F472122

General Info

Members Datasets Scaffolds Average Seq Length
645 303 1290 572

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10000457|Ga0105241_1000045719
Length 660
Sequence MLCCRRGQNRRRTRNTAGIRIEGRHDPRDIFHDHGQFSEYFTDQDDTGMSAAIAPTVARIGDYLIAEKLITRDQLNRALDEQRTHGGRVGYHLVKLGYVDELTLARALARQYKVPAVDLTRSELDPALVRLIPSDVARQHVVLPLKREGRILYVAMADPTNLRIVDDLKFRTRSDIVPVIAGEYTLRTMIERVYPEEEEPVTEAMESLLTDIDLGDDDVEMVEEEADDMTAAALTVAVNEAPVVKLINAILGDAVHKGASDIHFECFEHELRVRYRVDGALREIMKPPFKLRAALISRFKIMAGLNIAERRVPQDGRIKLKIGKKVIDYRVSTLPTLFGEKVVLRILDKGNLTLDLEKFGIEPRAEHELMEAVQNPYGMVLVTGPTGSGKTTTLYSALSKVNVIDVNIMTAEDPVEYNLYGINQVQVRNEIGMTFAAALKAFLRQDPNIIMVGEIRDLETGGIAVKAALTGHLVMSTLHTNSAPETVTRLLDMGLEPFNVASALNLVLAQRLVRRICPGCKTRYVPDDIELAAAKVTSRTTLGDLRFTEVALRDAAARATPEAVPHLKGLSLATTIGELPFFKGNGCDACSGTGLKGRQGLYEVMFVTPELRKCIMQNVGAADIREVAIQQGMLTLRMDGWLKVLKGITTLEQVVRETSA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
188 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
189 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
287 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.96
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10000457 3300009174 Bacteria 30758
2 JGI24737J22298_10006759 3300001990 Bacteria 3898
3 Ga0065715_10005641 3300005293 Bacteria 3325
4 Ga0065715_10093316 3300005293 Bacteria 4726
5 Ga0065715_10095668 3300005293 Bacteria 4031
6 Ga0065715_10122869 3300005293 Bacteria 2192
7 Ga0065707_10087905 3300005295 Bacteria 4847
8 Ga0070658_10011653 3300005327 Bacteria 7051
9 Ga0070658_10013996 3300005327 Bacteria 6441
10 Ga0070676_10001981 3300005328 Bacteria 10409
11 Ga0070676_10059141 3300005328 Bacteria 2273
12 Ga0070683_100004860 3300005329 Bacteria 11132
13 Ga0070683_100012786 3300005329 Bacteria 7302
14 Ga0070683_100032178 3300005329 Bacteria 4775
15 Ga0070670_100006929 3300005331 Bacteria 9607
16 Ga0068869_100006453 3300005334 Bacteria 7444
17 Ga0070680_100001098 3300005336 Bacteria 19422
18 Ga0070680_100057565 3300005336 Bacteria 3178
19 Ga0070680_100068748 3300005336 Bacteria 2907
20 Ga0070680_100069665 3300005336 Bacteria 2888
21 Ga0070682_100000484 3300005337 Bacteria 24978
22 Ga0070682_100000820 3300005337 Bacteria 18149
23 Ga0070682_100000832 3300005337 Bacteria 18004
24 Ga0068868_100005066 3300005338 Bacteria 9250
25 Ga0070660_100014184 3300005339 Bacteria 5738
26 Ga0070689_100078081 3300005340 Bacteria 2595
27 Ga0070691_10050757 3300005341 Bacteria 1979
28 Ga0070691_10074807 3300005341 Bacteria 1649
29 Ga0070687_100001604 3300005343 Bacteria 8055
30 Ga0070687_100001914 3300005343 Bacteria 7578
31 Ga0070661_100009939 3300005344 Bacteria 6601
32 Ga0070661_100015360 3300005344 Bacteria 5404
33 Ga0070661_100015567 3300005344 Bacteria 5368
34 Ga0070692_10013114 3300005345 Bacteria 3857
35 Ga0070668_100000943 3300005347 Bacteria 20268
36 Ga0070668_100009748 3300005347 Bacteria 7120
37 Ga0070668_100030966 3300005347 Bacteria 4070
