F472265

General Info

Members Datasets Scaffolds Average Seq Length
647 304 1288 149

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100666981|Ga0068863_1006669811
Length 173
Sequence VTGLVGEATSAPDQEPMMHPYPHLYTAAASGRPEGNVALTSPSLPEITTAPPPEFDGPGDVWSPETLLCASLADCFVLSFRAIARASRLEWSDLKCRVEGVLERVDGVTQFTRYTTFANLRVSPGIDADKARRLLEKADHLCLISNSLRGKRTLVAEVVISAAEATFGGAGST

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
223 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
224 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
225 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
300 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
301 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 1.55
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 30.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100666981 3300005841 Bacteria 1032
2 MBSR1b_contig_4976386 2162886012 Bacteria 1278
3 JGI24751J29686_10052650 3300002459 Bacteria 839
4 rootH1_10083716 3300003316 Bacteria 1624
5 rootH2_10249099 3300003320 Unclassified 1806
6 rootL2_10348100 3300003322 Bacteria 3009
7 rootH1_10225479 3300003323 Bacteria 2226
8 Ga0065714_10119360 3300005288 Unclassified 1367
9 Ga0065704_10092779 3300005289 Unclassified 2634
10 Ga0065712_10069890 3300005290 Bacteria 6563
11 Ga0065712_10071950 3300005290 Bacteria 4971
12 Ga0065715_10170144 3300005293 Unclassified 1553
13 Ga0065707_10103685 3300005295 Unclassified 2735
14 Ga0070683_100003733 3300005329 Bacteria 12418
15 Ga0070683_100237491 3300005329 Bacteria 1733
16 Ga0070683_100695307 3300005329 Bacteria 974
17 Ga0070690_100090464 3300005330 Bacteria 2015
18 Ga0070690_100152312 3300005330 Bacteria 1579
19 Ga0070670_100054910 3300005331 Bacteria 3420
20 Ga0070670_100148583 3300005331 Bacteria 2028
21 Ga0070670_100153120 3300005331 Unclassified 1996
22 Ga0070670_100188139 3300005331 Unclassified 1793
23 Ga0070670_100542848 3300005331 Unclassified 1037
24 Ga0070670_100665919 3300005331 Unclassified 934
25 Ga0070670_100833214 3300005331 Bacteria 834
26 Ga0070677_10026637 3300005333 Bacteria 2170
27 Ga0068869_100080893 3300005334 Bacteria 2425
28 Ga0068869_100604228 3300005334 Bacteria 927
29 Ga0068869_101092948 3300005334 Bacteria 697
30 Ga0070666_10055662 3300005335 Bacteria 2670
31 Ga0070666_10115262 3300005335 Bacteria 1861
32 Ga0070666_10270935 3300005335 Bacteria 1205
33 Ga0070666_10431104 3300005335 Unclassified 950
34 Ga0070666_10825275 3300005335 Unclassified 683
35 Ga0070680_100448475 3300005336 Bacteria 1102
36 Ga0068868_100012072 3300005338 Bacteria 6307
37 Ga0068868_100756080 3300005338 Unclassified 874
38 Ga0070660_100275861 3300005339 Unclassified 1375
39 Ga0070660_100321992 3300005339 Bacteria 1270
40 Ga0070689_100085780 3300005340 Bacteria 2476
41 Ga0070689_100875433 3300005340 Unclassified 793
42 Ga0070687_100206477 3300005343 Unclassified 1194
43 Ga0070661_100013594 3300005344 Bacteria 5715
44 Ga0070661_100259425 3300005344 Bacteria 1343
45 Ga0070661_100382913 3300005344 Bacteria 1109
46 Ga0070661_100629297 3300005344 Unclassified 869
47 Ga0070668_100026734 3300005347 Bacteria 4380
48 Ga0070668_100147404 3300005347 Unclassified 1900
49 Ga0070668_100646886 3300005347 Unclassified 929
50 Ga0070668_101653683 3300005347 Unclassified 587
51 Ga0070669_100008508 3300005353 Bacteria 7325
52 Ga0070669_100041319 3300005353 Bacteria 3353
53 Ga0070669_100459636 3300005353 Unclassified 1050
54 Ga0070669_100793362 3300005353 Unclassified 805
55 Ga0070669_100846746 3300005353 Unclassified 779
56 Ga0070675_100000325 3300005354 Bacteria 32228
57 Ga0070675_100024084 3300005354 Bacteria 4873
58 Ga0070675_100165477 3300005354 Bacteria 1904
59 Ga0070675_100236588 3300005354 Bacteria 1595
60 Ga0070675_100278266 3300005354 Bacteria 1470
61 Ga0070671_100200022 3300005355 Unclassified 1694
62 Ga0070671_100369789 3300005355 Unclassified 1224
63 Ga0070674_100453441 3300005356 Unclassified 1059
64 Ga0070673_100013373 3300005364 Bacteria 5675
65 Ga0070673_100139393 3300005364 Bacteria 2044
66 Ga0070673_100199750 3300005364 Unclassified 1722
67 Ga0070673_100250429 3300005364 Unclassified 1544
68 Ga0070673_101678383 3300005364 Bacteria 601
69 Ga0070688_100026817 3300005365 Bacteria 3426
70 Ga0070688_100440342 3300005365 Unclassified 972
71 Ga0070659_100179546 3300005366 Bacteria 1737
72 Ga0070667_100069098 3300005367 Bacteria 3006
73 Ga0070667_100124171 3300005367 Bacteria 2248
74 Ga0070667_100296274 3300005367 Unclassified 1456
75 Ga0070667_100463529 3300005367 Bacteria 1159
76 Ga0070667_100629161 3300005367 Unclassified 990
77 Ga0070709_10003648 3300005434 Bacteria 8260
78 Ga0070714_100282999 3300005435 Bacteria 1541
79 Ga0070701_10170858 3300005438 Unclassified 1266
80 Ga0070701_10266405 3300005438 Bacteria 1040
81 Ga0070711_100232737 3300005439 Bacteria 1437
82 Ga0070705_100306211 3300005440 Bacteria 1141
83 Ga0070705_100413384 3300005440 Bacteria 1002
84 Ga0070700_100433289 3300005441 Unclassified 996
85 Ga0070700_100621656 3300005441 Unclassified 849
86 Ga0070694_100888271 3300005444 Unclassified 735
87 Ga0070708_100037172 3300005445 Bacteria 4247
88 Ga0070708_101371065 3300005445 Bacteria 660
89 Ga0070663_100011449 3300005455 Bacteria 5570
90 Ga0070663_100201773 3300005455 Bacteria 1552
91 Ga0070678_100218614 3300005456 Unclassified 1583
92 Ga0070678_100320985 3300005456 Bacteria 1322
93 Ga0070678_100901279 3300005456 Unclassified 808
94 Ga0070662_100063456 3300005457 Bacteria 2702
95 Ga0070662_100268583 3300005457 Unclassified 1376
96 Ga0070662_100674070 3300005457 Unclassified 873
97 Ga0070662_101146916 3300005457 Bacteria 667
98 Ga0070681_10211915 3300005458 Bacteria 1853
99 Ga0068867_100058488 3300005459 Bacteria 2857
100 Ga0068867_100064327 3300005459 Bacteria 2727
101 Ga0068867_100077128 3300005459 Bacteria 2503
102 Ga0068867_100683726 3300005459 Bacteria 904
103 Ga0068867_100946281 3300005459 Unclassified 778
104 Ga0070685_10054642 3300005466 Bacteria 2318
105 Ga0070706_100233480 3300005467 Bacteria 1717
106 Ga0070706_100733885 3300005467 Bacteria 915
107 Ga0070679_100161937 3300005530 Bacteria 2212
