F472265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 304 | 1288 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100666981|Ga0068863_1006669811 |
| Length | 173 |
| Sequence | VTGLVGEATSAPDQEPMMHPYPHLYTAAASGRPEGNVALTSPSLPEITTAPPPEFDGPGDVWSPETLLCASLADCFVLSFRAIARASRLEWSDLKCRVEGVLERVDGVTQFTRYTTFANLRVSPGIDADKARRLLEKADHLCLISNSLRGKRTLVAEVVISAAEATFGGAGST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 177 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 178 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 195 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 223 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 224 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 225 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 300 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 95.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068863_100666981 | 3300005841 | Bacteria | 1032 |
| 2 | MBSR1b_contig_4976386 | 2162886012 | Bacteria | 1278 |
| 3 | JGI24751J29686_10052650 | 3300002459 | Bacteria | 839 |
| 4 | rootH1_10083716 | 3300003316 | Bacteria | 1624 |
| 5 | rootH2_10249099 | 3300003320 | Unclassified | 1806 |
| 6 | rootL2_10348100 | 3300003322 | Bacteria | 3009 |
| 7 | rootH1_10225479 | 3300003323 | Bacteria | 2226 |
| 8 | Ga0065714_10119360 | 3300005288 | Unclassified | 1367 |
| 9 | Ga0065704_10092779 | 3300005289 | Unclassified | 2634 |
| 10 | Ga0065712_10069890 | 3300005290 | Bacteria | 6563 |
| 11 | Ga0065712_10071950 | 3300005290 | Bacteria | 4971 |
| 12 | Ga0065715_10170144 | 3300005293 | Unclassified | 1553 |
| 13 | Ga0065707_10103685 | 3300005295 | Unclassified | 2735 |
| 14 | Ga0070683_100003733 | 3300005329 | Bacteria | 12418 |
| 15 | Ga0070683_100237491 | 3300005329 | Bacteria | 1733 |
| 16 | Ga0070683_100695307 | 3300005329 | Bacteria | 974 |
| 17 | Ga0070690_100090464 | 3300005330 | Bacteria | 2015 |
| 18 | Ga0070690_100152312 | 3300005330 | Bacteria | 1579 |
| 19 | Ga0070670_100054910 | 3300005331 | Bacteria | 3420 |
| 20 | Ga0070670_100148583 | 3300005331 | Bacteria | 2028 |
| 21 | Ga0070670_100153120 | 3300005331 | Unclassified | 1996 |
| 22 | Ga0070670_100188139 | 3300005331 | Unclassified | 1793 |
| 23 | Ga0070670_100542848 | 3300005331 | Unclassified | 1037 |
| 24 | Ga0070670_100665919 | 3300005331 | Unclassified | 934 |
| 25 | Ga0070670_100833214 | 3300005331 | Bacteria | 834 |
| 26 | Ga0070677_10026637 | 3300005333 | Bacteria | 2170 |
| 27 | Ga0068869_100080893 | 3300005334 | Bacteria | 2425 |
| 28 | Ga0068869_100604228 | 3300005334 | Bacteria | 927 |
| 29 | Ga0068869_101092948 | 3300005334 | Bacteria | 697 |
| 30 | Ga0070666_10055662 | 3300005335 | Bacteria | 2670 |
| 31 | Ga0070666_10115262 | 3300005335 | Bacteria | 1861 |
| 32 | Ga0070666_10270935 | 3300005335 | Bacteria | 1205 |
| 33 | Ga0070666_10431104 | 3300005335 | Unclassified | 950 |
| 34 | Ga0070666_10825275 | 3300005335 | Unclassified | 683 |
| 35 | Ga0070680_100448475 | 3300005336 | Bacteria | 1102 |
| 36 | Ga0068868_100012072 | 3300005338 | Bacteria | 6307 |
| 37 | Ga0068868_100756080 | 3300005338 | Unclassified | 874 |
| 38 | Ga0070660_100275861 | 3300005339 | Unclassified | 1375 |
| 39 | Ga0070660_100321992 | 3300005339 | Bacteria | 1270 |
| 40 | Ga0070689_100085780 | 3300005340 | Bacteria | 2476 |
| 41 | Ga0070689_100875433 | 3300005340 | Unclassified | 793 |
| 42 | Ga0070687_100206477 | 3300005343 | Unclassified | 1194 |
| 43 | Ga0070661_100013594 | 3300005344 | Bacteria | 5715 |
| 44 | Ga0070661_100259425 | 3300005344 | Bacteria | 1343 |
| 45 | Ga0070661_100382913 | 3300005344 | Bacteria | 1109 |
| 46 | Ga0070661_100629297 | 3300005344 | Unclassified | 869 |
| 47 | Ga0070668_100026734 | 3300005347 | Bacteria | 4380 |
| 48 | Ga0070668_100147404 | 3300005347 | Unclassified | 1900 |
| 49 | Ga0070668_100646886 | 3300005347 | Unclassified | 929 |
| 50 | Ga0070668_101653683 | 3300005347 | Unclassified | 587 |
| 51 | Ga0070669_100008508 | 3300005353 | Bacteria | 7325 |
| 52 | Ga0070669_100041319 | 3300005353 | Bacteria | 3353 |
| 53 | Ga0070669_100459636 | 3300005353 | Unclassified | 1050 |
| 54 | Ga0070669_100793362 | 3300005353 | Unclassified | 805 |
| 55 | Ga0070669_100846746 | 3300005353 | Unclassified | 779 |
| 56 | Ga0070675_100000325 | 3300005354 | Bacteria | 32228 |
| 57 | Ga0070675_100024084 | 3300005354 | Bacteria | 4873 |
| 58 | Ga0070675_100165477 | 3300005354 | Bacteria | 1904 |
| 59 | Ga0070675_100236588 | 3300005354 | Bacteria | 1595 |
| 60 | Ga0070675_100278266 | 3300005354 | Bacteria | 1470 |
| 61 | Ga0070671_100200022 | 3300005355 | Unclassified | 1694 |
| 62 | Ga0070671_100369789 | 3300005355 | Unclassified | 1224 |
| 63 | Ga0070674_100453441 | 3300005356 | Unclassified | 1059 |
| 64 | Ga0070673_100013373 | 3300005364 | Bacteria | 5675 |
| 65 | Ga0070673_100139393 | 3300005364 | Bacteria | 2044 |
| 66 | Ga0070673_100199750 | 3300005364 | Unclassified | 1722 |
| 67 | Ga0070673_100250429 | 3300005364 | Unclassified | 1544 |
| 68 | Ga0070673_101678383 | 3300005364 | Bacteria | 601 |
| 69 | Ga0070688_100026817 | 3300005365 | Bacteria | 3426 |
| 70 | Ga0070688_100440342 | 3300005365 | Unclassified | 972 |
| 71 | Ga0070659_100179546 | 3300005366 | Bacteria | 1737 |
| 72 | Ga0070667_100069098 | 3300005367 | Bacteria | 3006 |
| 73 | Ga0070667_100124171 | 3300005367 | Bacteria | 2248 |
| 74 | Ga0070667_100296274 | 3300005367 | Unclassified | 1456 |
| 75 | Ga0070667_100463529 | 3300005367 | Bacteria | 1159 |
| 76 | Ga0070667_100629161 | 3300005367 | Unclassified | 990 |
| 77 | Ga0070709_10003648 | 3300005434 | Bacteria | 8260 |
| 78 | Ga0070714_100282999 | 3300005435 | Bacteria | 1541 |
| 79 | Ga0070701_10170858 | 3300005438 | Unclassified | 1266 |
| 80 | Ga0070701_10266405 | 3300005438 | Bacteria | 1040 |
| 81 | Ga0070711_100232737 | 3300005439 | Bacteria | 1437 |
| 82 | Ga0070705_100306211 | 3300005440 | Bacteria | 1141 |
| 83 | Ga0070705_100413384 | 3300005440 | Bacteria | 1002 |
| 84 | Ga0070700_100433289 | 3300005441 | Unclassified | 996 |
| 85 | Ga0070700_100621656 | 3300005441 | Unclassified | 849 |
| 86 | Ga0070694_100888271 | 3300005444 | Unclassified | 735 |
| 87 | Ga0070708_100037172 | 3300005445 | Bacteria | 4247 |
| 88 | Ga0070708_101371065 | 3300005445 | Bacteria | 660 |
| 89 | Ga0070663_100011449 | 3300005455 | Bacteria | 5570 |
| 90 | Ga0070663_100201773 | 3300005455 | Bacteria | 1552 |
| 91 | Ga0070678_100218614 | 3300005456 | Unclassified | 1583 |
| 92 | Ga0070678_100320985 | 3300005456 | Bacteria | 1322 |
| 93 | Ga0070678_100901279 | 3300005456 | Unclassified | 808 |
| 94 | Ga0070662_100063456 | 3300005457 | Bacteria | 2702 |
| 95 | Ga0070662_100268583 | 3300005457 | Unclassified | 1376 |
| 96 | Ga0070662_100674070 | 3300005457 | Unclassified | 873 |
| 97 | Ga0070662_101146916 | 3300005457 | Bacteria | 667 |
| 98 | Ga0070681_10211915 | 3300005458 | Bacteria | 1853 |
| 99 | Ga0068867_100058488 | 3300005459 | Bacteria | 2857 |
| 100 | Ga0068867_100064327 | 3300005459 | Bacteria | 2727 |
| 101 | Ga0068867_100077128 | 3300005459 | Bacteria | 2503 |
| 102 | Ga0068867_100683726 | 3300005459 | Bacteria | 904 |
| 103 | Ga0068867_100946281 | 3300005459 | Unclassified | 778 |
| 104 | Ga0070685_10054642 | 3300005466 | Bacteria | 2318 |
| 105 | Ga0070706_100233480 | 3300005467 | Bacteria | 1717 |
| 106 | Ga0070706_100733885 | 3300005467 | Bacteria | 915 |
| 107 | Ga0070679_100161937 | 3300005530 | Bacteria | 2212 |
| 108 | Ga0070684_100001676 | 3300005535 | Bacteria | 16097 |
| 109 | Ga0070684_100131593 | 3300005535 | Bacteria | 2257 |
| 110 | Ga0070684_101276332 | 3300005535 | Unclassified | 691 |
| 111 | Ga0068853_100013571 | 3300005539 | Bacteria | 6657 |
| 112 | Ga0068853_101003924 | 3300005539 | Unclassified | 803 |
| 113 | Ga0070672_100281564 | 3300005543 | Bacteria | 1406 |
| 114 | Ga0070672_100318121 | 3300005543 | Bacteria | 1322 |
| 115 | Ga0070672_100591791 | 3300005543 | Unclassified | 965 |