38 Ga0070669_100000295 3300005353 Bacteria 39075
39 Ga0070669_100006385 3300005353 Bacteria 8490
40 Ga0070669_100007216 3300005353 Bacteria 7982
41 Ga0070675_100008383 3300005354 Bacteria 8020
42 Ga0070675_100055553 3300005354 Bacteria 3260
43 Ga0070671_100003568 3300005355 Bacteria 12170
44 Ga0070674_100000041 3300005356 Bacteria 55154
45 Ga0070674_100026834 3300005356 Bacteria 3767
46 Ga0070674_100028160 3300005356 Bacteria 3688
47 Ga0070673_100052356 3300005364 Bacteria 3202
48 Ga0070688_100019954 3300005365 Bacteria 3890
49 Ga0070659_100058688 3300005366 Bacteria 3038
50 Ga0070659_100069185 3300005366 Bacteria 2801
51 Ga0070667_100032000 3300005367 Bacteria 4386
52 Ga0070709_10000929 3300005434 Bacteria 16234
53 Ga0070709_10003801 3300005434 Bacteria 8120
54 Ga0070709_10010601 3300005434 Bacteria 5109
55 Ga0070709_10014644 3300005434 Bacteria 4439
56 Ga0070709_10018774 3300005434 Bacteria 3990
57 Ga0070709_10081281 3300005434 Bacteria 2115
58 Ga0070714_100005536 3300005435 Bacteria 9647
59 Ga0070714_100010177 3300005435 Bacteria 7425
60 Ga0070714_100013506 3300005435 Bacteria 6546
61 Ga0070713_100000145 3300005436 Bacteria 47159
62 Ga0070713_100014533 3300005436 Bacteria 5852
63 Ga0070701_10056111 3300005438 Bacteria 2060
64 Ga0070711_100000039 3300005439 Bacteria 85604
65 Ga0070711_100041854 3300005439 Bacteria 3095
66 Ga0070705_100000667 3300005440 Bacteria 19653
67 Ga0070705_100009454 3300005440 Bacteria 4848
68 Ga0070705_100033023 3300005440 Bacteria 2881
69 Ga0070705_100042937 3300005440 Bacteria 2588
70 Ga0070700_100029444 3300005441 Bacteria 3273
71 Ga0070694_100044783 3300005444 Bacteria 2962
72 Ga0070708_100000210 3300005445 Bacteria 43411
73 Ga0070708_100000357 3300005445 Bacteria 34509
74 Ga0070708_100001673 3300005445 Bacteria 17014
75 Ga0070708_100004166 3300005445 Bacteria 11357
76 Ga0070708_100039253 3300005445 Bacteria 4141
77 Ga0070708_100095162 3300005445 Bacteria 2718
78 Ga0070708_100096363 3300005445 Bacteria 2702
79 Ga0070663_100006931 3300005455 Bacteria 6862
80 Ga0070678_100004027 3300005456 Bacteria 8270
81 Ga0070662_100000533 3300005457 Bacteria 23035
82 Ga0070662_100002151 3300005457 Bacteria 12073
83 Ga0070662_100008083 3300005457 Bacteria 6848
84 Ga0070681_10001055 3300005458 Bacteria 23442
85 Ga0070681_10023925 3300005458 Bacteria 6149
86 Ga0070681_10034709 3300005458 Bacteria 5065
87 Ga0070681_10135824 3300005458 Bacteria 2390
88 Ga0068867_100002452 3300005459 Bacteria 13034
89 Ga0070685_10011283 3300005466 Bacteria 4677
90 Ga0070685_10018232 3300005466 Bacteria 3771
91 Ga0070706_100004311 3300005467 Bacteria 13777
92 Ga0070706_100025943 3300005467 Bacteria 5392
93 Ga0070706_100064667 3300005467 Bacteria 3381
94 Ga0070707_100000693 3300005468 Bacteria 33444
95 Ga0070707_100001168 3300005468 Bacteria 25843
96 Ga0070707_100018155 3300005468 Bacteria 6619
97 Ga0070707_100025529 3300005468 Bacteria 5606