108 Ga0070684_100001676 3300005535 Bacteria 16097
109 Ga0070684_100131593 3300005535 Bacteria 2257
110 Ga0070684_101276332 3300005535 Unclassified 691
111 Ga0068853_100013571 3300005539 Bacteria 6657
112 Ga0068853_101003924 3300005539 Unclassified 803
113 Ga0070672_100281564 3300005543 Bacteria 1406
114 Ga0070672_100318121 3300005543 Bacteria 1322
115 Ga0070672_100591791 3300005543 Unclassified 965
116 Ga0070672_101031683 3300005543 Unclassified 729
117 Ga0070686_100368781 3300005544 Bacteria 1084
118 Ga0070686_100478683 3300005544 Bacteria 962
119 Ga0070686_100715772 3300005544 Unclassified 800
120 Ga0070695_100115432 3300005545 Bacteria 1829
121 Ga0070695_100380367 3300005545 Bacteria 1065
122 Ga0070693_100010083 3300005547 Bacteria 4718
123 Ga0070693_100283893 3300005547 Bacteria 1110
124 Ga0070665_100012035 3300005548 Bacteria 8726
125 Ga0070665_100012817 3300005548 Bacteria 8441
126 Ga0070665_100307832 3300005548 Unclassified 1588
127 Ga0070665_100348662 3300005548 Bacteria 1486
128 Ga0070665_100584948 3300005548 Unclassified 1129
129 Ga0070665_101700440 3300005548 Unclassified 638
130 Ga0070704_100314406 3300005549 Bacteria 1310
131 Ga0070704_100918719 3300005549 Unclassified 788
132 Ga0068855_100000892 3300005563 Bacteria 37061
133 Ga0068855_100990019 3300005563 Unclassified 884
134 Ga0070664_100001454 3300005564 Bacteria 18865
135 Ga0070664_100023731 3300005564 Bacteria 5066
136 Ga0070664_100212097 3300005564 Unclassified 1731
137 Ga0068857_100018488 3300005577 Bacteria 6114
138 Ga0068857_100181239 3300005577 Bacteria 1917
139 Ga0068856_100101173 3300005614 Bacteria 2875
140 Ga0068852_100124148 3300005616 Bacteria 2368
141 Ga0068859_100315835 3300005617 Bacteria 1656
142 Ga0068859_100954223 3300005617 Unclassified 941
143 Ga0068859_101232892 3300005617 Bacteria 824
144 Ga0068859_101579969 3300005617 Unclassified 724
145 Ga0068859_101594618 3300005617 Unclassified 721
146 Ga0068864_100018939 3300005618 Bacteria 5755
147 Ga0068864_100030241 3300005618 Bacteria 4590
148 Ga0068864_100096879 3300005618 Bacteria 2611
149 Ga0068864_100114586 3300005618 Bacteria 2404
150 Ga0068864_100220994 3300005618 Bacteria 1748
151 Ga0068864_100342976 3300005618 Bacteria 1408
152 Ga0068864_100452215 3300005618 Bacteria 1228
153 Ga0068864_100845580 3300005618 Unclassified 901
154 Ga0068861_100049092 3300005719 Unclassified 3193
155 Ga0068861_100807055 3300005719 Bacteria 881
156 Ga0068851_10037124 3300005834 Bacteria 2442
157 Ga0068851_10545032 3300005834 Unclassified 700
158 Ga0068870_10385683 3300005840 Unclassified 908
159 Ga0068870_11214016 3300005840 Unclassified 546
160 Ga0068863_100004211 3300005841 Bacteria 14208
161 Ga0068863_100048863 3300005841 Bacteria 4011
162 Ga0068863_100125596 3300005841 Bacteria 2447
163 Ga0068863_100388646 3300005841 Bacteria 1363
164 Ga0068863_100526740 3300005841 Bacteria 1165
165 Ga0068858_100005625 3300005842 Bacteria 12254
166 Ga0068858_100342396 3300005842 Unclassified 1431
167 Ga0068858_100691034 3300005842 Bacteria 992
168 Ga0068858_100880400 3300005842 Bacteria 875
169 Ga0068858_100985316 3300005842 Unclassified 826
170 Ga0068860_100000377 3300005843 Bacteria 58377
171 Ga0068860_100676946 3300005843 Bacteria 1040
172 Ga0068860_101331824 3300005843 Unclassified 739
173 Ga0068860_101441444 3300005843 Bacteria 710
174 Ga0068862_100123252 3300005844 Bacteria 2286
175 Ga0068862_100243144 3300005844 Bacteria 1637
176 Ga0068862_100620083 3300005844 Unclassified 1040
177 Ga0068862_102518157 3300005844 Unclassified 526
178 Ga0097621_100014536 3300006237 Bacteria 5894
179 Ga0097621_100092630 3300006237 Bacteria 2531
180 Ga0097621_101053583 3300006237 Bacteria 762
181 Ga0097621_101508305 3300006237 Unclassified 638
182 Ga0068871_100041999 3300006358 Bacteria 3669
183 Ga0068871_100177268 3300006358 Unclassified 1830
184 Ga0075428_100398947 3300006844 Bacteria 1474
185 Ga0075431_100144001 3300006847 Unclassified 2456
186 Ga0075433_10376144 3300006852 Unclassified 1254
187 Ga0075433_11462716 3300006852 Unclassified 590
188 Ga0075434_100821526 3300006871 Unclassified 945
189 Ga0075429_100263444 3300006880 Unclassified 1509
190 Ga0068865_100087749 3300006881 Bacteria 2249
191 Ga0068865_101485846 3300006881 Unclassified 607
192 Ga0075436_100005942 3300006914 Bacteria 8387
193 Ga0075436_100448226 3300006914 Bacteria 939
194 Ga0097620_100315827 3300006931 Bacteria 1656
195 Ga0097620_100954255 3300006931 Unclassified 941
196 Ga0097620_101232888 3300006931 Bacteria 824
197 Ga0097620_101579935 3300006931 Unclassified 724
198 Ga0097620_101594679 3300006931 Unclassified 721
199 Ga0075435_100045538 3300007076 Bacteria 3517
200 Ga0105240_10006145 3300009093 Bacteria 17711
201 Ga0105240_10113024 3300009093 Unclassified 3282
202 Ga0105240_11333696 3300009093 Unclassified 756
203 Ga0111539_10007245 3300009094 Bacteria 14211
204 Ga0111539_10515313 3300009094 Bacteria 1393
205 Ga0111539_10526951 3300009094 Unclassified 1376
206 Ga0111539_11048741 3300009094 Bacteria 948
207 Ga0111539_11478731 3300009094 Unclassified 788
208 Ga0105245_10032747 3300009098 Bacteria 4602
209 Ga0105247_10006983 3300009101 Bacteria 6949
210 Ga0105243_10652114 3300009148 Bacteria 1020
211 Ga0105241_10555069 3300009174 Bacteria 1032
212 Ga0105241_11161123 3300009174 Bacteria 730
213 Ga0105242_10033723 3300009176 Bacteria 4101
214 Ga0105242_12469502 3300009176 Unclassified 568
215 Ga0105248_10000387 3300009177 Bacteria 50809
216 Ga0105248_10034586 3300009177 Bacteria 5652
217 Ga0105248_10264091 3300009177 Unclassified 1938
218 Ga0105248_10863339 3300009177 Bacteria 1022
219 Ga0105248_12870326 3300009177 Unclassified 549
220 Ga0105237_10306742 3300009545 Bacteria 1590
221 Ga0105237_10477504 3300009545 Bacteria 1253
222 Ga0105238_10284017 3300009551 Unclassified 1637
223 Ga0105238_11207113 3300009551 Bacteria 781
224 Ga0105238_12877300 3300009551 Unclassified 517
225 Ga0105249_10002487 3300009553 Bacteria 15968
226 Ga0105249_12022542 3300009553 Unclassified 649
227 Ga0105239_10021333 3300010375 Bacteria 7142
228 Ga0105239_11463197 3300010375 Unclassified 789
229 Ga0105246_10242172 3300011119 Unclassified 1426