| 116 | Ga0070672_101031683 | 3300005543 | Unclassified | 729 |
| 117 | Ga0070686_100368781 | 3300005544 | Bacteria | 1084 |
| 118 | Ga0070686_100478683 | 3300005544 | Bacteria | 962 |
| 119 | Ga0070686_100715772 | 3300005544 | Unclassified | 800 |
| 120 | Ga0070695_100115432 | 3300005545 | Bacteria | 1829 |
| 121 | Ga0070695_100380367 | 3300005545 | Bacteria | 1065 |
| 122 | Ga0070693_100010083 | 3300005547 | Bacteria | 4718 |
| 123 | Ga0070693_100283893 | 3300005547 | Bacteria | 1110 |
| 124 | Ga0070665_100012035 | 3300005548 | Bacteria | 8726 |
| 125 | Ga0070665_100012817 | 3300005548 | Bacteria | 8441 |
| 126 | Ga0070665_100307832 | 3300005548 | Unclassified | 1588 |
| 127 | Ga0070665_100348662 | 3300005548 | Bacteria | 1486 |
| 128 | Ga0070665_100584948 | 3300005548 | Unclassified | 1129 |
| 129 | Ga0070665_101700440 | 3300005548 | Unclassified | 638 |
| 130 | Ga0070704_100314406 | 3300005549 | Bacteria | 1310 |
| 131 | Ga0070704_100918719 | 3300005549 | Unclassified | 788 |
| 132 | Ga0068855_100000892 | 3300005563 | Bacteria | 37061 |
| 133 | Ga0068855_100990019 | 3300005563 | Unclassified | 884 |
| 134 | Ga0070664_100001454 | 3300005564 | Bacteria | 18865 |
| 135 | Ga0070664_100023731 | 3300005564 | Bacteria | 5066 |
| 136 | Ga0070664_100212097 | 3300005564 | Unclassified | 1731 |
| 137 | Ga0068857_100018488 | 3300005577 | Bacteria | 6114 |
| 138 | Ga0068857_100181239 | 3300005577 | Bacteria | 1917 |
| 139 | Ga0068856_100101173 | 3300005614 | Bacteria | 2875 |
| 140 | Ga0068852_100124148 | 3300005616 | Bacteria | 2368 |
| 141 | Ga0068859_100315835 | 3300005617 | Bacteria | 1656 |
| 142 | Ga0068859_100954223 | 3300005617 | Unclassified | 941 |
| 143 | Ga0068859_101232892 | 3300005617 | Bacteria | 824 |
| 144 | Ga0068859_101579969 | 3300005617 | Unclassified | 724 |
| 145 | Ga0068859_101594618 | 3300005617 | Unclassified | 721 |
| 146 | Ga0068864_100018939 | 3300005618 | Bacteria | 5755 |
| 147 | Ga0068864_100030241 | 3300005618 | Bacteria | 4590 |
| 148 | Ga0068864_100096879 | 3300005618 | Bacteria | 2611 |
| 149 | Ga0068864_100114586 | 3300005618 | Bacteria | 2404 |
| 150 | Ga0068864_100220994 | 3300005618 | Bacteria | 1748 |
| 151 | Ga0068864_100342976 | 3300005618 | Bacteria | 1408 |
| 152 | Ga0068864_100452215 | 3300005618 | Bacteria | 1228 |
| 153 | Ga0068864_100845580 | 3300005618 | Unclassified | 901 |
| 154 | Ga0068861_100049092 | 3300005719 | Unclassified | 3193 |
| 155 | Ga0068861_100807055 | 3300005719 | Bacteria | 881 |
| 156 | Ga0068851_10037124 | 3300005834 | Bacteria | 2442 |
| 157 | Ga0068851_10545032 | 3300005834 | Unclassified | 700 |
| 158 | Ga0068870_10385683 | 3300005840 | Unclassified | 908 |
| 159 | Ga0068870_11214016 | 3300005840 | Unclassified | 546 |
| 160 | Ga0068863_100004211 | 3300005841 | Bacteria | 14208 |
| 161 | Ga0068863_100048863 | 3300005841 | Bacteria | 4011 |
| 162 | Ga0068863_100125596 | 3300005841 | Bacteria | 2447 |
| 163 | Ga0068863_100388646 | 3300005841 | Bacteria | 1363 |
| 164 | Ga0068863_100526740 | 3300005841 | Bacteria | 1165 |
| 165 | Ga0068858_100005625 | 3300005842 | Bacteria | 12254 |
| 166 | Ga0068858_100342396 | 3300005842 | Unclassified | 1431 |
| 167 | Ga0068858_100691034 | 3300005842 | Bacteria | 992 |
| 168 | Ga0068858_100880400 | 3300005842 | Bacteria | 875 |
| 169 | Ga0068858_100985316 | 3300005842 | Unclassified | 826 |
| 170 | Ga0068860_100000377 | 3300005843 | Bacteria | 58377 |
| 171 | Ga0068860_100676946 | 3300005843 | Bacteria | 1040 |
| 172 | Ga0068860_101331824 | 3300005843 | Unclassified | 739 |
| 173 | Ga0068860_101441444 | 3300005843 | Bacteria | 710 |
| 174 | Ga0068862_100123252 | 3300005844 | Bacteria | 2286 |
| 175 | Ga0068862_100243144 | 3300005844 | Bacteria | 1637 |
| 176 | Ga0068862_100620083 | 3300005844 | Unclassified | 1040 |
| 177 | Ga0068862_102518157 | 3300005844 | Unclassified | 526 |
| 178 | Ga0097621_100014536 | 3300006237 | Bacteria | 5894 |
| 179 | Ga0097621_100092630 | 3300006237 | Bacteria | 2531 |
| 180 | Ga0097621_101053583 | 3300006237 | Bacteria | 762 |
| 181 | Ga0097621_101508305 | 3300006237 | Unclassified | 638 |
| 182 | Ga0068871_100041999 | 3300006358 | Bacteria | 3669 |
| 183 | Ga0068871_100177268 | 3300006358 | Unclassified | 1830 |
| 184 | Ga0075428_100398947 | 3300006844 | Bacteria | 1474 |
| 185 | Ga0075431_100144001 | 3300006847 | Unclassified | 2456 |
| 186 | Ga0075433_10376144 | 3300006852 | Unclassified | 1254 |
| 187 | Ga0075433_11462716 | 3300006852 | Unclassified | 590 |
| 188 | Ga0075434_100821526 | 3300006871 | Unclassified | 945 |
| 189 | Ga0075429_100263444 | 3300006880 | Unclassified | 1509 |
| 190 | Ga0068865_100087749 | 3300006881 | Bacteria | 2249 |
| 191 | Ga0068865_101485846 | 3300006881 | Unclassified | 607 |
| 192 | Ga0075436_100005942 | 3300006914 | Bacteria | 8387 |
| 193 | Ga0075436_100448226 | 3300006914 | Bacteria | 939 |
| 194 | Ga0097620_100315827 | 3300006931 | Bacteria | 1656 |
| 195 | Ga0097620_100954255 | 3300006931 | Unclassified | 941 |
| 196 | Ga0097620_101232888 | 3300006931 | Bacteria | 824 |
| 197 | Ga0097620_101579935 | 3300006931 | Unclassified | 724 |
| 198 | Ga0097620_101594679 | 3300006931 | Unclassified | 721 |
| 199 | Ga0075435_100045538 | 3300007076 | Bacteria | 3517 |
| 200 | Ga0105240_10006145 | 3300009093 | Bacteria | 17711 |
| 201 | Ga0105240_10113024 | 3300009093 | Unclassified | 3282 |
| 202 | Ga0105240_11333696 | 3300009093 | Unclassified | 756 |
| 203 | Ga0111539_10007245 | 3300009094 | Bacteria | 14211 |
| 204 | Ga0111539_10515313 | 3300009094 | Bacteria | 1393 |
| 205 | Ga0111539_10526951 | 3300009094 | Unclassified | 1376 |
| 206 | Ga0111539_11048741 | 3300009094 | Bacteria | 948 |
| 207 | Ga0111539_11478731 | 3300009094 | Unclassified | 788 |
| 208 | Ga0105245_10032747 | 3300009098 | Bacteria | 4602 |
| 209 | Ga0105247_10006983 | 3300009101 | Bacteria | 6949 |
| 210 | Ga0105243_10652114 | 3300009148 | Bacteria | 1020 |
| 211 | Ga0105241_10555069 | 3300009174 | Bacteria | 1032 |
| 212 | Ga0105241_11161123 | 3300009174 | Bacteria | 730 |
| 213 | Ga0105242_10033723 | 3300009176 | Bacteria | 4101 |
| 214 | Ga0105242_12469502 | 3300009176 | Unclassified | 568 |
| 215 | Ga0105248_10000387 | 3300009177 | Bacteria | 50809 |
| 216 | Ga0105248_10034586 | 3300009177 | Bacteria | 5652 |
| 217 | Ga0105248_10264091 | 3300009177 | Unclassified | 1938 |
| 218 | Ga0105248_10863339 | 3300009177 | Bacteria | 1022 |
| 219 | Ga0105248_12870326 | 3300009177 | Unclassified | 549 |
| 220 | Ga0105237_10306742 | 3300009545 | Bacteria | 1590 |
| 221 | Ga0105237_10477504 | 3300009545 | Bacteria | 1253 |
| 222 | Ga0105238_10284017 | 3300009551 | Unclassified | 1637 |
| 223 | Ga0105238_11207113 | 3300009551 | Bacteria | 781 |
| 224 | Ga0105238_12877300 | 3300009551 | Unclassified | 517 |
| 225 | Ga0105249_10002487 | 3300009553 | Bacteria | 15968 |
| 226 | Ga0105249_12022542 | 3300009553 | Unclassified | 649 |
| 227 | Ga0105239_10021333 | 3300010375 | Bacteria | 7142 |
| 228 | Ga0105239_11463197 | 3300010375 | Unclassified | 789 |
| 229 | Ga0105246_10242172 | 3300011119 | Unclassified | 1426 |
| 230 | Ga0105246_10434197 | 3300011119 | Unclassified | 1099 |
| 231 | Ga0157317_1025434 | 3300012475 | Bacteria | 551 |
| 232 | Ga0157374_10031824 | 3300013296 | Bacteria | 4798 |
| 233 | Ga0157374_10040856 | 3300013296 | Bacteria | 4272 |
| 234 | Ga0157374_10465227 | 3300013296 | Bacteria | 1267 |
| 235 | Ga0157374_10497278 | 3300013296 | Bacteria | 1224 |
| 236 | Ga0157374_10994048 | 3300013296 | Bacteria | 858 |
| 237 | Ga0157378_10022961 | 3300013297 | Bacteria | 5491 |
| 238 | Ga0157378_10134327 | 3300013297 | Bacteria | 2293 |
| 239 | Ga0157378_11200942 | 3300013297 | Unclassified | 798 |
| 240 | Ga0163162_10236344 | 3300013306 | Bacteria | 1958 |
| 241 | Ga0163162_10391991 | 3300013306 | Unclassified | 1521 |
| 242 | Ga0163162_10496994 | 3300013306 | Bacteria | 1350 |
