316577_10011701 Ga0316577_100117011 290
218 3300032002 Ga0307416_100283942 Ga0307416_1002839422 290
219 3300032133 Ga0316583_10034490 Ga0316583_100344902 290
220 3300036712 Ga0316584_0219175 Ga0316584_0219175_191_1153 290
221 3300046539 Ga0495621_0006717 Ga0495621_0006717_584_1507 290
222 3300048927 Ga0496124_0000089 Ga0496124_0000089_174135_175058 290
223 3300031649 Ga0307514_10000420 Ga0307514_1000042033 291
224 3300028794 Ga0307515_10000037 Ga0307515_1000003734 292
225 3300042876 Ga0451577_0002674 Ga0451577_0002674_19297_20217 292
226 3300044656 Ga0466969_0000156 Ga0466969_0000156_35865_36788 295
227 3300028794 Ga0307515_10000585 Ga0307515_1000058558 296
228 3300031616 Ga0307508_10000940 Ga0307508_1000094023 296
229 3300031649 Ga0307514_10005696 Ga0307514_100056966 296
230 3300033179 Ga0307507_10012802 Ga0307507_100128029 296
231 3300036647 Ga0316582_0015425 Ga0316582_0015425_3307_4242 296
232 3300036712 Ga0316584_0100553 Ga0316584_0100553_129_1064 296
233 3300042876 Ga0451577_0006991 Ga0451577_0006991_2989_3912 296
234 iso_pu_bacteria 2547132512 2548847179 296
235 iso_pu_bacteria 2574179768 2574429732 296
236 iso_pu_bacteria 2891633521 2891635113 296
237 iso_pu_bacteria 639633007 639785200 296
238 3300035398 Ga0316574_0166704 Ga0316574_0166704_68_1024 297
239 3300006195 Ga0075366_10013063 Ga0075366_100130632 298
240 3300042876 Ga0451577_0075638 Ga0451577_0075638_922_1875 298
241 3300005328 Ga0070676_10001356 Ga0070676_100013563 299
242 3300005334 Ga0068869_100009625 Ga0068869_1000096255 299
243 3300005354 Ga0070675_100081783 Ga0070675_1000817832 299
244 3300005355 Ga0070671_100125184 Ga0070671_1001251843 299
245 3300005364 Ga0070673_100205029 Ga0070673_1002050292 299
246 3300005543 Ga0070672_100160270 Ga0070672_1001602702 299
247 3300009098 Ga0105245_10124707 Ga0105245_101247073 299
248 3300025893 Ga0207682_10125522 Ga0207682_101255222 299
249 3300025907 Ga0207645_10002661 Ga0207645_100026618 299
250 3300025926 Ga0207659_10045916 Ga0207659_100459162 299
251 3300025927 Ga0207687_10179336 Ga0207687_101793362 299
252 3300025931 Ga0207644_10159112 Ga0207644_101591122 299
253 3300025940 Ga0207691_10056935 Ga0207691_100569353 299
254 3300025942 Ga0207689_10013759 Ga0207689_100137592 299
255 3300025960 Ga0207651_10016907 Ga0207651_100169073 299
256 3300026023 Ga0207677_10138733 Ga0207677_101387332 299
257 3300026089 Ga0207648_10003056 Ga0207648_1000305616 299
258 3300026116 Ga0207674_10011502 Ga0207674_100115025 299
259 3300026121 Ga0207683_10270134 Ga0207683_102701342 299
260 3300031507 Ga0307509_10006059 Ga0307509_1000605914 299
261 3300031649 Ga0307514_10059056 Ga0307514_100590563 299
262 3300033180 Ga0307510_10001144 Ga0307510_1000114418 299
263 3300046454 Ga0495592_0004109 Ga0495592_0004109_4974_5897 299
264 3300006846 Ga0075430_100094035 Ga0075430_1000940353 300
265 3300031238 Ga0265332_10000026 Ga0265332_1000002678 300
266 3300031238 Ga0265332_10011489 Ga0265332_100114891 300
267 3300035691 Ga0373931_0033076 Ga0373931_0033076_526_1449 300
268 3300006195 Ga0075366_10000934 Ga0075366_1000093410 302
269 3300035398 Ga0316574_0145691 Ga0316574_0145691_53_1015 302
270 3300050493 nmdc:mga0k408_467_c1 nmdc:mga0k408_467_c1_9340_10263 302
271 iso_pu_bacteria 2643221544 2643744297 302
272 iso_pu_bacteria 2643221585 2643934838 302
273 iso_pu_bacteria 2643221656 2644316325 302
274 iso_pu_bacteria 2738541337 2739053786 302
275 iso_pu_bacteria 2831864461 2831864720 302