230 Ga0105246_10434197 3300011119 Unclassified 1099
231 Ga0157317_1025434 3300012475 Bacteria 551
232 Ga0157374_10031824 3300013296 Bacteria 4798
233 Ga0157374_10040856 3300013296 Bacteria 4272
234 Ga0157374_10465227 3300013296 Bacteria 1267
235 Ga0157374_10497278 3300013296 Bacteria 1224
236 Ga0157374_10994048 3300013296 Bacteria 858
237 Ga0157378_10022961 3300013297 Bacteria 5491
238 Ga0157378_10134327 3300013297 Bacteria 2293
239 Ga0157378_11200942 3300013297 Unclassified 798
240 Ga0163162_10236344 3300013306 Bacteria 1958
241 Ga0163162_10391991 3300013306 Unclassified 1521
242 Ga0163162_10496994 3300013306 Bacteria 1350
243 Ga0163162_10649682 3300013306 Bacteria 1178
244 Ga0163162_12006997 3300013306 Bacteria 663
245 Ga0157375_10012273 3300013308 Bacteria 7597
246 Ga0157375_10099091 3300013308 Bacteria 2993
247 Ga0157375_10500967 3300013308 Bacteria 1379
248 Ga0157375_10918467 3300013308 Bacteria 1018
249 Ga0157375_12029122 3300013308 Bacteria 684
250 Ga0157375_12094049 3300013308 Bacteria 673
251 Ga0163163_10002171 3300014325 Bacteria 16562
252 Ga0163163_10022009 3300014325 Bacteria 6027
253 Ga0163163_10077720 3300014325 Bacteria 3314
254 Ga0163163_10162785 3300014325 Bacteria 2277
255 Ga0163163_10185169 3300014325 Unclassified 2130
256 Ga0163163_10289788 3300014325 Bacteria 1689
257 Ga0163163_10291339 3300014325 Bacteria 1684
258 Ga0163163_10526716 3300014325 Bacteria 1244
259 Ga0163163_11503389 3300014325 Unclassified 735
260 Ga0157380_10095983 3300014326 Bacteria 2457
261 Ga0157380_10264399 3300014326 Bacteria 1564
262 Ga0157380_10637199 3300014326 Bacteria 1061
263 Ga0157380_10739272 3300014326 Unclassified 994
264 Ga0157380_10994997 3300014326 Unclassified 871
265 Ga0157377_10038437 3300014745 Bacteria 2642
266 Ga0157377_10075559 3300014745 Bacteria 1957
267 Ga0157377_10593534 3300014745 Unclassified 789
268 Ga0157379_10193238 3300014968 Unclassified 1839
269 Ga0157379_10213853 3300014968 Bacteria 1746
270 Ga0157379_10647994 3300014968 Bacteria 989
271 Ga0157379_10975326 3300014968 Bacteria 807
272 Ga0157376_10760569 3300014969 Bacteria 979
273 Ga0157376_11727628 3300014969 Bacteria 661
274 Ga0157376_12115016 3300014969 Bacteria 601
275 Ga0157376_12614072 3300014969 Unclassified 545
276 Ga0163161_10481200 3300017792 Unclassified 1008
277 Ga0207656_10529497 3300025321 Unclassified 599
278 Ga0207642_10471351 3300025899 Unclassified 764
279 Ga0207710_10005531 3300025900 Bacteria 5437
280 Ga0207688_10059179 3300025901 Unclassified 2157
281 Ga0207688_10060833 3300025901 Bacteria 2128
282 Ga0207688_10487487 3300025901 Bacteria 771
283 Ga0207680_10046496 3300025903 Unclassified 2566
284 Ga0207680_10241989 3300025903 Bacteria 1244
285 Ga0207680_10688920 3300025903 Unclassified 732
286 Ga0207685_10088144 3300025905 Bacteria 1300
287 Ga0207699_10055516 3300025906 Bacteria 2357
288 Ga0207645_10173555 3300025907 Bacteria 1413
289 Ga0207684_10664059 3300025910 Bacteria 888
290 Ga0207695_10007482 3300025913 Bacteria 13873
291 Ga0207671_10224091 3300025914 Bacteria 1474
292 Ga0207671_10923362 3300025914 Bacteria 690
293 Ga0207663_10152254 3300025916 Bacteria 1624
294 Ga0207662_10901132 3300025918 Bacteria 626
295 Ga0207657_10018401 3300025919 Bacteria 6669
296 Ga0207657_10302521 3300025919 Bacteria 1267
297 Ga0207649_10256222 3300025920 Unclassified 1262
298 Ga0207649_10429336 3300025920 Bacteria 994
299 Ga0207649_10564577 3300025920 Bacteria 872
300 Ga0207652_10123794 3300025921 Bacteria 2302
301 Ga0207646_11431140 3300025922 Unclassified 600
302 Ga0207681_10021027 3300025923 Unclassified 4142
303 Ga0207681_10218264 3300025923 Bacteria 1474
304 Ga0207681_10237311 3300025923 Bacteria 1418
305 Ga0207694_10561707 3300025924 Unclassified 958
306 Ga0207650_10046047 3300025925 Bacteria 3211
307 Ga0207650_10063188 3300025925 Bacteria 2767
308 Ga0207650_10237299 3300025925 Bacteria 1473
309 Ga0207650_10421875 3300025925 Unclassified 1107
310 Ga0207650_10454394 3300025925 Unclassified 1066
311 Ga0207650_11064239 3300025925 Bacteria 688
312 Ga0207659_10000600 3300025926 Bacteria 21501
313 Ga0207659_10244610 3300025926 Bacteria 1453
314 Ga0207659_10583245 3300025926 Unclassified 952
315 Ga0207659_11265432 3300025926 Unclassified 634
316 Ga0207664_10262822 3300025929 Bacteria 1510
317 Ga0207690_10129018 3300025932 Bacteria 1848
318 Ga0207706_10165800 3300025933 Unclassified 1941
319 Ga0207709_10264746 3300025935 Bacteria 1262
320 Ga0207670_10236299 3300025936 Bacteria 1406
321 Ga0207669_10216611 3300025937 Bacteria 1402
322 Ga0207704_10032112 3300025938 Bacteria 2967
323 Ga0207704_10779075 3300025938 Unclassified 797
324 Ga0207691_10097637 3300025940 Unclassified 2625
325 Ga0207691_10149257 3300025940 Bacteria 2056
326 Ga0207691_10248631 3300025940 Bacteria 1535
327 Ga0207711_10238325 3300025941 Bacteria 1668
328 Ga0207711_10453925 3300025941 Unclassified 1193
329 Ga0207711_10484901 3300025941 Unclassified 1152
330 Ga0207711_10665530 3300025941 Bacteria 971
331 Ga0207689_10098480 3300025942 Bacteria 2402
332 Ga0207689_10225651 3300025942 Bacteria 1548
333 Ga0207689_10442991 3300025942 Unclassified 1085
334 Ga0207689_10689679 3300025942 Bacteria 861
335 Ga0207661_10132674 3300025944 Bacteria 2136
336 Ga0207661_10157113 3300025944 Unclassified 1971
337 Ga0207679_10085993 3300025945 Bacteria 2417
338 Ga0207679_10792435 3300025945 Unclassified 864
339 Ga0207667_10009937 3300025949 Bacteria 11163
340 Ga0207667_10485777 3300025949 Bacteria 1253
341 Ga0207651_10003082 3300025960 Bacteria 8097
342 Ga0207651_10038042 3300025960 Bacteria 3158
343 Ga0207651_10198804 3300025960 Bacteria 1605
344 Ga0207712_10026019 3300025961 Unclassified 3894
345 Ga0207712_10372217 3300025961 Unclassified 1193
346 Ga0207668_10062790 3300025972 Bacteria 2617
347 Ga0207668_10523539 3300025972 Bacteria 1023
348 Ga0207658_10007624 3300025986 Bacteria 7372
349 Ga0207658_10175691 3300025986 Bacteria 1768
350 Ga0207658_10287724 3300025986 Bacteria 1411
351 Ga0207658_10293094 3300025986 Unclassified 1399
352 Ga0207658_10399037 3300025986 Bacteria 1208
353 Ga0207658_10590751 3300025986 Unclassified 997