| 243 | Ga0163162_10649682 | 3300013306 | Bacteria | 1178 |
| 244 | Ga0163162_12006997 | 3300013306 | Bacteria | 663 |
| 245 | Ga0157375_10012273 | 3300013308 | Bacteria | 7597 |
| 246 | Ga0157375_10099091 | 3300013308 | Bacteria | 2993 |
| 247 | Ga0157375_10500967 | 3300013308 | Bacteria | 1379 |
| 248 | Ga0157375_10918467 | 3300013308 | Bacteria | 1018 |
| 249 | Ga0157375_12029122 | 3300013308 | Bacteria | 684 |
| 250 | Ga0157375_12094049 | 3300013308 | Bacteria | 673 |
| 251 | Ga0163163_10002171 | 3300014325 | Bacteria | 16562 |
| 252 | Ga0163163_10022009 | 3300014325 | Bacteria | 6027 |
| 253 | Ga0163163_10077720 | 3300014325 | Bacteria | 3314 |
| 254 | Ga0163163_10162785 | 3300014325 | Bacteria | 2277 |
| 255 | Ga0163163_10185169 | 3300014325 | Unclassified | 2130 |
| 256 | Ga0163163_10289788 | 3300014325 | Bacteria | 1689 |
| 257 | Ga0163163_10291339 | 3300014325 | Bacteria | 1684 |
| 258 | Ga0163163_10526716 | 3300014325 | Bacteria | 1244 |
| 259 | Ga0163163_11503389 | 3300014325 | Unclassified | 735 |
| 260 | Ga0157380_10095983 | 3300014326 | Bacteria | 2457 |
| 261 | Ga0157380_10264399 | 3300014326 | Bacteria | 1564 |
| 262 | Ga0157380_10637199 | 3300014326 | Bacteria | 1061 |
| 263 | Ga0157380_10739272 | 3300014326 | Unclassified | 994 |
| 264 | Ga0157380_10994997 | 3300014326 | Unclassified | 871 |
| 265 | Ga0157377_10038437 | 3300014745 | Bacteria | 2642 |
| 266 | Ga0157377_10075559 | 3300014745 | Bacteria | 1957 |
| 267 | Ga0157377_10593534 | 3300014745 | Unclassified | 789 |
| 268 | Ga0157379_10193238 | 3300014968 | Unclassified | 1839 |
| 269 | Ga0157379_10213853 | 3300014968 | Bacteria | 1746 |
| 270 | Ga0157379_10647994 | 3300014968 | Bacteria | 989 |
| 271 | Ga0157379_10975326 | 3300014968 | Bacteria | 807 |
| 272 | Ga0157376_10760569 | 3300014969 | Bacteria | 979 |
| 273 | Ga0157376_11727628 | 3300014969 | Bacteria | 661 |
| 274 | Ga0157376_12115016 | 3300014969 | Bacteria | 601 |
| 275 | Ga0157376_12614072 | 3300014969 | Unclassified | 545 |
| 276 | Ga0163161_10481200 | 3300017792 | Unclassified | 1008 |
| 277 | Ga0207656_10529497 | 3300025321 | Unclassified | 599 |
| 278 | Ga0207642_10471351 | 3300025899 | Unclassified | 764 |
| 279 | Ga0207710_10005531 | 3300025900 | Bacteria | 5437 |
| 280 | Ga0207688_10059179 | 3300025901 | Unclassified | 2157 |
| 281 | Ga0207688_10060833 | 3300025901 | Bacteria | 2128 |
| 282 | Ga0207688_10487487 | 3300025901 | Bacteria | 771 |
| 283 | Ga0207680_10046496 | 3300025903 | Unclassified | 2566 |
| 284 | Ga0207680_10241989 | 3300025903 | Bacteria | 1244 |
| 285 | Ga0207680_10688920 | 3300025903 | Unclassified | 732 |
| 286 | Ga0207685_10088144 | 3300025905 | Bacteria | 1300 |
| 287 | Ga0207699_10055516 | 3300025906 | Bacteria | 2357 |
| 288 | Ga0207645_10173555 | 3300025907 | Bacteria | 1413 |
| 289 | Ga0207684_10664059 | 3300025910 | Bacteria | 888 |
| 290 | Ga0207695_10007482 | 3300025913 | Bacteria | 13873 |
| 291 | Ga0207671_10224091 | 3300025914 | Bacteria | 1474 |
| 292 | Ga0207671_10923362 | 3300025914 | Bacteria | 690 |
| 293 | Ga0207663_10152254 | 3300025916 | Bacteria | 1624 |
| 294 | Ga0207662_10901132 | 3300025918 | Bacteria | 626 |
| 295 | Ga0207657_10018401 | 3300025919 | Bacteria | 6669 |
| 296 | Ga0207657_10302521 | 3300025919 | Bacteria | 1267 |
| 297 | Ga0207649_10256222 | 3300025920 | Unclassified | 1262 |
| 298 | Ga0207649_10429336 | 3300025920 | Bacteria | 994 |
| 299 | Ga0207649_10564577 | 3300025920 | Bacteria | 872 |
| 300 | Ga0207652_10123794 | 3300025921 | Bacteria | 2302 |
| 301 | Ga0207646_11431140 | 3300025922 | Unclassified | 600 |
| 302 | Ga0207681_10021027 | 3300025923 | Unclassified | 4142 |
| 303 | Ga0207681_10218264 | 3300025923 | Bacteria | 1474 |
| 304 | Ga0207681_10237311 | 3300025923 | Bacteria | 1418 |
| 305 | Ga0207694_10561707 | 3300025924 | Unclassified | 958 |
| 306 | Ga0207650_10046047 | 3300025925 | Bacteria | 3211 |
| 307 | Ga0207650_10063188 | 3300025925 | Bacteria | 2767 |
| 308 | Ga0207650_10237299 | 3300025925 | Bacteria | 1473 |
| 309 | Ga0207650_10421875 | 3300025925 | Unclassified | 1107 |
| 310 | Ga0207650_10454394 | 3300025925 | Unclassified | 1066 |
| 311 | Ga0207650_11064239 | 3300025925 | Bacteria | 688 |
| 312 | Ga0207659_10000600 | 3300025926 | Bacteria | 21501 |
| 313 | Ga0207659_10244610 | 3300025926 | Bacteria | 1453 |
| 314 | Ga0207659_10583245 | 3300025926 | Unclassified | 952 |
| 315 | Ga0207659_11265432 | 3300025926 | Unclassified | 634 |
| 316 | Ga0207664_10262822 | 3300025929 | Bacteria | 1510 |
| 317 | Ga0207690_10129018 | 3300025932 | Bacteria | 1848 |
| 318 | Ga0207706_10165800 | 3300025933 | Unclassified | 1941 |
| 319 | Ga0207709_10264746 | 3300025935 | Bacteria | 1262 |
| 320 | Ga0207670_10236299 | 3300025936 | Bacteria | 1406 |
| 321 | Ga0207669_10216611 | 3300025937 | Bacteria | 1402 |
| 322 | Ga0207704_10032112 | 3300025938 | Bacteria | 2967 |
| 323 | Ga0207704_10779075 | 3300025938 | Unclassified | 797 |
| 324 | Ga0207691_10097637 | 3300025940 | Unclassified | 2625 |
| 325 | Ga0207691_10149257 | 3300025940 | Bacteria | 2056 |
| 326 | Ga0207691_10248631 | 3300025940 | Bacteria | 1535 |
| 327 | Ga0207711_10238325 | 3300025941 | Bacteria | 1668 |
| 328 | Ga0207711_10453925 | 3300025941 | Unclassified | 1193 |
| 329 | Ga0207711_10484901 | 3300025941 | Unclassified | 1152 |
| 330 | Ga0207711_10665530 | 3300025941 | Bacteria | 971 |
| 331 | Ga0207689_10098480 | 3300025942 | Bacteria | 2402 |
| 332 | Ga0207689_10225651 | 3300025942 | Bacteria | 1548 |
| 333 | Ga0207689_10442991 | 3300025942 | Unclassified | 1085 |
| 334 | Ga0207689_10689679 | 3300025942 | Bacteria | 861 |
| 335 | Ga0207661_10132674 | 3300025944 | Bacteria | 2136 |
| 336 | Ga0207661_10157113 | 3300025944 | Unclassified | 1971 |
| 337 | Ga0207679_10085993 | 3300025945 | Bacteria | 2417 |
| 338 | Ga0207679_10792435 | 3300025945 | Unclassified | 864 |
| 339 | Ga0207667_10009937 | 3300025949 | Bacteria | 11163 |
| 340 | Ga0207667_10485777 | 3300025949 | Bacteria | 1253 |
| 341 | Ga0207651_10003082 | 3300025960 | Bacteria | 8097 |
| 342 | Ga0207651_10038042 | 3300025960 | Bacteria | 3158 |
| 343 | Ga0207651_10198804 | 3300025960 | Bacteria | 1605 |
| 344 | Ga0207712_10026019 | 3300025961 | Unclassified | 3894 |
| 345 | Ga0207712_10372217 | 3300025961 | Unclassified | 1193 |
| 346 | Ga0207668_10062790 | 3300025972 | Bacteria | 2617 |
| 347 | Ga0207668_10523539 | 3300025972 | Bacteria | 1023 |
| 348 | Ga0207658_10007624 | 3300025986 | Bacteria | 7372 |
| 349 | Ga0207658_10175691 | 3300025986 | Bacteria | 1768 |
| 350 | Ga0207658_10287724 | 3300025986 | Bacteria | 1411 |
| 351 | Ga0207658_10293094 | 3300025986 | Unclassified | 1399 |
| 352 | Ga0207658_10399037 | 3300025986 | Bacteria | 1208 |
| 353 | Ga0207658_10590751 | 3300025986 | Unclassified | 997 |
| 354 | Ga0207677_10219258 | 3300026023 | Unclassified | 1525 |
| 355 | Ga0207677_10565684 | 3300026023 | Bacteria | 993 |
| 356 | Ga0207677_11090042 | 3300026023 | Unclassified | 728 |
| 357 | Ga0207703_10009355 | 3300026035 | Bacteria | 7703 |
| 358 | Ga0207703_10654845 | 3300026035 | Bacteria | 997 |
| 359 | Ga0207639_11014173 | 3300026041 | Unclassified | 777 |
| 360 | Ga0207678_10209758 | 3300026067 | Bacteria | 1666 |
| 361 | Ga0207678_10430904 | 3300026067 | Unclassified | 1144 |
| 362 | Ga0207708_10791254 | 3300026075 | Unclassified | 816 |
| 363 | Ga0207702_10103004 | 3300026078 | Unclassified | 2524 |
| 364 | Ga0207702_10813083 | 3300026078 | Bacteria | 924 |
| 365 | Ga0207641_10000255 | 3300026088 | Bacteria | 67770 |
| 366 | Ga0207641_10105740 | 3300026088 | Unclassified | 2486 |
| 367 | Ga0207641_10216101 | 3300026088 | Unclassified | 1775 |
| 368 | Ga0207641_10238360 | 3300026088 | Bacteria | 1694 |
| 369 | Ga0207641_10391878 | 3300026088 | Bacteria | 1332 |
| 370 | Ga0207641_11405790 | 3300026088 | Unclassified | 699 |
| 371 | Ga0207641_12335725 | 3300026088 | Unclassified | 534 |