276 iso_pu_bacteria 2886848708 2886852515 302
277 3300039062 Ga0400483_275507 Ga0400483_275507_655_1581 303
278 iso_pu_bacteria 2643221639 2644220603 303
279 iso_pu_bacteria 2643221646 2644259526 303
280 3300005356 Ga0070674_100163900 Ga0070674_1001639002 304
281 3300005459 Ga0068867_100039231 Ga0068867_1000392312 304
282 3300049585 Ga0501069_0095774 Ga0501069_0095774_309_1250 304
283 3300049586 Ga0501070_0012966 Ga0501070_0012966_2035_2976 304
284 3300049742 Ga0501080_0051259 Ga0501080_0051259_913_1854 304
285 3300021361 Ga0213872_10000022 Ga0213872_1000002289 305
286 3300021361 Ga0213872_10002263 Ga0213872_100022635 305
287 3300039447 Ga0436361_0675000 Ga0436361_0675000_43028_43945 305
288 3300039447 Ga0436361_1070817 Ga0436361_1070817_5238_6155 305
289 iso_pu_bacteria 2881101125 2881104330 305
290 3300003320 rootH2_10012361 rootH2_100123616 306
291 3300003322 rootL2_10005926 rootL2_100059266 306
292 3300003323 rootH1_10012808 rootH1_100128084 306
293 3300003771 Ga0055526_1004255 Ga0055526_10042555 306
294 3300003775 Ga0055524_1001100 Ga0055524_100110010 306
295 3300003775 Ga0055524_1002597 Ga0055524_10025978 306
296 3300003790 Ga0055528_1027970 Ga0055528_10279702 306
297 3300003791 Ga0055530_10030464 Ga0055530_100304641 306
298 3300003794 Ga0055531_10000031 Ga0055531_100000317 306
299 3300003794 Ga0055531_10001122 Ga0055531_100011226 306
300 3300003794 Ga0055531_10002152 Ga0055531_1000215211 306
301 3300005262 Ga0065165_1000407 Ga0065165_100040734 306
302 3300005262 Ga0065165_1000455 Ga0065165_100045518 306
303 3300005295 Ga0065707_10087928 Ga0065707_100879282 306
304 3300005327 Ga0070658_10198185 Ga0070658_101981852 306
305 3300005331 Ga0070670_100007040 Ga0070670_1000070402 306
306 3300005354 Ga0070675_100121182 Ga0070675_1001211822 306
307 3300005364 Ga0070673_100282017 Ga0070673_1002820172 306
308 3300005367 Ga0070667_100003068 Ga0070667_10000306813 306
309 3300005367 Ga0070667_100331694 Ga0070667_1003316941 306
310 3300005455 Ga0070663_100069192 Ga0070663_1000691922 306
311 3300005457 Ga0070662_100033338 Ga0070662_1000333383 306
312 3300005467 Ga0070706_100002267 Ga0070706_10000226712 306
313 3300005543 Ga0070672_100265837 Ga0070672_1002658372 306
314 3300005577 Ga0068857_100019546 Ga0068857_1000195464 306
315 3300005841 Ga0068863_100459917 Ga0068863_1004599171 306
316 3300005842 Ga0068858_100423931 Ga0068858_1004239311 306
317 3300006177 Ga0075362_10028980 Ga0075362_100289802 306
318 3300006178 Ga0075367_10003732 Ga0075367_100037326 306
319 3300006178 Ga0075367_10062680 Ga0075367_100626802 306
320 3300006178 Ga0075367_10064275 Ga0075367_100642752 306
321 3300006186 Ga0075369_10004347 Ga0075369_100043475 306
322 3300006195 Ga0075366_10005540 Ga0075366_100055405 306
323 3300006195 Ga0075366_10006445 Ga0075366_100064453 306
324 3300006195 Ga0075366_10020955 Ga0075366_100209553 306
325 3300006195 Ga0075366_10071147 Ga0075366_100711472 306
326 3300006237 Ga0097621_100198317 Ga0097621_1001983172 306
327 3300006237 Ga0097621_100297473 Ga0097621_1002974732 306
328 3300006353 Ga0075370_10003984 Ga0075370_100039843 306
329 3300006353 Ga0075370_10047254 Ga0075370_100472542 306
330 3300006353 Ga0075370_10105697 Ga0075370_101056973 306
331 3300006358 Ga0068871_100284424 Ga0068871_1002844242 306
332 3300006944 Ga0099823_1000003 Ga0099823_10000036 306
333 3300012497 Ga0157319_1000002 Ga0157319_1000002143 306
334 3300013308 Ga0157375_10452315 Ga0157375_104523152 306