98 Ga0070707_100054968 3300005468 Bacteria 3817
99 Ga0070707_100063818 3300005468 Bacteria 3535
100 Ga0070698_100000771 3300005471 Bacteria 34710
101 Ga0070698_100004921 3300005471 Bacteria 14654
102 Ga0070698_100017906 3300005471 Bacteria 7464
103 Ga0070698_100021225 3300005471 Bacteria 6804
104 Ga0070698_100038308 3300005471 Bacteria 4940
105 Ga0070698_100091494 3300005471 Bacteria 3025
106 Ga0070698_100107346 3300005471 Bacteria 2759
107 Ga0070698_100112286 3300005471 Bacteria 2690
108 Ga0070699_100000017 3300005518 Bacteria 201366
109 Ga0070699_100006261 3300005518 Bacteria 10382
110 Ga0070699_100010859 3300005518 Bacteria 7880
111 Ga0070699_100021473 3300005518 Bacteria 5568
112 Ga0070699_100057542 3300005518 Bacteria 3368
113 Ga0070679_100048661 3300005530 Bacteria 4223
114 Ga0070679_100060229 3300005530 Bacteria 3783
115 Ga0070679_100140957 3300005530 Bacteria 2390
116 Ga0070684_100002068 3300005535 Bacteria 14796
117 Ga0070684_100012928 3300005535 Bacteria 6711
118 Ga0070684_100033171 3300005535 Bacteria 4406
119 Ga0070684_100065430 3300005535 Bacteria 3190
120 Ga0070684_100093211 3300005535 Bacteria 2681
121 Ga0070697_100002276 3300005536 Bacteria 14732
122 Ga0070697_100065971 3300005536 Bacteria 2959
123 Ga0070697_100077509 3300005536 Bacteria 2734
124 Ga0068853_100018054 3300005539 Bacteria 5833
125 Ga0068853_100043231 3300005539 Bacteria 3854
126 Ga0068853_100049543 3300005539 Bacteria 3610
127 Ga0068853_100055716 3300005539 Bacteria 3408
128 Ga0070672_100059776 3300005543 Bacteria 2999
129 Ga0070686_100000004 3300005544 Bacteria 262514
130 Ga0070686_100002192 3300005544 Bacteria 10788
131 Ga0070686_100027987 3300005544 Bacteria 3415
132 Ga0070695_100002571 3300005545 Bacteria 10476
133 Ga0070695_100010783 3300005545 Bacteria 5461
134 Ga0070696_100000258 3300005546 Bacteria 32042
135 Ga0070696_100001894 3300005546 Bacteria 13752
136 Ga0070696_100053959 3300005546 Bacteria 2799
137 Ga0070696_100100755 3300005546 Bacteria 2070
138 Ga0070693_100001629 3300005547 Bacteria 10142
139 Ga0070693_100016525 3300005547 Bacteria 3822
140 Ga0070693_100025116 3300005547 Bacteria 3203
141 Ga0070665_100071931 3300005548 Bacteria 3466
142 Ga0070704_100000131 3300005549 Bacteria 27558
143 Ga0070704_100001236 3300005549 Bacteria 13461
144 Ga0070704_100015670 3300005549 Bacteria 4769
145 Ga0070704_100041394 3300005549 Bacteria 3179
146 Ga0070704_100045943 3300005549 Bacteria 3041
147 Ga0070704_100062175 3300005549 Bacteria 2675
148 Ga0070704_100081069 3300005549 Bacteria 2389
149 Ga0068855_100000955 3300005563 Bacteria 35947
150 Ga0068855_100104710 3300005563 Bacteria 3254
151 Ga0068855_100200287 3300005563 Bacteria 2248
152 Ga0070664_100001434 3300005564 Bacteria 19011
153 Ga0070664_100092991 3300005564 Bacteria 2612
154 Ga0068857_100006243 3300005577 Bacteria 10190
155 Ga0068857_100011083 3300005577 Bacteria 7842