354 Ga0207677_10219258 3300026023 Unclassified 1525
355 Ga0207677_10565684 3300026023 Bacteria 993
356 Ga0207677_11090042 3300026023 Unclassified 728
357 Ga0207703_10009355 3300026035 Bacteria 7703
358 Ga0207703_10654845 3300026035 Bacteria 997
359 Ga0207639_11014173 3300026041 Unclassified 777
360 Ga0207678_10209758 3300026067 Bacteria 1666
361 Ga0207678_10430904 3300026067 Unclassified 1144
362 Ga0207708_10791254 3300026075 Unclassified 816
363 Ga0207702_10103004 3300026078 Unclassified 2524
364 Ga0207702_10813083 3300026078 Bacteria 924
365 Ga0207641_10000255 3300026088 Bacteria 67770
366 Ga0207641_10105740 3300026088 Unclassified 2486
367 Ga0207641_10216101 3300026088 Unclassified 1775
368 Ga0207641_10238360 3300026088 Bacteria 1694
369 Ga0207641_10391878 3300026088 Bacteria 1332
370 Ga0207641_11405790 3300026088 Unclassified 699
371 Ga0207641_12335725 3300026088 Unclassified 534
372 Ga0207648_10055915 3300026089 Bacteria 3444
373 Ga0207648_10066961 3300026089 Bacteria 3132
374 Ga0207648_10080348 3300026089 Bacteria 2844
375 Ga0207648_10133476 3300026089 Bacteria 2186
376 Ga0207648_11132222 3300026089 Unclassified 734
377 Ga0207676_10011200 3300026095 Bacteria 6404
378 Ga0207676_10029866 3300026095 Bacteria 4085
379 Ga0207676_10083223 3300026095 Bacteria 2605
380 Ga0207676_10188368 3300026095 Bacteria 1813
381 Ga0207676_10523684 3300026095 Bacteria 1129
382 Ga0207676_10624300 3300026095 Unclassified 1037
383 Ga0207676_10646110 3300026095 Unclassified 1020
384 Ga0207676_10799550 3300026095 Unclassified 920
385 Ga0207674_10017130 3300026116 Bacteria 7910
386 Ga0207674_11120113 3300026116 Unclassified 756
387 Ga0207675_100008908 3300026118 Bacteria 9415
388 Ga0207675_100751295 3300026118 Bacteria 987
389 Ga0207683_10043326 3300026121 Bacteria 3933
390 Ga0207683_10056683 3300026121 Bacteria 3438
391 Ga0207683_10283173 3300026121 Unclassified 1515
392 Ga0207683_10468190 3300026121 Unclassified 1162
393 Ga0207683_10759059 3300026121 Bacteria 900
394 Ga0207698_10159567 3300026142 Bacteria 1970
395 Ga0207698_10297242 3300026142 Unclassified 1501
396 Ga0207698_10359022 3300026142 Bacteria 1379
397 Ga0207428_10104793 3300027907 Unclassified 2182
398 Ga0207428_10138782 3300027907 Bacteria 1857
399 Ga0268266_10013647 3300028379 Bacteria 6997
400 Ga0268266_10014443 3300028379 Bacteria 6789
401 Ga0268266_10056638 3300028379 Bacteria 3372
402 Ga0268266_10121422 3300028379 Bacteria 2326
403 Ga0268265_10018891 3300028380 Bacteria 4784
404 Ga0268265_10095253 3300028380 Bacteria 2390
405 Ga0268264_10000370 3300028381 Bacteria 66454
406 Ga0268264_10393792 3300028381 Bacteria 1329
407 Ga0268264_10824490 3300028381 Bacteria 928
408 Ga0268264_10877662 3300028381 Bacteria 899
409 Ga0268264_10964473 3300028381 Bacteria 858
410 Ga0265336_10022980 3300028666 Bacteria 1982
411 Ga0307511_10003371 3300030521 Bacteria 16447
412 Ga0265332_10000528 3300031238 Bacteria 26011
413 Ga0265339_10304783 3300031249 Unclassified 759
414 Ga0265331_10001073 3300031250 Bacteria 21220
415 Ga0265327_10003590 3300031251 Bacteria 14643
416 Ga0265316_10059099 3300031344 Bacteria 2983
417 Ga0307513_10382848 3300031456 Bacteria 1146
418 Ga0307509_10000109 3300031507 Bacteria 117520
419 Ga0307509_10324962 3300031507 Bacteria 1273
420 Ga0307408_100205545 3300031548 Bacteria 1597
421 Ga0307408_100370191 3300031548 Unclassified 1222
422 Ga0307408_101181193 3300031548 Unclassified 713
423 Ga0265313_10145050 3300031595 Bacteria 1018
424 Ga0307508_10187228 3300031616 Bacteria 1672
425 Ga0307508_10571535 3300031616 Unclassified 730
426 Ga0307508_10873575 3300031616 Unclassified 523
427 Ga0316575_10001297 3300031665 Bacteria 7981
428 Ga0265314_10079782 3300031711 Bacteria 2163
429 Ga0265342_10053006 3300031712 Bacteria 2415
430 Ga0316576_10011335 3300031727 Bacteria 5838
431 Ga0316576_10490381 3300031727 Unclassified 905
432 Ga0316578_10533114 3300031728 Bacteria 690
433 Ga0316577_10012117 3300031733 Unclassified 4690
434 Ga0307410_10041897 3300031852 Bacteria 3022
435 Ga0307410_10298595 3300031852 Bacteria 1270
436 Ga0307410_10453855 3300031852 Bacteria 1046
437 Ga0307407_10433861 3300031903 Bacteria 950
438 Ga0307407_10451824 3300031903 Unclassified 933
439 Ga0307412_11431556 3300031911 Unclassified 626
440 Ga0307409_100256928 3300031995 Bacteria 1601
441 Ga0307409_100309714 3300031995 Bacteria 1473
442 Ga0307416_100321772 3300032002 Bacteria 1549
443 Ga0307416_100862138 3300032002 Unclassified 1004
444 Ga0307416_103712656 3300032002 Unclassified 511
445 Ga0307414_11366738 3300032004 Unclassified 658
446 Ga0307411_10051571 3300032005 Bacteria 2685
447 Ga0307411_10905062 3300032005 Unclassified 784
448 Ga0307415_100345742 3300032126 Unclassified 1250
449 Ga0316580_10287017 3300032139 Unclassified 511
450 Ga0307510_10010047 3300033180 Bacteria 11246
451 Ga0373948_0003131 3300034817 Bacteria 2516
452 Ga0373950_0003702 3300034818 Bacteria 2204
453 Ga0373958_0002058 3300034819 Bacteria 2778
454 Ga0373959_0013334 3300034820 Bacteria 1480
455 Ga0373928_0001597 3300035084 Bacteria 4392
456 Ga0373929_0002095 3300035085 Bacteria 3711
457 Ga0373940_0023768 3300035088 Bacteria 1584
458 Ga0373944_0004553 3300035089 Bacteria 3618
459 Ga0373944_0066507 3300035089 Unclassified 1166
460 Ga0373949_0001119 3300035090 Bacteria 8112
461 Ga0373951_0003335 3300035091 Unclassified 3929
462 Ga0373952_0000824 3300035092 Bacteria 5596
463 Ga0373932_0028199 3300035112 Bacteria 1541
464 Ga0373939_0098510 3300035114 Bacteria 999
465 Ga0373939_0243216 3300035114 Unclassified 697
466 Ga0373941_0014736 3300035115 Bacteria 2095
467 Ga0373945_0354935 3300035116 Unclassified 636
468 Ga0373953_0083975 3300035117 Bacteria 1327
469 Ga0373954_0202687 3300035118 Bacteria 975
470 Ga0373954_0583684 3300035118 Unclassified 554
471 Ga0373960_0015485 3300035121 Bacteria 1947
472 Ga0373943_0235443 3300035170 Bacteria 1024
473 Ga0373955_0096037 3300035172 Bacteria 1696
474 Ga0373942_0001341 3300035207 Bacteria 6382
475 Ga0373961_0001024 3300035241 Bacteria 9104
476 Ga0373961_0175179 3300035241 Unclassified 744
477 Ga0373962_0002619 3300035242 Bacteria 4277