335 3300014969 Ga0157376_10079824 Ga0157376_100798243 306
336 3300025273 Ga0209673_1004160 Ga0209673_10041605 306
337 3300025273 Ga0209673_1009288 Ga0209673_10092883 306
338 3300025295 Ga0209564_1000030 Ga0209564_1000030408 306
339 3300025298 Ga0209050_1006312 Ga0209050_10063128 306
340 3300025298 Ga0209050_1014557 Ga0209050_10145572 306
341 3300025299 Ga0209256_1002110 Ga0209256_100211011 306
342 3300025299 Ga0209256_1002225 Ga0209256_10022258 306
343 3300025303 Ga0209051_1001516 Ga0209051_100151617 306
344 3300025304 Ga0209257_1000016 Ga0209257_1000016690 306
345 3300025304 Ga0209257_1001314 Ga0209257_100131416 306
346 3300025304 Ga0209257_1003977 Ga0209257_10039779 306
347 3300025901 Ga0207688_10092622 Ga0207688_100926222 306
348 3300025910 Ga0207684_10003451 Ga0207684_100034515 306
349 3300025914 Ga0207671_10013996 Ga0207671_100139963 306
350 3300025925 Ga0207650_10025621 Ga0207650_100256211 306
351 3300025940 Ga0207691_10287236 Ga0207691_102872362 306
352 3300025960 Ga0207651_10141390 Ga0207651_101413902 306
353 3300026041 Ga0207639_10095797 Ga0207639_100957973 306
354 3300026095 Ga0207676_10006862 Ga0207676_100068622 306
355 3300026116 Ga0207674_10032551 Ga0207674_100325514 306
356 3300027296 Ga0209389_1000268 Ga0209389_100026829 306
357 3300027866 Ga0209813_10080709 Ga0209813_100807091 306
358 3300028786 Ga0307517_10001696 Ga0307517_1000169619 306
359 3300028794 Ga0307515_10000374 Ga0307515_1000037458 306
360 3300030522 Ga0307512_10134715 Ga0307512_101347152 306
361 3300031456 Ga0307513_10026352 Ga0307513_100263524 306
362 3300031456 Ga0307513_10213533 Ga0307513_102135332 306
363 3300031456 Ga0307513_10238751 Ga0307513_102387511 306
364 3300031507 Ga0307509_10001996 Ga0307509_1000199617 306
365 3300031507 Ga0307509_10008945 Ga0307509_100089452 306
366 3300031507 Ga0307509_10032771 Ga0307509_100327716 306
367 3300031507 Ga0307509_10078389 Ga0307509_100783892 306
368 3300031616 Ga0307508_10000222 Ga0307508_1000022254 306
369 3300031649 Ga0307514_10080818 Ga0307514_100808183 306
370 3300031665 Ga0316575_10002559 Ga0316575_100025592 306
371 3300032004 Ga0307414_10008560 Ga0307414_100085602 306
372 3300032005 Ga0307411_10000222 Ga0307411_100002229 306
373 3300033179 Ga0307507_10065720 Ga0307507_100657203 306
374 3300033180 Ga0307510_10079929 Ga0307510_100799292 306
375 3300034957 Ga0373938_0018084 Ga0373938_0018084_11_934 306
376 3300035115 Ga0373941_0042060 Ga0373941_0042060_285_1208 306
377 3300036712 Ga0316584_0007667 Ga0316584_0007667_2605_3555 306
378 3300037068 Ga0373925_0012696 Ga0373925_0012696_4378_5301 306
379 3300039447 Ga0436361_0727288 Ga0436361_0727288_1082_2011 306
380 3300041452 Ga0451793_0507773 Ga0451793_0507773_31_951 306
381 3300042120 Ga0450917_000728 Ga0450917_000728_134_1054 306
382 3300042126 Ga0450888_000488 Ga0450888_000488_1315_2235 306
383 3300042127 Ga0450890_000757 Ga0450890_000757_2488_3408 306
384 3300042127 Ga0450890_002578 Ga0450890_002578_967_1887 306
385 3300042129 Ga0450891_001217 Ga0450891_001217_577_1497 306
386 3300042130 Ga0450892_001368 Ga0450892_001368_1152_2072 306
387 3300042144 Ga0450889_000444 Ga0450889_000444_2199_3119 306
388 3300042438 Ga0439459_0000831 Ga0439459_0000831_1040_1960 306
389 3300042438 Ga0439459_0022777 Ga0439459_0022777_139_1059 306
390 3300042532 Ga0450893_0001683 Ga0450893_0001683_1538_2458 306
391 3300042876 Ga0451577_0111584 Ga0451577_0111584_987_2015 306
392 3300046460 Ga0495638_0147302 Ga0495638_0147302_406_1329 306