| 372 | Ga0207648_10055915 | 3300026089 | Bacteria | 3444 |
| 373 | Ga0207648_10066961 | 3300026089 | Bacteria | 3132 |
| 374 | Ga0207648_10080348 | 3300026089 | Bacteria | 2844 |
| 375 | Ga0207648_10133476 | 3300026089 | Bacteria | 2186 |
| 376 | Ga0207648_11132222 | 3300026089 | Unclassified | 734 |
| 377 | Ga0207676_10011200 | 3300026095 | Bacteria | 6404 |
| 378 | Ga0207676_10029866 | 3300026095 | Bacteria | 4085 |
| 379 | Ga0207676_10083223 | 3300026095 | Bacteria | 2605 |
| 380 | Ga0207676_10188368 | 3300026095 | Bacteria | 1813 |
| 381 | Ga0207676_10523684 | 3300026095 | Bacteria | 1129 |
| 382 | Ga0207676_10624300 | 3300026095 | Unclassified | 1037 |
| 383 | Ga0207676_10646110 | 3300026095 | Unclassified | 1020 |
| 384 | Ga0207676_10799550 | 3300026095 | Unclassified | 920 |
| 385 | Ga0207674_10017130 | 3300026116 | Bacteria | 7910 |
| 386 | Ga0207674_11120113 | 3300026116 | Unclassified | 756 |
| 387 | Ga0207675_100008908 | 3300026118 | Bacteria | 9415 |
| 388 | Ga0207675_100751295 | 3300026118 | Bacteria | 987 |
| 389 | Ga0207683_10043326 | 3300026121 | Bacteria | 3933 |
| 390 | Ga0207683_10056683 | 3300026121 | Bacteria | 3438 |
| 391 | Ga0207683_10283173 | 3300026121 | Unclassified | 1515 |
| 392 | Ga0207683_10468190 | 3300026121 | Unclassified | 1162 |
| 393 | Ga0207683_10759059 | 3300026121 | Bacteria | 900 |
| 394 | Ga0207698_10159567 | 3300026142 | Bacteria | 1970 |
| 395 | Ga0207698_10297242 | 3300026142 | Unclassified | 1501 |
| 396 | Ga0207698_10359022 | 3300026142 | Bacteria | 1379 |
| 397 | Ga0207428_10104793 | 3300027907 | Unclassified | 2182 |
| 398 | Ga0207428_10138782 | 3300027907 | Bacteria | 1857 |
| 399 | Ga0268266_10013647 | 3300028379 | Bacteria | 6997 |
| 400 | Ga0268266_10014443 | 3300028379 | Bacteria | 6789 |
| 401 | Ga0268266_10056638 | 3300028379 | Bacteria | 3372 |
| 402 | Ga0268266_10121422 | 3300028379 | Bacteria | 2326 |
| 403 | Ga0268265_10018891 | 3300028380 | Bacteria | 4784 |
| 404 | Ga0268265_10095253 | 3300028380 | Bacteria | 2390 |
| 405 | Ga0268264_10000370 | 3300028381 | Bacteria | 66454 |
| 406 | Ga0268264_10393792 | 3300028381 | Bacteria | 1329 |
| 407 | Ga0268264_10824490 | 3300028381 | Bacteria | 928 |
| 408 | Ga0268264_10877662 | 3300028381 | Bacteria | 899 |
| 409 | Ga0268264_10964473 | 3300028381 | Bacteria | 858 |
| 410 | Ga0265336_10022980 | 3300028666 | Bacteria | 1982 |
| 411 | Ga0307511_10003371 | 3300030521 | Bacteria | 16447 |
| 412 | Ga0265332_10000528 | 3300031238 | Bacteria | 26011 |
| 413 | Ga0265339_10304783 | 3300031249 | Unclassified | 759 |
| 414 | Ga0265331_10001073 | 3300031250 | Bacteria | 21220 |
| 415 | Ga0265327_10003590 | 3300031251 | Bacteria | 14643 |
| 416 | Ga0265316_10059099 | 3300031344 | Bacteria | 2983 |
| 417 | Ga0307513_10382848 | 3300031456 | Bacteria | 1146 |
| 418 | Ga0307509_10000109 | 3300031507 | Bacteria | 117520 |
| 419 | Ga0307509_10324962 | 3300031507 | Bacteria | 1273 |
| 420 | Ga0307408_100205545 | 3300031548 | Bacteria | 1597 |
| 421 | Ga0307408_100370191 | 3300031548 | Unclassified | 1222 |
| 422 | Ga0307408_101181193 | 3300031548 | Unclassified | 713 |
| 423 | Ga0265313_10145050 | 3300031595 | Bacteria | 1018 |
| 424 | Ga0307508_10187228 | 3300031616 | Bacteria | 1672 |
| 425 | Ga0307508_10571535 | 3300031616 | Unclassified | 730 |
| 426 | Ga0307508_10873575 | 3300031616 | Unclassified | 523 |
| 427 | Ga0316575_10001297 | 3300031665 | Bacteria | 7981 |
| 428 | Ga0265314_10079782 | 3300031711 | Bacteria | 2163 |
| 429 | Ga0265342_10053006 | 3300031712 | Bacteria | 2415 |
| 430 | Ga0316576_10011335 | 3300031727 | Bacteria | 5838 |
| 431 | Ga0316576_10490381 | 3300031727 | Unclassified | 905 |
| 432 | Ga0316578_10533114 | 3300031728 | Bacteria | 690 |
| 433 | Ga0316577_10012117 | 3300031733 | Unclassified | 4690 |
| 434 | Ga0307410_10041897 | 3300031852 | Bacteria | 3022 |
| 435 | Ga0307410_10298595 | 3300031852 | Bacteria | 1270 |
| 436 | Ga0307410_10453855 | 3300031852 | Bacteria | 1046 |
| 437 | Ga0307407_10433861 | 3300031903 | Bacteria | 950 |
| 438 | Ga0307407_10451824 | 3300031903 | Unclassified | 933 |
| 439 | Ga0307412_11431556 | 3300031911 | Unclassified | 626 |
| 440 | Ga0307409_100256928 | 3300031995 | Bacteria | 1601 |
| 441 | Ga0307409_100309714 | 3300031995 | Bacteria | 1473 |
| 442 | Ga0307416_100321772 | 3300032002 | Bacteria | 1549 |
| 443 | Ga0307416_100862138 | 3300032002 | Unclassified | 1004 |
| 444 | Ga0307416_103712656 | 3300032002 | Unclassified | 511 |
| 445 | Ga0307414_11366738 | 3300032004 | Unclassified | 658 |
| 446 | Ga0307411_10051571 | 3300032005 | Bacteria | 2685 |
| 447 | Ga0307411_10905062 | 3300032005 | Unclassified | 784 |
| 448 | Ga0307415_100345742 | 3300032126 | Unclassified | 1250 |
| 449 | Ga0316580_10287017 | 3300032139 | Unclassified | 511 |
| 450 | Ga0307510_10010047 | 3300033180 | Bacteria | 11246 |
| 451 | Ga0373948_0003131 | 3300034817 | Bacteria | 2516 |
| 452 | Ga0373950_0003702 | 3300034818 | Bacteria | 2204 |
| 453 | Ga0373958_0002058 | 3300034819 | Bacteria | 2778 |
| 454 | Ga0373959_0013334 | 3300034820 | Bacteria | 1480 |
| 455 | Ga0373928_0001597 | 3300035084 | Bacteria | 4392 |
| 456 | Ga0373929_0002095 | 3300035085 | Bacteria | 3711 |
| 457 | Ga0373940_0023768 | 3300035088 | Bacteria | 1584 |
| 458 | Ga0373944_0004553 | 3300035089 | Bacteria | 3618 |
| 459 | Ga0373944_0066507 | 3300035089 | Unclassified | 1166 |
| 460 | Ga0373949_0001119 | 3300035090 | Bacteria | 8112 |
| 461 | Ga0373951_0003335 | 3300035091 | Unclassified | 3929 |
| 462 | Ga0373952_0000824 | 3300035092 | Bacteria | 5596 |
| 463 | Ga0373932_0028199 | 3300035112 | Bacteria | 1541 |
| 464 | Ga0373939_0098510 | 3300035114 | Bacteria | 999 |
| 465 | Ga0373939_0243216 | 3300035114 | Unclassified | 697 |
| 466 | Ga0373941_0014736 | 3300035115 | Bacteria | 2095 |
| 467 | Ga0373945_0354935 | 3300035116 | Unclassified | 636 |
| 468 | Ga0373953_0083975 | 3300035117 | Bacteria | 1327 |
| 469 | Ga0373954_0202687 | 3300035118 | Bacteria | 975 |
| 470 | Ga0373954_0583684 | 3300035118 | Unclassified | 554 |
| 471 | Ga0373960_0015485 | 3300035121 | Bacteria | 1947 |
| 472 | Ga0373943_0235443 | 3300035170 | Bacteria | 1024 |
| 473 | Ga0373955_0096037 | 3300035172 | Bacteria | 1696 |
| 474 | Ga0373942_0001341 | 3300035207 | Bacteria | 6382 |
| 475 | Ga0373961_0001024 | 3300035241 | Bacteria | 9104 |
| 476 | Ga0373961_0175179 | 3300035241 | Unclassified | 744 |
| 477 | Ga0373962_0002619 | 3300035242 | Bacteria | 4277 |
| 478 | Ga0316574_0049500 | 3300035398 | Bacteria | 2613 |
| 479 | Ga0316574_0055067 | 3300035398 | Bacteria | 2486 |
| 480 | Ga0316574_0217442 | 3300035398 | Bacteria | 1225 |
| 481 | Ga0316574_0260690 | 3300035398 | Bacteria | 1107 |
| 482 | Ga0316574_0329129 | 3300035398 | Bacteria | 969 |
| 483 | Ga0316574_0852292 | 3300035398 | Unclassified | 553 |
| 484 | Ga0373931_0000743 | 3300035691 | Bacteria | 13596 |
| 485 | Ga0373931_0012427 | 3300035691 | Bacteria | 4125 |
| 486 | Ga0373947_0279452 | 3300035725 | Bacteria | 1110 |
| 487 | Ga0373937_0032315 | 3300036401 | Bacteria | 4747 |
| 488 | Ga0373937_1015057 | 3300036401 | Archaea | 778 |
| 489 | Ga0373937_1791803 | 3300036401 | Bacteria | 560 |
| 490 | Ga0316582_0214029 | 3300036647 | Bacteria | 1317 |
| 491 | Ga0316584_0099884 | 3300036712 | Unclassified | 2173 |
| 492 | Ga0395899_0000348 | 3300037312 | Bacteria | 56960 |
| 493 | Ga0395900_0001780 | 3300037418 | Bacteria | 24711 |
| 494 | Ga0395898_0000750 | 3300037466 | Bacteria | 56675 |
| 495 | Ga0395901_0000344 | 3300038443 | Bacteria | 56658 |
| 496 | Ga0439443_039650 | 3300042003 | Unclassified | 801 |
| 497 | Ga0450889_018968 | 3300042144 | Bacteria | 754 |
| 498 | Ga0439446_0084381 | 3300042156 | Bacteria | 987 |
| 499 | Ga0439464_0079432 | 3300042439 | Unclassified | 978 |
| 500 | Ga0451577_0031098 | 3300042876 | Bacteria | 4818 |
| 501 | Ga0451577_0092236 | 3300042876 | Bacteria | 2704 |