478 Ga0316574_0049500 3300035398 Bacteria 2613
479 Ga0316574_0055067 3300035398 Bacteria 2486
480 Ga0316574_0217442 3300035398 Bacteria 1225
481 Ga0316574_0260690 3300035398 Bacteria 1107
482 Ga0316574_0329129 3300035398 Bacteria 969
483 Ga0316574_0852292 3300035398 Unclassified 553
484 Ga0373931_0000743 3300035691 Bacteria 13596
485 Ga0373931_0012427 3300035691 Bacteria 4125
486 Ga0373947_0279452 3300035725 Bacteria 1110
487 Ga0373937_0032315 3300036401 Bacteria 4747
488 Ga0373937_1015057 3300036401 Archaea 778
489 Ga0373937_1791803 3300036401 Bacteria 560
490 Ga0316582_0214029 3300036647 Bacteria 1317
491 Ga0316584_0099884 3300036712 Unclassified 2173
492 Ga0395899_0000348 3300037312 Bacteria 56960
493 Ga0395900_0001780 3300037418 Bacteria 24711
494 Ga0395898_0000750 3300037466 Bacteria 56675
495 Ga0395901_0000344 3300038443 Bacteria 56658
496 Ga0439443_039650 3300042003 Unclassified 801
497 Ga0450889_018968 3300042144 Bacteria 754
498 Ga0439446_0084381 3300042156 Bacteria 987
499 Ga0439464_0079432 3300042439 Unclassified 978
500 Ga0451577_0031098 3300042876 Bacteria 4818
501 Ga0451577_0092236 3300042876 Bacteria 2704
502 Ga0451577_0103422 3300042876 Bacteria 2545
503 Ga0451577_0210025 3300042876 Bacteria 1758
504 Ga0451577_0517797 3300042876 Bacteria 1083
505 Ga0451577_1236137 3300042876 Bacteria 666
506 Ga0453684_0013318 3300044712 Bacteria 13383
507 Ga0453684_0118790 3300044712 Bacteria 3197
508 Ga0451576_0036862 3300045051 Bacteria 5181
509 Ga0451576_0054542 3300045051 Bacteria 4185
510 Ga0451576_0077325 3300045051 Bacteria 3463
511 Ga0451576_0385472 3300045051 Bacteria 1469
512 Ga0495592_0143952 3300046454 Bacteria 1655
513 Ga0495629_0700971 3300046459 Bacteria 672
514 Ga0495580_0526193 3300046472 Unclassified 787
515 Ga0495582_0006259 3300046473 Bacteria 6635
516 Ga0495582_0080932 3300046473 Bacteria 1804
517 Ga0495639_0024924 3300046475 Bacteria 2635
518 Ga0495639_0489329 3300046475 Unclassified 627
519 Ga0495594_0189435 3300046499 Bacteria 1172
520 Ga0495666_0490066 3300046526 Unclassified 549
521 Ga0495665_0178978 3300046531 Bacteria 1102
522 Ga0495586_0071473 3300046535 Bacteria 1896
523 Ga0495587_0405512 3300046536 Unclassified 757
524 Ga0495645_0527384 3300046543 Unclassified 735
525 Ga0495645_0816715 3300046543 Unclassified 558
526 Ga0495667_0287806 3300046559 Unclassified 1042
527 Ga0495667_0670875 3300046559 Unclassified 643
528 Ga0495611_0520007 3300046648 Unclassified 540
529 Ga0495625_0508252 3300046660 Unclassified 736
530 Ga0495635_0317358 3300046663 Bacteria 1043
531 Ga0495657_0127093 3300046675 Bacteria 1600
532 Ga0495646_0495097 3300046680 Unclassified 628
533 Ga0495647_0018954 3300046681 Bacteria 2456
534 Ga0495647_0025293 3300046681 Bacteria 2168
535 Ga0495658_0016537 3300046683 Bacteria 3796
536 Ga0495658_0030295 3300046683 Bacteria 2937
537 Ga0495669_0042534 3300046684 Bacteria 2020
538 Ga0495669_0486599 3300046684 Unclassified 600
539 Ga0495613_0405181 3300046689 Unclassified 930
540 Ga0495600_0463962 3300046809 Bacteria 782
541 Ga0495674_0273382 3300047319 Bacteria 1386
542 Ga0495680_0284783 3300047322 Bacteria 1164
543 Ga0495680_0285223 3300047322 Unclassified 1163
544 Ga0495593_0205333 3300047673 Unclassified 990
545 Ga0496101_0191869 3300048904 Bacteria 1577
546 Ga0496101_1038659 3300048904 Bacteria 644
547 Ga0496108_0876177 3300048911 Bacteria 772
548 Ga0496110_0488985 3300048913 Bacteria 1121
549 Ga0496112_0029235 3300048915 Bacteria 5328
550 Ga0496112_0038581 3300048915 Bacteria 4664
551 Ga0496112_0785430 3300048915 Bacteria 877
552 Ga0496113_0008021 3300048916 Bacteria 6849
553 Ga0496113_0830461 3300048916 Bacteria 733
554 Ga0496114_0507317 3300048917 Bacteria 1067
555 Ga0496119_0002294 3300048922 Bacteria 21157
556 Ga0496119_0027028 3300048922 Unclassified 3959
557 Ga0496120_0002163 3300048923 Bacteria 20906
558 Ga0496124_0045755 3300048927 Bacteria 3751
559 Ga0496125_0016346 3300048928 Bacteria 7130
560 Ga0501033_0409825 3300049570 Bacteria 945
561 Ga0501036_0185809 3300049572 Bacteria 1749
562 Ga0501036_1261705 3300049572 Unclassified 601
563 Ga0501037_0833776 3300049573 Bacteria 607
564 Ga0501037_1100206 3300049573 Bacteria 515
565 Ga0501038_0273983 3300049574 Bacteria 1330
566 Ga0501038_0663719 3300049574 Bacteria 784
567 Ga0501039_0162776 3300049575 Bacteria 1754
568 Ga0501040_0020633 3300049576 Bacteria 4393
569 Ga0501040_0542025 3300049576 Bacteria 839
570 Ga0501041_0068044 3300049577 Bacteria 2183
571 Ga0501041_0238941 3300049577 Bacteria 1141
572 Ga0501042_0060641 3300049578 Unclassified 2702
573 Ga0501042_1305601 3300049578 Unclassified 529
574 Ga0501043_0086328 3300049579 Bacteria 2466
575 Ga0501046_0752860 3300049580 Bacteria 684
576 Ga0501046_1012941 3300049580 Bacteria 576
577 Ga0501048_0414927 3300049582 Bacteria 963
578 Ga0501067_0179179 3300049583 Bacteria 1180
579 Ga0501068_0000659 3300049584 Bacteria 17770
580 Ga0501071_0004008 3300049587 Bacteria 9296
581 Ga0501071_0088593 3300049587 Bacteria 2271
582 Ga0501071_0195420 3300049587 Bacteria 1518
583 Ga0501071_0545475 3300049587 Bacteria 890
584 Ga0501072_0043048 3300049588 Bacteria 3549
585 Ga0501072_0044513 3300049588 Bacteria 3490
586 Ga0501072_0044563 3300049588 Bacteria 3488
587 Ga0501073_0000957 3300049589 Bacteria 20786
588 Ga0501073_0036021 3300049589 Bacteria 3517
589 Ga0501073_0096326 3300049589 Bacteria 2055
590 Ga0501073_0323551 3300049589 Bacteria 1064
591 Ga0501074_0000961 3300049590 Bacteria 18637
592 Ga0501074_0071455 3300049590 Unclassified 2495
593 Ga0501074_0410901 3300049590 Bacteria 960
594 Ga0501074_0482764 3300049590 Unclassified 878
595 Ga0501075_0020094 3300049591 Bacteria 4851
596 Ga0501075_0394540 3300049591 Bacteria 1055
597 Ga0501076_0009865 3300049592 Bacteria 7059
598 Ga0501076_0031536 3300049592 Bacteria 4134
599 Ga0501076_0043728 3300049592 Bacteria 3531
600 Ga0501076_0118745 3300049592 Unclassified 2141
601 Ga0501077_0004124 3300049593 Bacteria 8777
602 Ga0501077_0015646 3300049593 Bacteria 4778
603 Ga0501079_0002046 3300049741 Bacteria 14453
604 Ga0501079_1077694 3300049741 Bacteria 633