393 3300046519 Ga0495632_0017704 Ga0495632_0017704_2613_3533 306
394 3300046542 Ga0495597_0006336 Ga0495597_0006336_3535_4455 306
395 3300046694 Ga0495649_0007532 Ga0495649_0007532_2696_3616 306
396 3300046810 Ga0495660_0029786 Ga0495660_0029786_1745_2665 306
397 3300047443 Ga0495687_000161 Ga0495687_000161_41457_42377 306
398 3300048927 Ga0496124_0030268 Ga0496124_0030268_3014_3985 306
399 3300048929 Ga0496126_0048406 Ga0496126_0048406_1658_2578 306
400 3300049514 Ga0501291_003448 Ga0501291_003448_44_964 306
401 3300049523 Ga0501300_000901 Ga0501300_000901_945_1865 306
402 3300049651 Ga0501201_001318 Ga0501201_001318_371_1291 306
403 3300049654 Ga0501207_005485 Ga0501207_005485_442_1362 306
404 3300049662 Ga0501222_000657 Ga0501222_000657_1682_2602 306
405 3300049669 Ga0501235_017149 Ga0501235_017149_158_1078 306
406 3300049705 Ga0501225_0030493 Ga0501225_0030493_109_1029 306
407 3300049764 Ga0501267_000705 Ga0501267_000705_1439_2359 306
408 3300049769 Ga0501272_000660 Ga0501272_000660_1173_2093 306
409 3300050490 nmdc:mga03n38_33634_c1 nmdc:mga03n38_33634_c1_426_1346 306
410 3300050493 nmdc:mga0k408_12731_c1 nmdc:mga0k408_12731_c1_3622_4542 306
411 3300050493 nmdc:mga0k408_19320_c1 nmdc:mga0k408_19320_c1_1885_2805 306
412 3300050493 nmdc:mga0k408_34713_c1 nmdc:mga0k408_34713_c1_740_1660 306
413 3300050493 nmdc:mga0k408_35286_c1 nmdc:mga0k408_35286_c1_1554_2474 306
414 3300050494 nmdc:mga06z11_30492_c1 nmdc:mga06z11_30492_c1_1325_2245 306
415 3300050496 nmdc:mga07m45_11565_c1 nmdc:mga07m45_11565_c1_1341_2261 306
416 3300050496 nmdc:mga07m45_2794_c1 nmdc:mga07m45_2794_c1_4601_5521 306
417 3300050496 nmdc:mga07m45_44925_c1 nmdc:mga07m45_44925_c1_826_1746 306
418 3300050514 nmdc:mga08x19_205057_c1 nmdc:mga08x19_205057_c1_40_963 306
419 3300050516 nmdc:mga0sz30_14435_c1 nmdc:mga0sz30_14435_c1_1932_2852 306
420 3300050516 nmdc:mga0sz30_46433_c1 nmdc:mga0sz30_46433_c1_660_1580 306
421 3300053093 Ga0500651_0145825 Ga0500651_0145825_329_1381 306
422 3300053134 Ga0500658_0002556 Ga0500658_0002556_741_1661 306
423 3300053156 Ga0500622_0018407 Ga0500622_0018407_2773_3696 306
424 iso_pu_bacteria 2738543013 2739251108 306
425 3300005328 Ga0070676_10129177 Ga0070676_101291772 307
426 3300005329 Ga0070683_100083913 Ga0070683_1000839132 307
427 3300005331 Ga0070670_100233873 Ga0070670_1002338732 307
428 3300005333 Ga0070677_10006765 Ga0070677_100067653 307
429 3300005334 Ga0068869_100000526 Ga0068869_1000005265 307
430 3300005334 Ga0068869_100051790 Ga0068869_1000517903 307
431 3300005334 Ga0068869_100104802 Ga0068869_1001048021 307
432 3300005335 Ga0070666_10243675 Ga0070666_102436752 307
433 3300005336 Ga0070680_100008304 Ga0070680_1000083046 307
434 3300005338 Ga0068868_100001665 Ga0068868_10000166515 307
435 3300005338 Ga0068868_100002887 Ga0068868_1000028876 307
436 3300005340 Ga0070689_100004173 Ga0070689_1000041739 307
437 3300005354 Ga0070675_100000289 Ga0070675_10000028921 307
438 3300005354 Ga0070675_100002011 Ga0070675_10000201111 307
439 3300005355 Ga0070671_100084088 Ga0070671_1000840882 307
440 3300005364 Ga0070673_100011556 Ga0070673_1000115566 307
441 3300005366 Ga0070659_100030016 Ga0070659_1000300162 307
442 3300005455 Ga0070663_100008955 Ga0070663_1000089551 307
443 3300005456 Ga0070678_100000935 Ga0070678_1000009355 307
444 3300005457 Ga0070662_100003340 Ga0070662_1000033404 307
445 3300005458 Ga0070681_10150400 Ga0070681_101504002 307