| 502 | Ga0451577_0103422 | 3300042876 | Bacteria | 2545 |
| 503 | Ga0451577_0210025 | 3300042876 | Bacteria | 1758 |
| 504 | Ga0451577_0517797 | 3300042876 | Bacteria | 1083 |
| 505 | Ga0451577_1236137 | 3300042876 | Bacteria | 666 |
| 506 | Ga0453684_0013318 | 3300044712 | Bacteria | 13383 |
| 507 | Ga0453684_0118790 | 3300044712 | Bacteria | 3197 |
| 508 | Ga0451576_0036862 | 3300045051 | Bacteria | 5181 |
| 509 | Ga0451576_0054542 | 3300045051 | Bacteria | 4185 |
| 510 | Ga0451576_0077325 | 3300045051 | Bacteria | 3463 |
| 511 | Ga0451576_0385472 | 3300045051 | Bacteria | 1469 |
| 512 | Ga0495592_0143952 | 3300046454 | Bacteria | 1655 |
| 513 | Ga0495629_0700971 | 3300046459 | Bacteria | 672 |
| 514 | Ga0495580_0526193 | 3300046472 | Unclassified | 787 |
| 515 | Ga0495582_0006259 | 3300046473 | Bacteria | 6635 |
| 516 | Ga0495582_0080932 | 3300046473 | Bacteria | 1804 |
| 517 | Ga0495639_0024924 | 3300046475 | Bacteria | 2635 |
| 518 | Ga0495639_0489329 | 3300046475 | Unclassified | 627 |
| 519 | Ga0495594_0189435 | 3300046499 | Bacteria | 1172 |
| 520 | Ga0495666_0490066 | 3300046526 | Unclassified | 549 |
| 521 | Ga0495665_0178978 | 3300046531 | Bacteria | 1102 |
| 522 | Ga0495586_0071473 | 3300046535 | Bacteria | 1896 |
| 523 | Ga0495587_0405512 | 3300046536 | Unclassified | 757 |
| 524 | Ga0495645_0527384 | 3300046543 | Unclassified | 735 |
| 525 | Ga0495645_0816715 | 3300046543 | Unclassified | 558 |
| 526 | Ga0495667_0287806 | 3300046559 | Unclassified | 1042 |
| 527 | Ga0495667_0670875 | 3300046559 | Unclassified | 643 |
| 528 | Ga0495611_0520007 | 3300046648 | Unclassified | 540 |
| 529 | Ga0495625_0508252 | 3300046660 | Unclassified | 736 |
| 530 | Ga0495635_0317358 | 3300046663 | Bacteria | 1043 |
| 531 | Ga0495657_0127093 | 3300046675 | Bacteria | 1600 |
| 532 | Ga0495646_0495097 | 3300046680 | Unclassified | 628 |
| 533 | Ga0495647_0018954 | 3300046681 | Bacteria | 2456 |
| 534 | Ga0495647_0025293 | 3300046681 | Bacteria | 2168 |
| 535 | Ga0495658_0016537 | 3300046683 | Bacteria | 3796 |
| 536 | Ga0495658_0030295 | 3300046683 | Bacteria | 2937 |
| 537 | Ga0495669_0042534 | 3300046684 | Bacteria | 2020 |
| 538 | Ga0495669_0486599 | 3300046684 | Unclassified | 600 |
| 539 | Ga0495613_0405181 | 3300046689 | Unclassified | 930 |
| 540 | Ga0495600_0463962 | 3300046809 | Bacteria | 782 |
| 541 | Ga0495674_0273382 | 3300047319 | Bacteria | 1386 |
| 542 | Ga0495680_0284783 | 3300047322 | Bacteria | 1164 |
| 543 | Ga0495680_0285223 | 3300047322 | Unclassified | 1163 |
| 544 | Ga0495593_0205333 | 3300047673 | Unclassified | 990 |
| 545 | Ga0496101_0191869 | 3300048904 | Bacteria | 1577 |
| 546 | Ga0496101_1038659 | 3300048904 | Bacteria | 644 |
| 547 | Ga0496108_0876177 | 3300048911 | Bacteria | 772 |
| 548 | Ga0496110_0488985 | 3300048913 | Bacteria | 1121 |
| 549 | Ga0496112_0029235 | 3300048915 | Bacteria | 5328 |
| 550 | Ga0496112_0038581 | 3300048915 | Bacteria | 4664 |
| 551 | Ga0496112_0785430 | 3300048915 | Bacteria | 877 |
| 552 | Ga0496113_0008021 | 3300048916 | Bacteria | 6849 |
| 553 | Ga0496113_0830461 | 3300048916 | Bacteria | 733 |
| 554 | Ga0496114_0507317 | 3300048917 | Bacteria | 1067 |
| 555 | Ga0496119_0002294 | 3300048922 | Bacteria | 21157 |
| 556 | Ga0496119_0027028 | 3300048922 | Unclassified | 3959 |
| 557 | Ga0496120_0002163 | 3300048923 | Bacteria | 20906 |
| 558 | Ga0496124_0045755 | 3300048927 | Bacteria | 3751 |
| 559 | Ga0496125_0016346 | 3300048928 | Bacteria | 7130 |
| 560 | Ga0501033_0409825 | 3300049570 | Bacteria | 945 |
| 561 | Ga0501036_0185809 | 3300049572 | Bacteria | 1749 |
| 562 | Ga0501036_1261705 | 3300049572 | Unclassified | 601 |
| 563 | Ga0501037_0833776 | 3300049573 | Bacteria | 607 |
| 564 | Ga0501037_1100206 | 3300049573 | Bacteria | 515 |
| 565 | Ga0501038_0273983 | 3300049574 | Bacteria | 1330 |
| 566 | Ga0501038_0663719 | 3300049574 | Bacteria | 784 |
| 567 | Ga0501039_0162776 | 3300049575 | Bacteria | 1754 |
| 568 | Ga0501040_0020633 | 3300049576 | Bacteria | 4393 |
| 569 | Ga0501040_0542025 | 3300049576 | Bacteria | 839 |
| 570 | Ga0501041_0068044 | 3300049577 | Bacteria | 2183 |
| 571 | Ga0501041_0238941 | 3300049577 | Bacteria | 1141 |
| 572 | Ga0501042_0060641 | 3300049578 | Unclassified | 2702 |
| 573 | Ga0501042_1305601 | 3300049578 | Unclassified | 529 |
| 574 | Ga0501043_0086328 | 3300049579 | Bacteria | 2466 |
| 575 | Ga0501046_0752860 | 3300049580 | Bacteria | 684 |
| 576 | Ga0501046_1012941 | 3300049580 | Bacteria | 576 |
| 577 | Ga0501048_0414927 | 3300049582 | Bacteria | 963 |
| 578 | Ga0501067_0179179 | 3300049583 | Bacteria | 1180 |
| 579 | Ga0501068_0000659 | 3300049584 | Bacteria | 17770 |
| 580 | Ga0501071_0004008 | 3300049587 | Bacteria | 9296 |
| 581 | Ga0501071_0088593 | 3300049587 | Bacteria | 2271 |
| 582 | Ga0501071_0195420 | 3300049587 | Bacteria | 1518 |
| 583 | Ga0501071_0545475 | 3300049587 | Bacteria | 890 |
| 584 | Ga0501072_0043048 | 3300049588 | Bacteria | 3549 |
| 585 | Ga0501072_0044513 | 3300049588 | Bacteria | 3490 |
| 586 | Ga0501072_0044563 | 3300049588 | Bacteria | 3488 |
| 587 | Ga0501073_0000957 | 3300049589 | Bacteria | 20786 |
| 588 | Ga0501073_0036021 | 3300049589 | Bacteria | 3517 |
| 589 | Ga0501073_0096326 | 3300049589 | Bacteria | 2055 |
| 590 | Ga0501073_0323551 | 3300049589 | Bacteria | 1064 |
| 591 | Ga0501074_0000961 | 3300049590 | Bacteria | 18637 |
| 592 | Ga0501074_0071455 | 3300049590 | Unclassified | 2495 |
| 593 | Ga0501074_0410901 | 3300049590 | Bacteria | 960 |
| 594 | Ga0501074_0482764 | 3300049590 | Unclassified | 878 |
| 595 | Ga0501075_0020094 | 3300049591 | Bacteria | 4851 |
| 596 | Ga0501075_0394540 | 3300049591 | Bacteria | 1055 |
| 597 | Ga0501076_0009865 | 3300049592 | Bacteria | 7059 |
| 598 | Ga0501076_0031536 | 3300049592 | Bacteria | 4134 |
| 599 | Ga0501076_0043728 | 3300049592 | Bacteria | 3531 |
| 600 | Ga0501076_0118745 | 3300049592 | Unclassified | 2141 |
| 601 | Ga0501077_0004124 | 3300049593 | Bacteria | 8777 |
| 602 | Ga0501077_0015646 | 3300049593 | Bacteria | 4778 |
| 603 | Ga0501079_0002046 | 3300049741 | Bacteria | 14453 |
| 604 | Ga0501079_1077694 | 3300049741 | Bacteria | 633 |
| 605 | Ga0501080_0011402 | 3300049742 | Bacteria | 8141 |
| 606 | Ga0501080_0083207 | 3300049742 | Bacteria | 2973 |
| 607 | Ga0501080_0125597 | 3300049742 | Bacteria | 2376 |
| 608 | Ga0501080_0194572 | 3300049742 | Bacteria | 1863 |
| 609 | Ga0501080_0197393 | 3300049742 | Bacteria | 1848 |
| 610 | Ga0501081_0181692 | 3300049743 | Bacteria | 1522 |
| 611 | Ga0501081_0229705 | 3300049743 | Bacteria | 1351 |
| 612 | Ga0501081_0318696 | 3300049743 | Bacteria | 1142 |
| 613 | Ga0501081_0804208 | 3300049743 | Unclassified | 708 |
| 614 | Ga0501083_0032085 | 3300049744 | Bacteria | 3604 |
| 615 | Ga0501083_0176720 | 3300049744 | Unclassified | 1395 |
| 616 | Ga0501083_0708550 | 3300049744 | Bacteria | 655 |
| 617 | Ga0501044_0089262 | 3300049823 | Bacteria | 3111 |
| 618 | Ga0501045_0002911 | 3300049824 | Bacteria | 11695 |
| 619 | Ga0501045_0010492 | 3300049824 | Bacteria | 6490 |
| 620 | nmdc:mga0qj67_454702_c1 | 3300050509 | Bacteria | 1031 |
| 621 | nmdc:mga06r32_27388_c1 | 3300050510 | Bacteria | 5324 |
| 622 | nmdc:mga08y16_1058454_c1 | 3300050511 | Bacteria | 788 |
| 623 | nmdc:mga08y16_37029_c1 | 3300050511 | Bacteria | 5124 |
| 624 | nmdc:mga08y16_506486_c1 | 3300050511 | Bacteria | 1226 |
| 625 | nmdc:mga0rr50_310883_c1 | 3300050513 | Bacteria | 1320 |
| 626 | nmdc:mga08x19_1546_c1 | 3300050514 | Bacteria | 14262 |
| 627 | nmdc:mga08x19_19392_c1 | 3300050514 | Bacteria | 4173 |
| 628 | nmdc:mga08x19_89984_c1 | 3300050514 | Bacteria | 2025 |
| 629 | nmdc:mga0a205_55333_c1 | 3300050515 | Bacteria | 1785 |
| 630 | Ga0495601_0549244 | 3300053077 | Unclassified | 743 |
| 631 | Ga0495595_0106665 | 3300053084 | Bacteria | 1356 |
| 632 | Ga0495619_0226916 | 3300053085 | Unclassified | 1294 |