156 Ga0068857_100032160 3300005577 Bacteria 4638
157 Ga0068857_100032447 3300005577 Bacteria 4617
158 Ga0068854_100023802 3300005578 Bacteria 4186
159 Ga0070702_100008718 3300005615 Bacteria 4927
160 Ga0068852_100038728 3300005616 Bacteria 4008
161 Ga0068859_100044269 3300005617 Bacteria 4473
162 Ga0068859_100078030 3300005617 Bacteria 3353
163 Ga0068864_100000513 3300005618 Bacteria 33457
164 Ga0068864_100042139 3300005618 Bacteria 3906
165 Ga0068866_10000879 3300005718 Bacteria 13265
166 Ga0068861_100002473 3300005719 Bacteria 12045
167 Ga0068870_10007409 3300005840 Bacteria 4888
168 Ga0068863_100022225 3300005841 Bacteria 6057
169 Ga0068858_100018041 3300005842 Bacteria 6608
170 Ga0068860_100007067 3300005843 Bacteria 11237
171 Ga0068860_100137261 3300005843 Bacteria 2349
172 Ga0068862_100000848 3300005844 Bacteria 30092
173 Ga0068862_100002981 3300005844 Bacteria 14783
174 Ga0081539_10000087 3300005985 Bacteria 214031
175 Ga0081539_10032873 3300005985 Bacteria 3169
176 Ga0070716_100011832 3300006173 Bacteria 4403
177 Ga0070716_100014045 3300006173 Bacteria 4096
178 Ga0070712_100049375 3300006175 Bacteria 2922
179 Ga0097621_100038591 3300006237 Bacteria 3833
180 Ga0068871_100074810 3300006358 Bacteria 2795
181 Ga0075428_100009899 3300006844 Bacteria 10591
182 Ga0075428_100024712 3300006844 Bacteria 6648
183 Ga0075428_100110140 3300006844 Bacteria 3000
184 Ga0075430_100005695 3300006846 Bacteria 10512
185 Ga0075430_100006469 3300006846 Bacteria 9871
186 Ga0075430_100009351 3300006846 Bacteria 8284
187 Ga0075430_100106123 3300006846 Bacteria 2344
188 Ga0075431_100005850 3300006847 Bacteria 12168
189 Ga0075431_100028370 3300006847 Bacteria 5751
190 Ga0075431_100068077 3300006847 Bacteria 3674
191 Ga0075433_10000113 3300006852 Bacteria 40079
192 Ga0075433_10027295 3300006852 Bacteria 4840
193 Ga0075433_10055257 3300006852 Bacteria 3465
194 Ga0075434_100000514 3300006871 Bacteria 29406
195 Ga0075434_100001776 3300006871 Bacteria 18584
196 Ga0075434_100003802 3300006871 Bacteria 13498
197 Ga0075434_100009886 3300006871 Bacteria 8924
198 Ga0075434_100113089 3300006871 Bacteria 2726
199 Ga0075434_100136653 3300006871 Bacteria 2471
200 Ga0075429_100000824 3300006880 Bacteria 24318
201 Ga0075429_100004806 3300006880 Bacteria 11631
202 Ga0068865_100004622 3300006881 Bacteria 8315
203 Ga0075436_100005098 3300006914 Bacteria 9042
204 Ga0075436_100013343 3300006914 Bacteria 5629
205 Ga0075436_100023652 3300006914 Bacteria 4220
206 Ga0075436_100028244 3300006914 Bacteria 3859
207 Ga0075436_100063026 3300006914 Bacteria 2562
208 Ga0097620_100015379 3300006931 Bacteria 7687
209 Ga0097620_100044266 3300006931 Bacteria 4473
210 Ga0097620_100078030 3300006931 Bacteria 3353
211 Ga0075435_100002752 3300007076 Bacteria 11740
212 Ga0075435_100010345 3300007076 Bacteria 6820
213 Ga0075435_100136017 3300007076 Bacteria 2059
214 Ga0099794_10000085 3300007265 Bacteria 34871