605 Ga0501080_0011402 3300049742 Bacteria 8141
606 Ga0501080_0083207 3300049742 Bacteria 2973
607 Ga0501080_0125597 3300049742 Bacteria 2376
608 Ga0501080_0194572 3300049742 Bacteria 1863
609 Ga0501080_0197393 3300049742 Bacteria 1848
610 Ga0501081_0181692 3300049743 Bacteria 1522
611 Ga0501081_0229705 3300049743 Bacteria 1351
612 Ga0501081_0318696 3300049743 Bacteria 1142
613 Ga0501081_0804208 3300049743 Unclassified 708
614 Ga0501083_0032085 3300049744 Bacteria 3604
615 Ga0501083_0176720 3300049744 Unclassified 1395
616 Ga0501083_0708550 3300049744 Bacteria 655
617 Ga0501044_0089262 3300049823 Bacteria 3111
618 Ga0501045_0002911 3300049824 Bacteria 11695
619 Ga0501045_0010492 3300049824 Bacteria 6490
620 nmdc:mga0qj67_454702_c1 3300050509 Bacteria 1031
621 nmdc:mga06r32_27388_c1 3300050510 Bacteria 5324
622 nmdc:mga08y16_1058454_c1 3300050511 Bacteria 788
623 nmdc:mga08y16_37029_c1 3300050511 Bacteria 5124
624 nmdc:mga08y16_506486_c1 3300050511 Bacteria 1226
625 nmdc:mga0rr50_310883_c1 3300050513 Bacteria 1320
626 nmdc:mga08x19_1546_c1 3300050514 Bacteria 14262
627 nmdc:mga08x19_19392_c1 3300050514 Bacteria 4173
628 nmdc:mga08x19_89984_c1 3300050514 Bacteria 2025
629 nmdc:mga0a205_55333_c1 3300050515 Bacteria 1785
630 Ga0495601_0549244 3300053077 Unclassified 743
631 Ga0495595_0106665 3300053084 Bacteria 1356
632 Ga0495619_0226916 3300053085 Unclassified 1294
633 Ga0500648_378874 3300053097 Unclassified 554
634 Ga0500588_0070310 3300053146 Bacteria 1146
635 Ga0500637_0155129 3300053178 Unclassified 1321
636 Ga0501084_0122310 3300054114 Bacteria 2189
637 Ga0501084_0252732 3300054114 Bacteria 1488
638 Ga0501082_0017467 3300060353 Bacteria 6182
639 Ga0501082_0019635 3300060353 Bacteria 5827
640 Ga0501082_1720899 3300060353 Bacteria 547
641 Ga0530510_0149774 3300061734 Unclassified 1722
642 Ga0530510_0182399 3300061734 Unclassified 1557
643 Ga0530510_0491093 3300061734 Unclassified 930
644 Ga0530510_1010037 3300061734 Unclassified 637
645 Ga0068863_100666981
646 MBSR1b_contig_4976386
647 JGI24751J29686_10052650
648 rootH1_10083716
649 rootH2_10249099
650 rootL2_10348100
651 rootH1_10225479
652 Ga0065714_10119360
653 Ga0065704_10092779
654 Ga0065712_10069890
655 Ga0065712_10071950
656 Ga0065715_10170144
657 Ga0065707_10103685
658 Ga0070683_100003733
659 Ga0070683_100237491
660 Ga0070683_100695307
661 Ga0070690_100090464
662 Ga0070690_100152312
663 Ga0070670_100054910
664 Ga0070670_100148583
665 Ga0070670_100153120
666 Ga0070670_100188139
667 Ga0070670_100542848
668 Ga0070670_100665919
669 Ga0070670_100833214
670 Ga0070677_10026637
671 Ga0068869_100080893
672 Ga0068869_100604228
673 Ga0068869_101092948
674 Ga0070666_10055662
675 Ga0070666_10115262
676 Ga0070666_10270935
677 Ga0070666_10431104
678 Ga0070666_10825275
679 Ga0070680_100448475
680 Ga0068868_100012072
681 Ga0068868_100756080
682 Ga0070660_100275861
683 Ga0070660_100321992
684 Ga0070689_100085780
685 Ga0070689_100875433
686 Ga0070687_100206477
687 Ga0070661_100013594
688 Ga0070661_100259425
689 Ga0070661_100382913
690 Ga0070661_100629297
691 Ga0070668_100026734
692 Ga0070668_100147404
693 Ga0070668_100646886
694 Ga0070668_101653683
695 Ga0070669_100008508
696 Ga0070669_100041319
697 Ga0070669_100459636
698 Ga0070669_100793362
699 Ga0070669_100846746
700 Ga0070675_100000325
701 Ga0070675_100024084
702 Ga0070675_100165477
703 Ga0070675_100236588
704 Ga0070675_100278266
705 Ga0070671_100200022
706 Ga0070671_100369789
707 Ga0070674_100453441
708 Ga0070673_100013373
709 Ga0070673_100139393
710 Ga0070673_100199750
711 Ga0070673_100250429
712 Ga0070673_101678383
713 Ga0070688_100026817
714 Ga0070688_100440342
715 Ga0070659_100179546
716 Ga0070667_100069098
717 Ga0070667_100124171
718 Ga0070667_100296274
719 Ga0070667_100463529
720 Ga0070667_100629161
721 Ga0070709_10003648
722 Ga0070714_100282999
723 Ga0070701_10170858
724 Ga0070701_10266405
725 Ga0070711_100232737
726 Ga0070705_100306211
727 Ga0070705_100413384
728 Ga0070700_100433289
729 Ga0070700_100621656
730 Ga0070694_100888271
731 Ga0070708_100037172
732 Ga0070708_101371065
733 Ga0070663_100011449
734 Ga0070663_100201773
735 Ga0070678_100218614
736 Ga0070678_100320985
737 Ga0070678_100901279
738 Ga0070662_100063456
739 Ga0070662_100268583
740 Ga0070662_100674070
741 Ga0070662_101146916
742 Ga0070681_10211915
743 Ga0068867_100058488
744 Ga0068867_100064327
745 Ga0068867_100077128
746 Ga0068867_100683726
747 Ga0068867_100946281
748 Ga0070685_10054642
749 Ga0070706_100233480
750 Ga0070706_100733885
751 Ga0070679_100161937
752 Ga0070684_100001676
753 Ga0070684_100131593
754 Ga0070684_101276332
755 Ga0068853_100013571
756 Ga0068853_101003924
757 Ga0070672_100281564
758 Ga0070672_100318121
759 Ga0070672_100591791
760 Ga0070672_101031683
761 Ga0070686_100368781
762 Ga0070686_100478683
763 Ga0070686_100715772
764 Ga0070695_100115432
765 Ga0070695_100380367
766 Ga0070693_100010083
767 Ga0070693_100283893
768 Ga0070665_100012035
769 Ga0070665_100012817
770 Ga0070665_100307832
771 Ga0070665_100348662
772 Ga0070665_100584948
773 Ga0070665_101700440
774 Ga0070704_100314406
775 Ga0070704_100918719
776 Ga0068855_100000892
777 Ga0068855_100990019
778 Ga0070664_100001454
779 Ga0070664_100023731
780 Ga0070664_100212097
781 Ga0068857_100018488
782 Ga0068857_100181239
783 Ga0068856_100101173
784 Ga0068852_100124148
785 Ga0068859_100315835
786 Ga0068859_100954223
787 Ga0068859_101232892
788 Ga0068859_101579969
789 Ga0068859_101594618
790 Ga0068864_100018939
791 Ga0068864_100030241
792 Ga0068864_100096879
793 Ga0068864_100114586
794 Ga0068864_100220994
795 Ga0068864_100342976
796 Ga0068864_100452215
797 Ga0068864_100845580
798 Ga0068861_100049092
799 Ga0068861_100807055
800 Ga0068851_10037124
801 Ga0068851_10545032
802 Ga0068870_10385683
803 Ga0068870_11214016
804 Ga0068863_100004211
805 Ga0068863_100048863
806 Ga0068863_100125596
807 Ga0068863_100388646
808 Ga0068863_100526740
809 Ga0068858_100005625
810 Ga0068858_100342396
811 Ga0068858_100691034
812 Ga0068858_100880400
813 Ga0068858_100985316
814 Ga0068860_100000377
815 Ga0068860_100676946
816 Ga0068860_101331824
817 Ga0068860_101441444