446 3300005459 Ga0068867_100086853 Ga0068867_1000868532 307
447 3300005530 Ga0070679_100004158 Ga0070679_1000041588 307
448 3300005539 Ga0068853_100027475 Ga0068853_1000274752 307
449 3300005543 Ga0070672_100033043 Ga0070672_1000330432 307
450 3300005547 Ga0070693_100326626 Ga0070693_1003266261 307
451 3300005563 Ga0068855_100032621 Ga0068855_1000326216 307
452 3300005577 Ga0068857_100369928 Ga0068857_1003699281 307
453 3300005578 Ga0068854_100110033 Ga0068854_1001100332 307
454 3300005614 Ga0068856_100025363 Ga0068856_1000253634 307
455 3300005616 Ga0068852_100003362 Ga0068852_1000033626 307
456 3300005616 Ga0068852_100043355 Ga0068852_1000433553 307
457 3300005617 Ga0068859_100001930 Ga0068859_1000019307 307
458 3300005618 Ga0068864_100000799 Ga0068864_10000079913 307
459 3300005718 Ga0068866_10159631 Ga0068866_101596312 307
460 3300005718 Ga0068866_10209654 Ga0068866_102096542 307
461 3300005719 Ga0068861_100004849 Ga0068861_1000048496 307
462 3300005834 Ga0068851_10008715 Ga0068851_100087152 307
463 3300005834 Ga0068851_10045224 Ga0068851_100452242 307
464 3300005841 Ga0068863_100014630 Ga0068863_1000146303 307
465 3300005841 Ga0068863_100015891 Ga0068863_1000158915 307
466 3300005842 Ga0068858_100000259 Ga0068858_10000025940 307
467 3300005843 Ga0068860_100080262 Ga0068860_1000802624 307
468 3300006237 Ga0097621_100024370 Ga0097621_1000243703 307
469 3300006353 Ga0075370_10115134 Ga0075370_101151342 307
470 3300006358 Ga0068871_100011400 Ga0068871_1000114004 307
471 3300006358 Ga0068871_100051115 Ga0068871_1000511153 307
472 3300006358 Ga0068871_100303230 Ga0068871_1003032302 307
473 3300006931 Ga0097620_100001930 Ga0097620_1000019307 307
474 3300009093 Ga0105240_10426591 Ga0105240_104265912 307
475 3300009101 Ga0105247_10084472 Ga0105247_100844722 307
476 3300009148 Ga0105243_10069162 Ga0105243_100691621 307
477 3300009176 Ga0105242_10147911 Ga0105242_101479113 307
478 3300009177 Ga0105248_10007056 Ga0105248_100070568 307
479 3300009177 Ga0105248_10015976 Ga0105248_100159767 307
480 3300009545 Ga0105237_10043340 Ga0105237_100433402 307
481 3300013102 Ga0157371_10028746 Ga0157371_100287464 307
482 3300013296 Ga0157374_10004892 Ga0157374_100048926 307
483 3300013306 Ga0163162_10011233 Ga0163162_100112334 307
484 3300013307 Ga0157372_10041512 Ga0157372_100415124 307
485 3300013308 Ga0157375_10545374 Ga0157375_105453742 307
486 3300014969 Ga0157376_10019230 Ga0157376_100192303 307
487 3300017792 Ga0163161_10073015 Ga0163161_100730152 307
488 3300021361 Ga0213872_10000039 Ga0213872_1000003999 307
489 3300025321 Ga0207656_10008247 Ga0207656_100082474 307
490 3300025321 Ga0207656_10118584 Ga0207656_101185841 307
491 3300025893 Ga0207682_10012083 Ga0207682_100120832 307
492 3300025901 Ga0207688_10027052 Ga0207688_100270522 307
493 3300025901 Ga0207688_10092177 Ga0207688_100921771 307
494 3300025907 Ga0207645_10088136 Ga0207645_100881362 307
495 3300025907 Ga0207645_10169783 Ga0207645_101697831 307
496 3300025911 Ga0207654_10175090 Ga0207654_101750902 307
497 3300025919 Ga0207657_10025263 Ga0207657_100252633 307
498 3300025921 Ga0207652_10006460 Ga0207652_100064603 307
499 3300025925 Ga0207650_10024375 Ga0207650_100243753 307
500 3300025925 Ga0207650_10054446 Ga0207650_100544462 307
501 3300025926 Ga0207659_10004686 Ga0207659_100046863 307
502 3300025927 Ga0207687_10176511 Ga0207687_101765112 307
503 3300025931 Ga0207644_10125793 Ga0207644_101257932 307
504 3300025932 Ga0207690_10002793 Ga0207690_1000279310 307