| 633 | Ga0500648_378874 | 3300053097 | Unclassified | 554 |
| 634 | Ga0500588_0070310 | 3300053146 | Bacteria | 1146 |
| 635 | Ga0500637_0155129 | 3300053178 | Unclassified | 1321 |
| 636 | Ga0501084_0122310 | 3300054114 | Bacteria | 2189 |
| 637 | Ga0501084_0252732 | 3300054114 | Bacteria | 1488 |
| 638 | Ga0501082_0017467 | 3300060353 | Bacteria | 6182 |
| 639 | Ga0501082_0019635 | 3300060353 | Bacteria | 5827 |
| 640 | Ga0501082_1720899 | 3300060353 | Bacteria | 547 |
| 641 | Ga0530510_0149774 | 3300061734 | Unclassified | 1722 |
| 642 | Ga0530510_0182399 | 3300061734 | Unclassified | 1557 |
| 643 | Ga0530510_0491093 | 3300061734 | Unclassified | 930 |
| 644 | Ga0530510_1010037 | 3300061734 | Unclassified | 637 |
| 645 | Ga0068863_100666981 | |||
| 646 | MBSR1b_contig_4976386 | |||
| 647 | JGI24751J29686_10052650 | |||
| 648 | rootH1_10083716 | |||
| 649 | rootH2_10249099 | |||
| 650 | rootL2_10348100 | |||
| 651 | rootH1_10225479 | |||
| 652 | Ga0065714_10119360 | |||
| 653 | Ga0065704_10092779 | |||
| 654 | Ga0065712_10069890 | |||
| 655 | Ga0065712_10071950 | |||
| 656 | Ga0065715_10170144 | |||
| 657 | Ga0065707_10103685 | |||
| 658 | Ga0070683_100003733 | |||
| 659 | Ga0070683_100237491 | |||
| 660 | Ga0070683_100695307 | |||
| 661 | Ga0070690_100090464 | |||
| 662 | Ga0070690_100152312 | |||
| 663 | Ga0070670_100054910 | |||
| 664 | Ga0070670_100148583 | |||
| 665 | Ga0070670_100153120 | |||
| 666 | Ga0070670_100188139 | |||
| 667 | Ga0070670_100542848 | |||
| 668 | Ga0070670_100665919 | |||
| 669 | Ga0070670_100833214 | |||
| 670 | Ga0070677_10026637 | |||
| 671 | Ga0068869_100080893 | |||
| 672 | Ga0068869_100604228 | |||
| 673 | Ga0068869_101092948 | |||
| 674 | Ga0070666_10055662 | |||
| 675 | Ga0070666_10115262 | |||
| 676 | Ga0070666_10270935 | |||
| 677 | Ga0070666_10431104 | |||
| 678 | Ga0070666_10825275 | |||
| 679 | Ga0070680_100448475 | |||
| 680 | Ga0068868_100012072 | |||
| 681 | Ga0068868_100756080 | |||
| 682 | Ga0070660_100275861 | |||
| 683 | Ga0070660_100321992 | |||
| 684 | Ga0070689_100085780 | |||
| 685 | Ga0070689_100875433 | |||
| 686 | Ga0070687_100206477 | |||
| 687 | Ga0070661_100013594 | |||
| 688 | Ga0070661_100259425 | |||
| 689 | Ga0070661_100382913 | |||
| 690 | Ga0070661_100629297 | |||
| 691 | Ga0070668_100026734 | |||
| 692 | Ga0070668_100147404 | |||
| 693 | Ga0070668_100646886 | |||
| 694 | Ga0070668_101653683 | |||
| 695 | Ga0070669_100008508 | |||
| 696 | Ga0070669_100041319 | |||
| 697 | Ga0070669_100459636 | |||
| 698 | Ga0070669_100793362 | |||
| 699 | Ga0070669_100846746 | |||
| 700 | Ga0070675_100000325 | |||
| 701 | Ga0070675_100024084 | |||
| 702 | Ga0070675_100165477 | |||
| 703 | Ga0070675_100236588 | |||
| 704 | Ga0070675_100278266 | |||
| 705 | Ga0070671_100200022 | |||
| 706 | Ga0070671_100369789 | |||
| 707 | Ga0070674_100453441 | |||
| 708 | Ga0070673_100013373 | |||
| 709 | Ga0070673_100139393 | |||
| 710 | Ga0070673_100199750 | |||
| 711 | Ga0070673_100250429 | |||
| 712 | Ga0070673_101678383 | |||
| 713 | Ga0070688_100026817 | |||
| 714 | Ga0070688_100440342 | |||
| 715 | Ga0070659_100179546 | |||
| 716 | Ga0070667_100069098 | |||
| 717 | Ga0070667_100124171 | |||
| 718 | Ga0070667_100296274 | |||
| 719 | Ga0070667_100463529 | |||
| 720 | Ga0070667_100629161 | |||
| 721 | Ga0070709_10003648 | |||
| 722 | Ga0070714_100282999 | |||
| 723 | Ga0070701_10170858 | |||
| 724 | Ga0070701_10266405 | |||
| 725 | Ga0070711_100232737 | |||
| 726 | Ga0070705_100306211 | |||
| 727 | Ga0070705_100413384 | |||
| 728 | Ga0070700_100433289 | |||
| 729 | Ga0070700_100621656 | |||
| 730 | Ga0070694_100888271 | |||
| 731 | Ga0070708_100037172 | |||
| 732 | Ga0070708_101371065 | |||
| 733 | Ga0070663_100011449 | |||
| 734 | Ga0070663_100201773 | |||
| 735 | Ga0070678_100218614 | |||
| 736 | Ga0070678_100320985 | |||
| 737 | Ga0070678_100901279 | |||
| 738 | Ga0070662_100063456 | |||
| 739 | Ga0070662_100268583 | |||
| 740 | Ga0070662_100674070 | |||
| 741 | Ga0070662_101146916 | |||
| 742 | Ga0070681_10211915 | |||
| 743 | Ga0068867_100058488 | |||
| 744 | Ga0068867_100064327 | |||
| 745 | Ga0068867_100077128 | |||
| 746 | Ga0068867_100683726 | |||
| 747 | Ga0068867_100946281 | |||
| 748 | Ga0070685_10054642 | |||
| 749 | Ga0070706_100233480 | |||
| 750 | Ga0070706_100733885 | |||
| 751 | Ga0070679_100161937 | |||
| 752 | Ga0070684_100001676 | |||
| 753 | Ga0070684_100131593 | |||
| 754 | Ga0070684_101276332 | |||
| 755 | Ga0068853_100013571 | |||
| 756 | Ga0068853_101003924 | |||
| 757 | Ga0070672_100281564 | |||
| 758 | Ga0070672_100318121 | |||
| 759 | Ga0070672_100591791 | |||
| 760 | Ga0070672_101031683 | |||
| 761 | Ga0070686_100368781 | |||
| 762 | Ga0070686_100478683 | |||
| 763 | Ga0070686_100715772 | |||
| 764 | Ga0070695_100115432 | |||
| 765 | Ga0070695_100380367 | |||
| 766 | Ga0070693_100010083 | |||
| 767 | Ga0070693_100283893 | |||
| 768 | Ga0070665_100012035 | |||
| 769 | Ga0070665_100012817 | |||
| 770 | Ga0070665_100307832 | |||
| 771 | Ga0070665_100348662 | |||
| 772 | Ga0070665_100584948 | |||
| 773 | Ga0070665_101700440 | |||
| 774 | Ga0070704_100314406 | |||
| 775 | Ga0070704_100918719 | |||
| 776 | Ga0068855_100000892 | |||
| 777 | Ga0068855_100990019 | |||
| 778 | Ga0070664_100001454 | |||
| 779 | Ga0070664_100023731 | |||
| 780 | Ga0070664_100212097 | |||
| 781 | Ga0068857_100018488 | |||
| 782 | Ga0068857_100181239 | |||
| 783 | Ga0068856_100101173 | |||
| 784 | Ga0068852_100124148 | |||
| 785 | Ga0068859_100315835 | |||
| 786 | Ga0068859_100954223 | |||
| 787 | Ga0068859_101232892 | |||
| 788 | Ga0068859_101579969 | |||
| 789 | Ga0068859_101594618 | |||
| 790 | Ga0068864_100018939 | |||
| 791 | Ga0068864_100030241 | |||
| 792 | Ga0068864_100096879 | |||
| 793 | Ga0068864_100114586 | |||
| 794 | Ga0068864_100220994 | |||
| 795 | Ga0068864_100342976 | |||
| 796 | Ga0068864_100452215 | |||
| 797 | Ga0068864_100845580 | |||
| 798 | Ga0068861_100049092 | |||
| 799 | Ga0068861_100807055 | |||
| 800 | Ga0068851_10037124 | |||
| 801 | Ga0068851_10545032 | |||
| 802 | Ga0068870_10385683 | |||
| 803 | Ga0068870_11214016 | |||
| 804 | Ga0068863_100004211 | |||
| 805 | Ga0068863_100048863 | |||
| 806 | Ga0068863_100125596 | |||
| 807 | Ga0068863_100388646 | |||
| 808 | Ga0068863_100526740 | |||
| 809 | Ga0068858_100005625 | |||
| 810 | Ga0068858_100342396 | |||
| 811 | Ga0068858_100691034 | |||
| 812 | Ga0068858_100880400 | |||
| 813 | Ga0068858_100985316 | |||
| 814 | Ga0068860_100000377 | |||
| 815 | Ga0068860_100676946 | |||
| 816 | Ga0068860_101331824 | |||
| 817 | Ga0068860_101441444 | |||
| 818 | Ga0068862_100123252 | |||
| 819 | Ga0068862_100243144 | |||
| 820 | Ga0068862_100620083 | |||
| 821 | Ga0068862_102518157 | |||
| 822 | Ga0097621_100014536 | |||
| 823 | Ga0097621_100092630 | |||
| 824 | Ga0097621_101053583 | |||
| 825 | Ga0097621_101508305 | |||
| 826 | Ga0068871_100041999 | |||
| 827 | Ga0068871_100177268 | |||
| 828 | Ga0075428_100398947 | |||
| 829 | Ga0075431_100144001 | |||
| 830 | Ga0075433_10376144 | |||
| 831 | Ga0075433_11462716 | |||
| 832 | Ga0075434_100821526 | |||
| 833 | Ga0075429_100263444 | |||
| 834 | Ga0068865_100087749 | |||
| 835 | Ga0068865_101485846 | |||
| 836 | Ga0075436_100005942 | |||
| 837 | Ga0075436_100448226 | |||
| 838 | Ga0097620_100315827 | |||
| 839 | Ga0097620_100954255 | |||
| 840 | Ga0097620_101232888 | |||
| 841 | Ga0097620_101579935 | |||
| 842 | Ga0097620_101594679 | |||
| 843 | Ga0075435_100045538 | |||
| 844 | Ga0105240_10006145 | |||
| 845 | Ga0105240_10113024 | |||
| 846 | Ga0105240_11333696 | |||
| 847 | Ga0111539_10007245 | |||
| 848 | Ga0111539_10515313 | |||
| 849 | Ga0111539_10526951 | |||
| 850 | Ga0111539_11048741 | |||
| 851 | Ga0111539_11478731 | |||
| 852 | Ga0105245_10032747 | |||
| 853 | Ga0105247_10006983 | |||
| 854 | Ga0105243_10652114 | |||
| 855 | Ga0105241_10555069 | |||