818 Ga0068862_100123252
819 Ga0068862_100243144
820 Ga0068862_100620083
821 Ga0068862_102518157
822 Ga0097621_100014536
823 Ga0097621_100092630
824 Ga0097621_101053583
825 Ga0097621_101508305
826 Ga0068871_100041999
827 Ga0068871_100177268
828 Ga0075428_100398947
829 Ga0075431_100144001
830 Ga0075433_10376144
831 Ga0075433_11462716
832 Ga0075434_100821526
833 Ga0075429_100263444
834 Ga0068865_100087749
835 Ga0068865_101485846
836 Ga0075436_100005942
837 Ga0075436_100448226
838 Ga0097620_100315827
839 Ga0097620_100954255
840 Ga0097620_101232888
841 Ga0097620_101579935
842 Ga0097620_101594679
843 Ga0075435_100045538
844 Ga0105240_10006145
845 Ga0105240_10113024
846 Ga0105240_11333696
847 Ga0111539_10007245
848 Ga0111539_10515313
849 Ga0111539_10526951
850 Ga0111539_11048741
851 Ga0111539_11478731
852 Ga0105245_10032747
853 Ga0105247_10006983
854 Ga0105243_10652114
855 Ga0105241_10555069
856 Ga0105241_11161123
857 Ga0105242_10033723
858 Ga0105242_12469502
859 Ga0105248_10000387
860 Ga0105248_10034586
861 Ga0105248_10264091
862 Ga0105248_10863339
863 Ga0105248_12870326
864 Ga0105237_10306742
865 Ga0105237_10477504
866 Ga0105238_10284017
867 Ga0105238_11207113
868 Ga0105238_12877300
869 Ga0105249_10002487
870 Ga0105249_12022542
871 Ga0105239_10021333
872 Ga0105239_11463197
873 Ga0105246_10242172
874 Ga0105246_10434197
875 Ga0157317_1025434
876 Ga0157374_10031824
877 Ga0157374_10040856
878 Ga0157374_10465227
879 Ga0157374_10497278
880 Ga0157374_10994048
881 Ga0157378_10022961
882 Ga0157378_10134327
883 Ga0157378_11200942
884 Ga0163162_10236344
885 Ga0163162_10391991
886 Ga0163162_10496994
887 Ga0163162_10649682
888 Ga0163162_12006997
889 Ga0157375_10012273
890 Ga0157375_10099091
891 Ga0157375_10500967
892 Ga0157375_10918467
893 Ga0157375_12029122
894 Ga0157375_12094049
895 Ga0163163_10002171
896 Ga0163163_10022009
897 Ga0163163_10077720
898 Ga0163163_10162785
899 Ga0163163_10185169
900 Ga0163163_10289788
901 Ga0163163_10291339
902 Ga0163163_10526716
903 Ga0163163_11503389
904 Ga0157380_10095983
905 Ga0157380_10264399
906 Ga0157380_10637199
907 Ga0157380_10739272
908 Ga0157380_10994997
909 Ga0157377_10038437
910 Ga0157377_10075559
911 Ga0157377_10593534
912 Ga0157379_10193238
913 Ga0157379_10213853
914 Ga0157379_10647994
915 Ga0157379_10975326
916 Ga0157376_10760569
917 Ga0157376_11727628
918 Ga0157376_12115016
919 Ga0157376_12614072
920 Ga0163161_10481200
921 Ga0207656_10529497
922 Ga0207642_10471351
923 Ga0207710_10005531
924 Ga0207688_10059179
925 Ga0207688_10060833
926 Ga0207688_10487487
927 Ga0207680_10046496
928 Ga0207680_10241989
929 Ga0207680_10688920
930 Ga0207685_10088144
931 Ga0207699_10055516
932 Ga0207645_10173555
933 Ga0207684_10664059
934 Ga0207695_10007482
935 Ga0207671_10224091
936 Ga0207671_10923362
937 Ga0207663_10152254
938 Ga0207662_10901132
939 Ga0207657_10018401
940 Ga0207657_10302521
941 Ga0207649_10256222
942 Ga0207649_10429336
943 Ga0207649_10564577
944 Ga0207652_10123794
945 Ga0207646_11431140
946 Ga0207681_10021027
947 Ga0207681_10218264
948 Ga0207681_10237311
949 Ga0207694_10561707
950 Ga0207650_10046047
951 Ga0207650_10063188
952 Ga0207650_10237299
953 Ga0207650_10421875
954 Ga0207650_10454394
955 Ga0207650_11064239
956 Ga0207659_10000600
957 Ga0207659_10244610
958 Ga0207659_10583245
959 Ga0207659_11265432
960 Ga0207664_10262822
961 Ga0207690_10129018
962 Ga0207706_10165800
963 Ga0207709_10264746
964 Ga0207670_10236299
965 Ga0207669_10216611
966 Ga0207704_10032112
967 Ga0207704_10779075
968 Ga0207691_10097637
969 Ga0207691_10149257
970 Ga0207691_10248631
971 Ga0207711_10238325
972 Ga0207711_10453925
973 Ga0207711_10484901
974 Ga0207711_10665530
975 Ga0207689_10098480
976 Ga0207689_10225651
977 Ga0207689_10442991
978 Ga0207689_10689679
979 Ga0207661_10132674
980 Ga0207661_10157113
981 Ga0207679_10085993
982 Ga0207679_10792435
983 Ga0207667_10009937
984 Ga0207667_10485777
985 Ga0207651_10003082
986 Ga0207651_10038042
987 Ga0207651_10198804
988 Ga0207712_10026019
989 Ga0207712_10372217
990 Ga0207668_10062790
991 Ga0207668_10523539
992 Ga0207658_10007624
993 Ga0207658_10175691
994 Ga0207658_10287724
995 Ga0207658_10293094
996 Ga0207658_10399037
997 Ga0207658_10590751
998 Ga0207677_10219258
999 Ga0207677_10565684
1000 Ga0207677_11090042
1001 Ga0207703_10009355
1002 Ga0207703_10654845
1003 Ga0207639_11014173
1004 Ga0207678_10209758
1005 Ga0207678_10430904
1006 Ga0207708_10791254
1007 Ga0207702_10103004
1008 Ga0207702_10813083
1009 Ga0207641_10000255
1010 Ga0207641_10105740
1011 Ga0207641_10216101
1012 Ga0207641_10238360
1013 Ga0207641_10391878
1014 Ga0207641_11405790
1015 Ga0207641_12335725
1016 Ga0207648_10055915
1017 Ga0207648_10066961
1018 Ga0207648_10080348
1019 Ga0207648_10133476
1020 Ga0207648_11132222
1021 Ga0207676_10011200
1022 Ga0207676_10029866
1023 Ga0207676_10083223
1024 Ga0207676_10188368
1025 Ga0207676_10523684
1026 Ga0207676_10624300
1027 Ga0207676_10646110
1028 Ga0207676_10799550
1029 Ga0207674_10017130
1030 Ga0207674_11120113
1031 Ga0207675_100008908
1032 Ga0207675_100751295
1033 Ga0207683_10043326
1034 Ga0207683_10056683
1035 Ga0207683_10283173
1036 Ga0207683_10468190
1037 Ga0207683_10759059
1038 Ga0207698_10159567
1039 Ga0207698_10297242
1040 Ga0207698_10359022
1041 Ga0207428_10104793
1042 Ga0207428_10138782
1043 Ga0268266_10013647
1044 Ga0268266_10014443
1045 Ga0268266_10056638
1046 Ga0268266_10121422
1047 Ga0268265_10018891
1048 Ga0268265_10095253
1049 Ga0268264_10000370
1050 Ga0268264_10393792
1051 Ga0268264_10824490
1052 Ga0268264_10877662
1053 Ga0268264_10964473
1054 Ga0265336_10022980
1055 Ga0307511_10003371
1056 Ga0265332_10000528
1057 Ga0265339_10304783
1058 Ga0265331_10001073
1059 Ga0265327_10003590
1060 Ga0265316_10059099
1061 Ga0307513_10382848
1062 Ga0307509_10000109
1063 Ga0307509_10324962
1064 Ga0307408_100205545
1065 Ga0307408_100370191
1066 Ga0307408_101181193
1067 Ga0265313_10145050
1068 Ga0307508_10187228
1069 Ga0307508_10571535
1070 Ga0307508_10873575
1071 Ga0316575_10001297
1072 Ga0265314_10079782
1073 Ga0265342_10053006
1074 Ga0316576_10011335
1075 Ga0316576_10490381
1076 Ga0316578_10533114