505 3300025933 Ga0207706_10001138 Ga0207706_1000113816 307
506 3300025933 Ga0207706_10433855 Ga0207706_104338551 307
507 3300025936 Ga0207670_10001616 Ga0207670_100016162 307
508 3300025937 Ga0207669_10300632 Ga0207669_103006321 307
509 3300025939 Ga0207665_10022676 Ga0207665_100226764 307
510 3300025940 Ga0207691_10042365 Ga0207691_100423654 307
511 3300025940 Ga0207691_10069374 Ga0207691_100693742 307
512 3300025941 Ga0207711_10015447 Ga0207711_100154476 307
513 3300025941 Ga0207711_10019702 Ga0207711_100197023 307
514 3300025942 Ga0207689_10000784 Ga0207689_1000078412 307
515 3300025944 Ga0207661_10390379 Ga0207661_103903792 307
516 3300025949 Ga0207667_10301784 Ga0207667_103017842 307
517 3300025960 Ga0207651_10000437 Ga0207651_100004376 307
518 3300025981 Ga0207640_10151912 Ga0207640_101519122 307
519 3300025986 Ga0207658_10037856 Ga0207658_100378562 307
520 3300026023 Ga0207677_10001302 Ga0207677_1000130212 307
521 3300026023 Ga0207677_10003436 Ga0207677_100034363 307
522 3300026023 Ga0207677_10066210 Ga0207677_100662102 307
523 3300026035 Ga0207703_10000970 Ga0207703_1000097018 307
524 3300026041 Ga0207639_10005501 Ga0207639_100055016 307
525 3300026067 Ga0207678_10012814 Ga0207678_100128144 307
526 3300026078 Ga0207702_10008590 Ga0207702_100085906 307
527 3300026088 Ga0207641_10013074 Ga0207641_100130743 307
528 3300026089 Ga0207648_10032485 Ga0207648_100324852 307
529 3300026089 Ga0207648_10131048 Ga0207648_101310483 307
530 3300026095 Ga0207676_10001334 Ga0207676_1000133418 307
531 3300026095 Ga0207676_10002611 Ga0207676_1000261110 307
532 3300026116 Ga0207674_10235513 Ga0207674_102355132 307
533 3300026118 Ga0207675_100002446 Ga0207675_10000244618 307
534 3300026121 Ga0207683_10009863 Ga0207683_100098635 307
535 3300026142 Ga0207698_10002384 Ga0207698_100023848 307
536 3300026142 Ga0207698_10043542 Ga0207698_100435422 307
537 3300028381 Ga0268264_10107323 Ga0268264_101073232 307
538 3300028794 Ga0307515_10038455 Ga0307515_100384556 307
539 3300028794 Ga0307515_10119226 Ga0307515_101192263 307
540 3300031824 Ga0307413_10127242 Ga0307413_101272422 307
541 3300031852 Ga0307410_10204464 Ga0307410_102044642 307
542 3300031901 Ga0307406_10118157 Ga0307406_101181572 307
543 3300031911 Ga0307412_10009393 Ga0307412_100093932 307
544 3300031995 Ga0307409_100043535 Ga0307409_1000435352 307
545 3300032002 Ga0307416_100008542 Ga0307416_1000085422 307
546 3300032005 Ga0307411_10139246 Ga0307411_101392462 307
547 3300032126 Ga0307415_100001343 Ga0307415_1000013437 307
548 3300034817 Ga0373948_0002485 Ga0373948_0002485_1645_2568 307
549 3300035114 Ga0373939_0000003 Ga0373939_0000003_1224_2147 307
550 3300035121 Ga0373960_0000945 Ga0373960_0000945_2071_2994 307
551 3300035691 Ga0373931_0000512 Ga0373931_0000512_9189_10115 307
552 3300036401 Ga0373937_0245271 Ga0373937_0245271_693_1619 307
553 3300037471 Ga0395905_0097275 Ga0395905_0097275_1776_2699 307
554 3300037853 Ga0436364_0691409 Ga0436364_0691409_267_1190 307
555 3300039447 Ga0436361_0577165 Ga0436361_0577165_63808_64731 307
556 3300046457 Ga0495590_0011883 Ga0495590_0011883_141_1064 307
557 3300046522 Ga0495643_0000158 Ga0495643_0000158_97341_98282 307
558 3300046543 Ga0495645_0008312 Ga0495645_0008312_1435_2361 307
559 3300046559 Ga0495667_0130254 Ga0495667_0130254_598_1524 307
560 3300047319 Ga0495674_0194269 Ga0495674_0194269_52_978 307
561 3300047471 Ga0495684_0052721 Ga0495684_0052721_1509_2435 307