| 856 | Ga0105241_11161123 | |||
| 857 | Ga0105242_10033723 | |||
| 858 | Ga0105242_12469502 | |||
| 859 | Ga0105248_10000387 | |||
| 860 | Ga0105248_10034586 | |||
| 861 | Ga0105248_10264091 | |||
| 862 | Ga0105248_10863339 | |||
| 863 | Ga0105248_12870326 | |||
| 864 | Ga0105237_10306742 | |||
| 865 | Ga0105237_10477504 | |||
| 866 | Ga0105238_10284017 | |||
| 867 | Ga0105238_11207113 | |||
| 868 | Ga0105238_12877300 | |||
| 869 | Ga0105249_10002487 | |||
| 870 | Ga0105249_12022542 | |||
| 871 | Ga0105239_10021333 | |||
| 872 | Ga0105239_11463197 | |||
| 873 | Ga0105246_10242172 | |||
| 874 | Ga0105246_10434197 | |||
| 875 | Ga0157317_1025434 | |||
| 876 | Ga0157374_10031824 | |||
| 877 | Ga0157374_10040856 | |||
| 878 | Ga0157374_10465227 | |||
| 879 | Ga0157374_10497278 | |||
| 880 | Ga0157374_10994048 | |||
| 881 | Ga0157378_10022961 | |||
| 882 | Ga0157378_10134327 | |||
| 883 | Ga0157378_11200942 | |||
| 884 | Ga0163162_10236344 | |||
| 885 | Ga0163162_10391991 | |||
| 886 | Ga0163162_10496994 | |||
| 887 | Ga0163162_10649682 | |||
| 888 | Ga0163162_12006997 | |||
| 889 | Ga0157375_10012273 | |||
| 890 | Ga0157375_10099091 | |||
| 891 | Ga0157375_10500967 | |||
| 892 | Ga0157375_10918467 | |||
| 893 | Ga0157375_12029122 | |||
| 894 | Ga0157375_12094049 | |||
| 895 | Ga0163163_10002171 | |||
| 896 | Ga0163163_10022009 | |||
| 897 | Ga0163163_10077720 | |||
| 898 | Ga0163163_10162785 | |||
| 899 | Ga0163163_10185169 | |||
| 900 | Ga0163163_10289788 | |||
| 901 | Ga0163163_10291339 | |||
| 902 | Ga0163163_10526716 | |||
| 903 | Ga0163163_11503389 | |||
| 904 | Ga0157380_10095983 | |||
| 905 | Ga0157380_10264399 | |||
| 906 | Ga0157380_10637199 | |||
| 907 | Ga0157380_10739272 | |||
| 908 | Ga0157380_10994997 | |||
| 909 | Ga0157377_10038437 | |||
| 910 | Ga0157377_10075559 | |||
| 911 | Ga0157377_10593534 | |||
| 912 | Ga0157379_10193238 | |||
| 913 | Ga0157379_10213853 | |||
| 914 | Ga0157379_10647994 | |||
| 915 | Ga0157379_10975326 | |||
| 916 | Ga0157376_10760569 | |||
| 917 | Ga0157376_11727628 | |||
| 918 | Ga0157376_12115016 | |||
| 919 | Ga0157376_12614072 | |||
| 920 | Ga0163161_10481200 | |||
| 921 | Ga0207656_10529497 | |||
| 922 | Ga0207642_10471351 | |||
| 923 | Ga0207710_10005531 | |||
| 924 | Ga0207688_10059179 | |||
| 925 | Ga0207688_10060833 | |||
| 926 | Ga0207688_10487487 | |||
| 927 | Ga0207680_10046496 | |||
| 928 | Ga0207680_10241989 | |||
| 929 | Ga0207680_10688920 | |||
| 930 | Ga0207685_10088144 | |||
| 931 | Ga0207699_10055516 | |||
| 932 | Ga0207645_10173555 | |||
| 933 | Ga0207684_10664059 | |||
| 934 | Ga0207695_10007482 | |||
| 935 | Ga0207671_10224091 | |||
| 936 | Ga0207671_10923362 | |||
| 937 | Ga0207663_10152254 | |||
| 938 | Ga0207662_10901132 | |||
| 939 | Ga0207657_10018401 | |||
| 940 | Ga0207657_10302521 | |||
| 941 | Ga0207649_10256222 | |||
| 942 | Ga0207649_10429336 | |||
| 943 | Ga0207649_10564577 | |||
| 944 | Ga0207652_10123794 | |||
| 945 | Ga0207646_11431140 | |||
| 946 | Ga0207681_10021027 | |||
| 947 | Ga0207681_10218264 | |||
| 948 | Ga0207681_10237311 | |||
| 949 | Ga0207694_10561707 | |||
| 950 | Ga0207650_10046047 | |||
| 951 | Ga0207650_10063188 | |||
| 952 | Ga0207650_10237299 | |||
| 953 | Ga0207650_10421875 | |||
| 954 | Ga0207650_10454394 | |||
| 955 | Ga0207650_11064239 | |||
| 956 | Ga0207659_10000600 | |||
| 957 | Ga0207659_10244610 | |||
| 958 | Ga0207659_10583245 | |||
| 959 | Ga0207659_11265432 | |||
| 960 | Ga0207664_10262822 | |||
| 961 | Ga0207690_10129018 | |||
| 962 | Ga0207706_10165800 | |||
| 963 | Ga0207709_10264746 | |||
| 964 | Ga0207670_10236299 | |||
| 965 | Ga0207669_10216611 | |||
| 966 | Ga0207704_10032112 | |||
| 967 | Ga0207704_10779075 | |||
| 968 | Ga0207691_10097637 | |||
| 969 | Ga0207691_10149257 | |||
| 970 | Ga0207691_10248631 | |||
| 971 | Ga0207711_10238325 | |||
| 972 | Ga0207711_10453925 | |||
| 973 | Ga0207711_10484901 | |||
| 974 | Ga0207711_10665530 | |||
| 975 | Ga0207689_10098480 | |||
| 976 | Ga0207689_10225651 | |||
| 977 | Ga0207689_10442991 | |||
| 978 | Ga0207689_10689679 | |||
| 979 | Ga0207661_10132674 | |||
| 980 | Ga0207661_10157113 | |||
| 981 | Ga0207679_10085993 | |||
| 982 | Ga0207679_10792435 | |||
| 983 | Ga0207667_10009937 | |||
| 984 | Ga0207667_10485777 | |||
| 985 | Ga0207651_10003082 | |||
| 986 | Ga0207651_10038042 | |||
| 987 | Ga0207651_10198804 | |||
| 988 | Ga0207712_10026019 | |||
| 989 | Ga0207712_10372217 | |||
| 990 | Ga0207668_10062790 | |||
| 991 | Ga0207668_10523539 | |||
| 992 | Ga0207658_10007624 | |||
| 993 | Ga0207658_10175691 | |||
| 994 | Ga0207658_10287724 | |||
| 995 | Ga0207658_10293094 | |||
| 996 | Ga0207658_10399037 | |||
| 997 | Ga0207658_10590751 | |||
| 998 | Ga0207677_10219258 | |||
| 999 | Ga0207677_10565684 | |||
| 1000 | Ga0207677_11090042 | |||
| 1001 | Ga0207703_10009355 | |||
| 1002 | Ga0207703_10654845 | |||
| 1003 | Ga0207639_11014173 | |||
| 1004 | Ga0207678_10209758 | |||
| 1005 | Ga0207678_10430904 | |||
| 1006 | Ga0207708_10791254 | |||
| 1007 | Ga0207702_10103004 | |||
| 1008 | Ga0207702_10813083 | |||
| 1009 | Ga0207641_10000255 | |||
| 1010 | Ga0207641_10105740 | |||
| 1011 | Ga0207641_10216101 | |||
| 1012 | Ga0207641_10238360 | |||
| 1013 | Ga0207641_10391878 | |||
| 1014 | Ga0207641_11405790 | |||
| 1015 | Ga0207641_12335725 | |||
| 1016 | Ga0207648_10055915 | |||
| 1017 | Ga0207648_10066961 | |||
| 1018 | Ga0207648_10080348 | |||
| 1019 | Ga0207648_10133476 | |||
| 1020 | Ga0207648_11132222 | |||
| 1021 | Ga0207676_10011200 | |||
| 1022 | Ga0207676_10029866 | |||
| 1023 | Ga0207676_10083223 | |||
| 1024 | Ga0207676_10188368 | |||
| 1025 | Ga0207676_10523684 | |||
| 1026 | Ga0207676_10624300 | |||
| 1027 | Ga0207676_10646110 | |||
| 1028 | Ga0207676_10799550 | |||
| 1029 | Ga0207674_10017130 | |||
| 1030 | Ga0207674_11120113 | |||
| 1031 | Ga0207675_100008908 | |||
| 1032 | Ga0207675_100751295 | |||
| 1033 | Ga0207683_10043326 | |||
| 1034 | Ga0207683_10056683 | |||
| 1035 | Ga0207683_10283173 | |||
| 1036 | Ga0207683_10468190 | |||
| 1037 | Ga0207683_10759059 | |||
| 1038 | Ga0207698_10159567 | |||
| 1039 | Ga0207698_10297242 | |||
| 1040 | Ga0207698_10359022 | |||
| 1041 | Ga0207428_10104793 | |||
| 1042 | Ga0207428_10138782 | |||
| 1043 | Ga0268266_10013647 | |||
| 1044 | Ga0268266_10014443 | |||
| 1045 | Ga0268266_10056638 | |||
| 1046 | Ga0268266_10121422 | |||
| 1047 | Ga0268265_10018891 | |||
| 1048 | Ga0268265_10095253 | |||
| 1049 | Ga0268264_10000370 | |||
| 1050 | Ga0268264_10393792 | |||
| 1051 | Ga0268264_10824490 | |||
| 1052 | Ga0268264_10877662 | |||
| 1053 | Ga0268264_10964473 | |||
| 1054 | Ga0265336_10022980 | |||
| 1055 | Ga0307511_10003371 | |||
| 1056 | Ga0265332_10000528 | |||
| 1057 | Ga0265339_10304783 | |||
| 1058 | Ga0265331_10001073 | |||
| 1059 | Ga0265327_10003590 | |||
| 1060 | Ga0265316_10059099 | |||
| 1061 | Ga0307513_10382848 | |||
| 1062 | Ga0307509_10000109 | |||
| 1063 | Ga0307509_10324962 | |||
| 1064 | Ga0307408_100205545 | |||
| 1065 | Ga0307408_100370191 | |||
| 1066 | Ga0307408_101181193 | |||
| 1067 | Ga0265313_10145050 | |||
| 1068 | Ga0307508_10187228 | |||
| 1069 | Ga0307508_10571535 | |||
| 1070 | Ga0307508_10873575 | |||
| 1071 | Ga0316575_10001297 | |||
| 1072 | Ga0265314_10079782 | |||
| 1073 | Ga0265342_10053006 | |||
| 1074 | Ga0316576_10011335 | |||
| 1075 | Ga0316576_10490381 | |||
| 1076 | Ga0316578_10533114 | |||
| 1077 | Ga0316577_10012117 | |||
| 1078 | Ga0307410_10041897 | |||
| 1079 | Ga0307410_10298595 | |||
| 1080 | Ga0307410_10453855 | |||
| 1081 | Ga0307407_10433861 | |||
| 1082 | Ga0307407_10451824 | |||
| 1083 | Ga0307412_11431556 | |||
| 1084 | Ga0307409_100256928 | |||
| 1085 | Ga0307409_100309714 | |||
| 1086 | Ga0307416_100321772 | |||
| 1087 | Ga0307416_100862138 | |||
| 1088 | Ga0307416_103712656 | |||
| 1089 | Ga0307414_11366738 | |||
| 1090 | Ga0307411_10051571 | |||