1077 Ga0316577_10012117
1078 Ga0307410_10041897
1079 Ga0307410_10298595
1080 Ga0307410_10453855
1081 Ga0307407_10433861
1082 Ga0307407_10451824
1083 Ga0307412_11431556
1084 Ga0307409_100256928
1085 Ga0307409_100309714
1086 Ga0307416_100321772
1087 Ga0307416_100862138
1088 Ga0307416_103712656
1089 Ga0307414_11366738
1090 Ga0307411_10051571
1091 Ga0307411_10905062
1092 Ga0307415_100345742
1093 Ga0316580_10287017
1094 Ga0307510_10010047
1095 Ga0373948_0003131
1096 Ga0373950_0003702
1097 Ga0373958_0002058
1098 Ga0373959_0013334
1099 Ga0373928_0001597
1100 Ga0373929_0002095
1101 Ga0373940_0023768
1102 Ga0373944_0004553
1103 Ga0373944_0066507
1104 Ga0373949_0001119
1105 Ga0373951_0003335
1106 Ga0373952_0000824
1107 Ga0373932_0028199
1108 Ga0373939_0098510
1109 Ga0373939_0243216
1110 Ga0373941_0014736
1111 Ga0373945_0354935
1112 Ga0373953_0083975
1113 Ga0373954_0202687
1114 Ga0373954_0583684
1115 Ga0373960_0015485
1116 Ga0373943_0235443
1117 Ga0373955_0096037
1118 Ga0373942_0001341
1119 Ga0373961_0001024
1120 Ga0373961_0175179
1121 Ga0373962_0002619
1122 Ga0316574_0049500
1123 Ga0316574_0055067
1124 Ga0316574_0217442
1125 Ga0316574_0260690
1126 Ga0316574_0329129
1127 Ga0316574_0852292
1128 Ga0373931_0000743
1129 Ga0373931_0012427
1130 Ga0373947_0279452
1131 Ga0373937_0032315
1132 Ga0373937_1015057
1133 Ga0373937_1791803
1134 Ga0316582_0214029
1135 Ga0316584_0099884
1136 Ga0395899_0000348
1137 Ga0395900_0001780
1138 Ga0395898_0000750
1139 Ga0395901_0000344
1140 Ga0439443_039650
1141 Ga0450889_018968
1142 Ga0439446_0084381
1143 Ga0439464_0079432
1144 Ga0451577_0031098
1145 Ga0451577_0092236
1146 Ga0451577_0103422
1147 Ga0451577_0210025
1148 Ga0451577_0517797
1149 Ga0451577_1236137
1150 Ga0453684_0013318
1151 Ga0453684_0118790
1152 Ga0451576_0036862
1153 Ga0451576_0054542
1154 Ga0451576_0077325
1155 Ga0451576_0385472
1156 Ga0495592_0143952
1157 Ga0495629_0700971
1158 Ga0495580_0526193
1159 Ga0495582_0006259
1160 Ga0495582_0080932
1161 Ga0495639_0024924
1162 Ga0495639_0489329
1163 Ga0495594_0189435
1164 Ga0495666_0490066
1165 Ga0495665_0178978
1166 Ga0495586_0071473
1167 Ga0495587_0405512
1168 Ga0495645_0527384
1169 Ga0495645_0816715
1170 Ga0495667_0287806
1171 Ga0495667_0670875
1172 Ga0495611_0520007
1173 Ga0495625_0508252
1174 Ga0495635_0317358
1175 Ga0495657_0127093
1176 Ga0495646_0495097
1177 Ga0495647_0018954
1178 Ga0495647_0025293
1179 Ga0495658_0016537
1180 Ga0495658_0030295
1181 Ga0495669_0042534
1182 Ga0495669_0486599
1183 Ga0495613_0405181
1184 Ga0495600_0463962
1185 Ga0495674_0273382
1186 Ga0495680_0284783
1187 Ga0495680_0285223
1188 Ga0495593_0205333
1189 Ga0496101_0191869
1190 Ga0496101_1038659
1191 Ga0496108_0876177
1192 Ga0496110_0488985
1193 Ga0496112_0029235
1194 Ga0496112_0038581
1195 Ga0496112_0785430
1196 Ga0496113_0008021
1197 Ga0496113_0830461
1198 Ga0496114_0507317
1199 Ga0496119_0002294
1200 Ga0496119_0027028
1201 Ga0496120_0002163
1202 Ga0496124_0045755
1203 Ga0496125_0016346
1204 Ga0501033_0409825
1205 Ga0501036_0185809
1206 Ga0501036_1261705
1207 Ga0501037_0833776
1208 Ga0501037_1100206
1209 Ga0501038_0273983
1210 Ga0501038_0663719
1211 Ga0501039_0162776
1212 Ga0501040_0020633
1213 Ga0501040_0542025
1214 Ga0501041_0068044
1215 Ga0501041_0238941
1216 Ga0501042_0060641
1217 Ga0501042_1305601
1218 Ga0501043_0086328
1219 Ga0501046_0752860
1220 Ga0501046_1012941
1221 Ga0501048_0414927
1222 Ga0501067_0179179
1223 Ga0501068_0000659
1224 Ga0501071_0004008
1225 Ga0501071_0088593
1226 Ga0501071_0195420
1227 Ga0501071_0545475
1228 Ga0501072_0043048
1229 Ga0501072_0044513
1230 Ga0501072_0044563
1231 Ga0501073_0000957
1232 Ga0501073_0036021
1233 Ga0501073_0096326
1234 Ga0501073_0323551
1235 Ga0501074_0000961
1236 Ga0501074_0071455
1237 Ga0501074_0410901
1238 Ga0501074_0482764
1239 Ga0501075_0020094
1240 Ga0501075_0394540
1241 Ga0501076_0009865
1242 Ga0501076_0031536
1243 Ga0501076_0043728
1244 Ga0501076_0118745
1245 Ga0501077_0004124
1246 Ga0501077_0015646
1247 Ga0501079_0002046
1248 Ga0501079_1077694
1249 Ga0501080_0011402
1250 Ga0501080_0083207
1251 Ga0501080_0125597
1252 Ga0501080_0194572
1253 Ga0501080_0197393
1254 Ga0501081_0181692
1255 Ga0501081_0229705
1256 Ga0501081_0318696
1257 Ga0501081_0804208
1258 Ga0501083_0032085
1259 Ga0501083_0176720
1260 Ga0501083_0708550
1261 Ga0501044_0089262
1262 Ga0501045_0002911
1263 Ga0501045_0010492
1264 nmdc:mga0qj67_454702_c1
1265 nmdc:mga06r32_27388_c1
1266 nmdc:mga08y16_1058454_c1
1267 nmdc:mga08y16_37029_c1
1268 nmdc:mga08y16_506486_c1
1269 nmdc:mga0rr50_310883_c1
1270 nmdc:mga08x19_1546_c1
1271 nmdc:mga08x19_19392_c1
1272 nmdc:mga08x19_89984_c1
1273 nmdc:mga0a205_55333_c1
1274 Ga0495601_0549244
1275 Ga0495595_0106665
1276 Ga0495619_0226916
1277 Ga0500648_378874
1278 Ga0500588_0070310
1279 Ga0500637_0155129
1280 Ga0501084_0122310
1281 Ga0501084_0252732
1282 Ga0501082_0017467
1283 Ga0501082_0019635
1284 Ga0501082_1720899
1285 Ga0530510_0149774
1286 Ga0530510_0182399
1287 Ga0530510_0491093
1288 Ga0530510_1010037

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

57

157

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8659 4 144
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8603 4 144
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.8505 3 140
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.847 5 145
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8412 5 145
ID Description Score Start End Superfamily
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8558 11 144 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8501 4 140 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8439 11 144 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8232 46 144 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.819 4 142 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A5E6MPW9-F1-model_v4 Uncharacterized protein 0.9918 1 145
AF-A0A7Y3MEX1-F1-model_v4 OsmC family protein 0.9905 1 145
AF-A0A7X3WNY2-F1-model_v4 OsmC family peroxiredoxin 0.9873 1 144
AF-A0A524MEJ6-F1-model_v4 OsmC family peroxiredoxin 0.9851 1 95
AF-A0A5E6MPW9-F1-model_v4 Uncharacterized protein 0.9851 1 145

Map