562 3300048903 Ga0496100_0136337 Ga0496100_0136337_543_1469 307
563 3300048904 Ga0496101_0019920 Ga0496101_0019920_3486_4412 307
564 3300048905 Ga0496102_0004032 Ga0496102_0004032_7425_8351 307
565 3300048907 Ga0496104_0059372 Ga0496104_0059372_2660_3586 307
566 3300048907 Ga0496104_0108248 Ga0496104_0108248_563_1489 307
567 3300048909 Ga0496106_0013057 Ga0496106_0013057_2119_3045 307
568 3300048910 Ga0496107_0012808 Ga0496107_0012808_3143_4069 307
569 3300048912 Ga0496109_0032510 Ga0496109_0032510_751_1677 307
570 3300048913 Ga0496110_0010280 Ga0496110_0010280_3377_4303 307
571 3300048913 Ga0496110_0345583 Ga0496110_0345583_259_1185 307
572 3300048914 Ga0496111_0037819 Ga0496111_0037819_2226_3152 307
573 3300048914 Ga0496111_0148093 Ga0496111_0148093_399_1325 307
574 3300048916 Ga0496113_0065043 Ga0496113_0065043_259_1185 307
575 3300048917 Ga0496114_0055681 Ga0496114_0055681_403_1329 307
576 3300048917 Ga0496114_0071935 Ga0496114_0071935_1717_2643 307
577 3300048918 Ga0496115_0112257 Ga0496115_0112257_419_1345 307
578 3300048924 Ga0496121_0005083 Ga0496121_0005083_930_1853 307
579 3300049649 Ga0501198_000009 Ga0501198_000009_30823_31746 307
580 3300049662 Ga0501222_000001 Ga0501222_000001_153213_154136 307
581 3300050496 nmdc:mga07m45_3661_c1 nmdc:mga07m45_3661_c1_393_1316 307
582 3300050508 nmdc:mga09592_753_c1 nmdc:mga09592_753_c1_15431_16354 307
583 3300050512 nmdc:mga0n895_114768_c1 nmdc:mga0n895_114768_c1_1687_2613 307
584 3300005328 Ga0070676_10049414 Ga0070676_100494141 309
585 3300005331 Ga0070670_100105061 Ga0070670_1001050612 309
586 3300005355 Ga0070671_100021484 Ga0070671_1000214844 309
587 3300005459 Ga0068867_100049225 Ga0068867_1000492252 309
588 3300005616 Ga0068852_100172996 Ga0068852_1001729961 309
589 3300006038 Ga0075365_10078643 Ga0075365_100786432 309
590 3300006042 Ga0075368_10048102 Ga0075368_100481022 309
591 3300006177 Ga0075362_10008340 Ga0075362_100083404 309
592 3300006178 Ga0075367_10160334 Ga0075367_101603341 309
593 3300025907 Ga0207645_10020578 Ga0207645_100205783 309
594 3300025925 Ga0207650_10054164 Ga0207650_100541643 309
595 3300025931 Ga0207644_10156182 Ga0207644_101561822 309
596 3300026089 Ga0207648_10064887 Ga0207648_100648873 309
597 3300028794 Ga0307515_10130291 Ga0307515_101302913 309
598 3300031548 Ga0307408_100227071 Ga0307408_1002270712 309
599 3300042115 Ga0450911_000637 Ga0450911_000637_8596_9549 309
600 3300048928 Ga0496125_0008827 Ga0496125_0008827_3528_4481 309
601 3300050493 nmdc:mga0k408_165997_c1 nmdc:mga0k408_165997_c1_75_1028 309
602 3300053153 Ga0500616_0028967 Ga0500616_0028967_1796_2749 309
603 3300031235 Ga0265330_10000012 Ga0265330_1000001252 310
604 3300031238 Ga0265332_10000012 Ga0265332_1000001252 310
605 3300031241 Ga0265325_10030143 Ga0265325_100301434 310
606 3300031711 Ga0265314_10000029 Ga0265314_10000029206 310
607 3300045051 Ga0451576_0042791 Ga0451576_0042791_3584_4564 311
608 3300002705 JGI25156J39149_1015917 JGI25156J39149_10159171 312
609 3300002772 JGI25164J39214_1002878 JGI25164J39214_10028781 312
610 3300003752 Ga0055539_1000432 Ga0055539_10004322 312
611 3300003756 Ga0055533_1000026 Ga0055533_1000026109 312
612 3300003761 Ga0055535_1000163 Ga0055535_100016338 312
613 3300003763 Ga0055529_1000278 Ga0055529_100027853 312
614 3300005327 Ga0070658_10058973 Ga0070658_100589732 312
615 3300009093 Ga0105240_10415310 Ga0105240_104153102 312
616 3300009545 Ga0105237_10521258 Ga0105237_105212581 312