| 1091 | Ga0307411_10905062 | |||
| 1092 | Ga0307415_100345742 | |||
| 1093 | Ga0316580_10287017 | |||
| 1094 | Ga0307510_10010047 | |||
| 1095 | Ga0373948_0003131 | |||
| 1096 | Ga0373950_0003702 | |||
| 1097 | Ga0373958_0002058 | |||
| 1098 | Ga0373959_0013334 | |||
| 1099 | Ga0373928_0001597 | |||
| 1100 | Ga0373929_0002095 | |||
| 1101 | Ga0373940_0023768 | |||
| 1102 | Ga0373944_0004553 | |||
| 1103 | Ga0373944_0066507 | |||
| 1104 | Ga0373949_0001119 | |||
| 1105 | Ga0373951_0003335 | |||
| 1106 | Ga0373952_0000824 | |||
| 1107 | Ga0373932_0028199 | |||
| 1108 | Ga0373939_0098510 | |||
| 1109 | Ga0373939_0243216 | |||
| 1110 | Ga0373941_0014736 | |||
| 1111 | Ga0373945_0354935 | |||
| 1112 | Ga0373953_0083975 | |||
| 1113 | Ga0373954_0202687 | |||
| 1114 | Ga0373954_0583684 | |||
| 1115 | Ga0373960_0015485 | |||
| 1116 | Ga0373943_0235443 | |||
| 1117 | Ga0373955_0096037 | |||
| 1118 | Ga0373942_0001341 | |||
| 1119 | Ga0373961_0001024 | |||
| 1120 | Ga0373961_0175179 | |||
| 1121 | Ga0373962_0002619 | |||
| 1122 | Ga0316574_0049500 | |||
| 1123 | Ga0316574_0055067 | |||
| 1124 | Ga0316574_0217442 | |||
| 1125 | Ga0316574_0260690 | |||
| 1126 | Ga0316574_0329129 | |||
| 1127 | Ga0316574_0852292 | |||
| 1128 | Ga0373931_0000743 | |||
| 1129 | Ga0373931_0012427 | |||
| 1130 | Ga0373947_0279452 | |||
| 1131 | Ga0373937_0032315 | |||
| 1132 | Ga0373937_1015057 | |||
| 1133 | Ga0373937_1791803 | |||
| 1134 | Ga0316582_0214029 | |||
| 1135 | Ga0316584_0099884 | |||
| 1136 | Ga0395899_0000348 | |||
| 1137 | Ga0395900_0001780 | |||
| 1138 | Ga0395898_0000750 | |||
| 1139 | Ga0395901_0000344 | |||
| 1140 | Ga0439443_039650 | |||
| 1141 | Ga0450889_018968 | |||
| 1142 | Ga0439446_0084381 | |||
| 1143 | Ga0439464_0079432 | |||
| 1144 | Ga0451577_0031098 | |||
| 1145 | Ga0451577_0092236 | |||
| 1146 | Ga0451577_0103422 | |||
| 1147 | Ga0451577_0210025 | |||
| 1148 | Ga0451577_0517797 | |||
| 1149 | Ga0451577_1236137 | |||
| 1150 | Ga0453684_0013318 | |||
| 1151 | Ga0453684_0118790 | |||
| 1152 | Ga0451576_0036862 | |||
| 1153 | Ga0451576_0054542 | |||
| 1154 | Ga0451576_0077325 | |||
| 1155 | Ga0451576_0385472 | |||
| 1156 | Ga0495592_0143952 | |||
| 1157 | Ga0495629_0700971 | |||
| 1158 | Ga0495580_0526193 | |||
| 1159 | Ga0495582_0006259 | |||
| 1160 | Ga0495582_0080932 | |||
| 1161 | Ga0495639_0024924 | |||
| 1162 | Ga0495639_0489329 | |||
| 1163 | Ga0495594_0189435 | |||
| 1164 | Ga0495666_0490066 | |||
| 1165 | Ga0495665_0178978 | |||
| 1166 | Ga0495586_0071473 | |||
| 1167 | Ga0495587_0405512 | |||
| 1168 | Ga0495645_0527384 | |||
| 1169 | Ga0495645_0816715 | |||
| 1170 | Ga0495667_0287806 | |||
| 1171 | Ga0495667_0670875 | |||
| 1172 | Ga0495611_0520007 | |||
| 1173 | Ga0495625_0508252 | |||
| 1174 | Ga0495635_0317358 | |||
| 1175 | Ga0495657_0127093 | |||
| 1176 | Ga0495646_0495097 | |||
| 1177 | Ga0495647_0018954 | |||
| 1178 | Ga0495647_0025293 | |||
| 1179 | Ga0495658_0016537 | |||
| 1180 | Ga0495658_0030295 | |||
| 1181 | Ga0495669_0042534 | |||
| 1182 | Ga0495669_0486599 | |||
| 1183 | Ga0495613_0405181 | |||
| 1184 | Ga0495600_0463962 | |||
| 1185 | Ga0495674_0273382 | |||
| 1186 | Ga0495680_0284783 | |||
| 1187 | Ga0495680_0285223 | |||
| 1188 | Ga0495593_0205333 | |||
| 1189 | Ga0496101_0191869 | |||
| 1190 | Ga0496101_1038659 | |||
| 1191 | Ga0496108_0876177 | |||
| 1192 | Ga0496110_0488985 | |||
| 1193 | Ga0496112_0029235 | |||
| 1194 | Ga0496112_0038581 | |||
| 1195 | Ga0496112_0785430 | |||
| 1196 | Ga0496113_0008021 | |||
| 1197 | Ga0496113_0830461 | |||
| 1198 | Ga0496114_0507317 | |||
| 1199 | Ga0496119_0002294 | |||
| 1200 | Ga0496119_0027028 | |||
| 1201 | Ga0496120_0002163 | |||
| 1202 | Ga0496124_0045755 | |||
| 1203 | Ga0496125_0016346 | |||
| 1204 | Ga0501033_0409825 | |||
| 1205 | Ga0501036_0185809 | |||
| 1206 | Ga0501036_1261705 | |||
| 1207 | Ga0501037_0833776 | |||
| 1208 | Ga0501037_1100206 | |||
| 1209 | Ga0501038_0273983 | |||
| 1210 | Ga0501038_0663719 | |||
| 1211 | Ga0501039_0162776 | |||
| 1212 | Ga0501040_0020633 | |||
| 1213 | Ga0501040_0542025 | |||
| 1214 | Ga0501041_0068044 | |||
| 1215 | Ga0501041_0238941 | |||
| 1216 | Ga0501042_0060641 | |||
| 1217 | Ga0501042_1305601 | |||
| 1218 | Ga0501043_0086328 | |||
| 1219 | Ga0501046_0752860 | |||
| 1220 | Ga0501046_1012941 | |||
| 1221 | Ga0501048_0414927 | |||
| 1222 | Ga0501067_0179179 | |||
| 1223 | Ga0501068_0000659 | |||
| 1224 | Ga0501071_0004008 | |||
| 1225 | Ga0501071_0088593 | |||
| 1226 | Ga0501071_0195420 | |||
| 1227 | Ga0501071_0545475 | |||
| 1228 | Ga0501072_0043048 | |||
| 1229 | Ga0501072_0044513 | |||
| 1230 | Ga0501072_0044563 | |||
| 1231 | Ga0501073_0000957 | |||
| 1232 | Ga0501073_0036021 | |||
| 1233 | Ga0501073_0096326 | |||
| 1234 | Ga0501073_0323551 | |||
| 1235 | Ga0501074_0000961 | |||
| 1236 | Ga0501074_0071455 | |||
| 1237 | Ga0501074_0410901 | |||
| 1238 | Ga0501074_0482764 | |||
| 1239 | Ga0501075_0020094 | |||
| 1240 | Ga0501075_0394540 | |||
| 1241 | Ga0501076_0009865 | |||
| 1242 | Ga0501076_0031536 | |||
| 1243 | Ga0501076_0043728 | |||
| 1244 | Ga0501076_0118745 | |||
| 1245 | Ga0501077_0004124 | |||
| 1246 | Ga0501077_0015646 | |||
| 1247 | Ga0501079_0002046 | |||
| 1248 | Ga0501079_1077694 | |||
| 1249 | Ga0501080_0011402 | |||
| 1250 | Ga0501080_0083207 | |||
| 1251 | Ga0501080_0125597 | |||
| 1252 | Ga0501080_0194572 | |||
| 1253 | Ga0501080_0197393 | |||
| 1254 | Ga0501081_0181692 | |||
| 1255 | Ga0501081_0229705 | |||
| 1256 | Ga0501081_0318696 | |||
| 1257 | Ga0501081_0804208 | |||
| 1258 | Ga0501083_0032085 | |||
| 1259 | Ga0501083_0176720 | |||
| 1260 | Ga0501083_0708550 | |||
| 1261 | Ga0501044_0089262 | |||
| 1262 | Ga0501045_0002911 | |||
| 1263 | Ga0501045_0010492 | |||
| 1264 | nmdc:mga0qj67_454702_c1 | |||
| 1265 | nmdc:mga06r32_27388_c1 | |||
| 1266 | nmdc:mga08y16_1058454_c1 | |||
| 1267 | nmdc:mga08y16_37029_c1 | |||
| 1268 | nmdc:mga08y16_506486_c1 | |||
| 1269 | nmdc:mga0rr50_310883_c1 | |||
| 1270 | nmdc:mga08x19_1546_c1 | |||
| 1271 | nmdc:mga08x19_19392_c1 | |||
| 1272 | nmdc:mga08x19_89984_c1 | |||
| 1273 | nmdc:mga0a205_55333_c1 | |||
| 1274 | Ga0495601_0549244 | |||
| 1275 | Ga0495595_0106665 | |||
| 1276 | Ga0495619_0226916 | |||
| 1277 | Ga0500648_378874 | |||
| 1278 | Ga0500588_0070310 | |||
| 1279 | Ga0500637_0155129 | |||
| 1280 | Ga0501084_0122310 | |||
| 1281 | Ga0501084_0252732 | |||
| 1282 | Ga0501082_0017467 | |||
| 1283 | Ga0501082_0019635 | |||
| 1284 | Ga0501082_1720899 | |||
| 1285 | Ga0530510_0149774 | |||
| 1286 | Ga0530510_0182399 | |||
| 1287 | Ga0530510_0491093 | |||
| 1288 | Ga0530510_1010037 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8659 | 4 | 144 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8603 | 4 | 144 |
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.8505 | 3 | 140 |
| 2e8c-assembly1.cif.gz_A | crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 | 0.847 | 5 | 145 |
| 2e8c-assembly1.cif.gz_A | crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 | 0.8412 | 5 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2onfB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8558 | 11 | 144 | 3.30.300.20 |
| 2d7vB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8501 | 4 | 140 | 3.30.300.20 |
| 2onfB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8439 | 11 | 144 | 3.30.300.20 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8232 | 46 | 144 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.819 | 4 | 142 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E6MPW9-F1-model_v4 | Uncharacterized protein | 0.9918 | 1 | 145 |
|
| AF-A0A7Y3MEX1-F1-model_v4 | OsmC family protein | 0.9905 | 1 | 145 |
|
| AF-A0A7X3WNY2-F1-model_v4 | OsmC family peroxiredoxin | 0.9873 | 1 | 144 |
|
| AF-A0A524MEJ6-F1-model_v4 | OsmC family peroxiredoxin | 0.9851 | 1 | 95 |
|
| AF-A0A5E6MPW9-F1-model_v4 | Uncharacterized protein | 0.9851 | 1 | 145 |
|