617 3300025226 Ga0209674_100024 Ga0209674_100024191 312
618 3300025230 Ga0209563_100069 Ga0209563_100069191 312
619 3300025231 Ga0207427_100422 Ga0207427_1004225 312
620 3300025242 Ga0209258_100080 Ga0209258_100080135 312
621 3300025253 Ga0209677_100048 Ga0209677_10004880 312
622 3300025254 Ga0209148_1004019 Ga0209148_10040192 312
623 3300025256 Ga0209759_1000207 Ga0209759_10002073 312
624 3300025256 Ga0209759_1000925 Ga0209759_100092511 312
625 3300025272 Ga0209455_1000030 Ga0209455_1000030364 312
626 3300025303 Ga0209051_1008898 Ga0209051_10088981 312
627 3300025913 Ga0207695_10199060 Ga0207695_101990602 312
628 3300025919 Ga0207657_10027983 Ga0207657_100279832 312
629 3300025924 Ga0207694_10305317 Ga0207694_103053171 312
630 3300025935 Ga0207709_10077836 Ga0207709_100778362 312
631 3300026089 Ga0207648_10101947 Ga0207648_101019472 312
632 3300030521 Ga0307511_10077454 Ga0307511_100774541 312
633 3300031730 Ga0307516_10004842 Ga0307516_100048424 312
634 3300044683 Ga0466965_0005277 Ga0466965_0005277_3251_4234 312
635 3300044684 Ga0466966_0001886 Ga0466966_0001886_1230_2213 312
636 3300044693 Ga0466961_0011166 Ga0466961_0011166_3118_4101 312
637 3300044706 Ga0466964_0035787 Ga0466964_0035787_343_1326 312
638 3300044719 Ga0466971_0049868 Ga0466971_0049868_111_1094 312
639 3300044842 Ga0466957_0003723 Ga0466957_0003723_4038_5021 312
640 3300045049 Ga0466959_0032871 Ga0466959_0032871_14_997 312
641 3300045836 Ga0466958_0017396 Ga0466958_0017396_3123_4106 312
642 3300046506 Ga0495583_0000022 Ga0495583_0000022_82231_83169 312
643 3300046507 Ga0495606_0002246 Ga0495606_0002246_16425_17363 312
644 3300046694 Ga0495649_0001129 Ga0495649_0001129_9867_10805 312
645 3300046794 Ga0495589_0007409 Ga0495589_0007409_1545_2483 312
646 3300048911 Ga0496108_0112062 Ga0496108_0112062_64_1002 312
647 3300053080 Ga0500635_0000032 Ga0500635_0000032_85931_86869 312
648 3300053122 Ga0500608_088520 Ga0500608_088520_113_1051 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

23

82

0.96

PF03466

LysR_substrate

LysR substrate binding domain

106

316

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9607 1 84
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9607 1 84
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9603 1 84
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9596 1 84
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9582 1 84
ID Description Score Start End Superfamily
af_Q2G0C6_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9795 1 80 1.10.10.10
af_P77309_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9729 1 81 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9723 2 86 1.10.10.10
4x6gE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9694 1 84 1.10.10.10
af_P05827_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9673 1 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C3T3C9-F1-model_v4 LysR family transcriptional regulator 0.8282 67 301 GO:0000976
GO:0006355
AF-A0A7Z0D4P5-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.8127 86 311 GO:0000976
GO:0006355
AF-A0A2P4UH63-F1-model_v4 Transcriptional regulator CysB-like protein 0.8109 95 298 GO:0003677
GO:0003700
GO:0032993
AF-A0A7C3T3C9-F1-model_v4 LysR family transcriptional regulator 0.8059 67 301 GO:0000976
GO:0006355
AF-A0A4Q5W9K1-F1-model_v4 deleted 0.8051 93 303

Feature Viewer

pLDDT pTM Quality
85.92 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map