215 Ga0099794_10030824 3300007265 Bacteria 2506
216 Ga0099794_10045032 3300007265 Bacteria 2110
217 Ga0105240_10007698 3300009093 Bacteria 15588
218 Ga0105240_10058447 3300009093 Bacteria 4814
219 Ga0105240_10069042 3300009093 Bacteria 4375
220 Ga0111539_10137600 3300009094 Bacteria 2860
221 Ga0111539_10147344 3300009094 Bacteria 2756
222 Ga0111539_10319260 3300009094 Bacteria 1808
223 Ga0105245_10063606 3300009098 Bacteria 3332
224 Ga0114129_10010130 3300009147 Bacteria 13437
225 Ga0114129_10052359 3300009147 Bacteria 5728
226 Ga0114129_10096127 3300009147 Bacteria 4102
227 Ga0114129_10171779 3300009147 Bacteria 2955
228 Ga0105241_10006589 3300009174 Bacteria 8556
229 Ga0105241_10022305 3300009174 Bacteria 4689
230 Ga0105241_10068575 3300009174 Bacteria 2748
231 Ga0105248_10007867 3300009177 Bacteria 11708
232 Ga0105248_10112433 3300009177 Bacteria 3071
233 Ga0105237_10013619 3300009545 Bacteria 8520
234 Ga0105238_10001309 3300009551 Bacteria 24997
235 Ga0105249_10000716 3300009553 Bacteria 30160
236 Ga0105249_10035000 3300009553 Bacteria 4553
237 Ga0105239_10004042 3300010375 Bacteria 17740
238 Ga0105239_10073031 3300010375 Bacteria 3772
239 Ga0105246_10017333 3300011119 Bacteria 4575
240 Ga0157373_10024281 3300013100 Bacteria 4392
241 Ga0157371_10011126 3300013102 Bacteria 6964
242 Ga0157370_10031382 3300013104 Bacteria 5198
243 Ga0157370_10038503 3300013104 Bacteria 4625
244 Ga0157370_10067719 3300013104 Bacteria 3375
245 Ga0157369_10027456 3300013105 Bacteria 6310
246 Ga0157369_10039642 3300013105 Bacteria 5147
247 Ga0157369_10063801 3300013105 Bacteria 3969
248 Ga0157374_10051721 3300013296 Bacteria 3823
249 Ga0157374_10071777 3300013296 Bacteria 3266
250 Ga0157378_10000989 3300013297 Bacteria 26023
251 Ga0157378_10007245 3300013297 Bacteria 9683
252 Ga0157378_10112659 3300013297 Bacteria 2496
253 Ga0163162_10013541 3300013306 Bacteria 7965
254 Ga0163162_10040116 3300013306 Bacteria 4680
255 Ga0157372_10015669 3300013307 Bacteria 8129
256 Ga0157372_10027756 3300013307 Bacteria 6169
257 Ga0157372_10108820 3300013307 Bacteria 3173
258 Ga0157380_10005367 3300014326 Bacteria 8955
259 Ga0157379_10060425 3300014968 Bacteria 3388
260 Ga0163161_10051362 3300017792 Bacteria 2986
261 Ga0207697_10014138 3300025315 Bacteria 3317
262 Ga0207697_10023844 3300025315 Bacteria 2506
263 Ga0207653_10000060 3300025885 Bacteria 84774
264 Ga0207642_10001654 3300025899 Bacteria 6872
265 Ga0207642_10002850 3300025899 Bacteria 5400
266 Ga0207699_10003687 3300025906 Bacteria 7313
267 Ga0207699_10016639 3300025906 Bacteria 3852
268 Ga0207699_10052373 3300025906 Bacteria 2416
269 Ga0207645_10001348 3300025907 Bacteria 20155
270 Ga0207645_10006303 3300025907 Bacteria 8529
271 Ga0207645_10013755 3300025907 Bacteria 5432
272 Ga0207643_10004070 3300025908 Bacteria 7863
273 Ga0207643_10009035 3300025908 Bacteria 5352
274 Ga0207705_10002273 3300025909 Bacteria 14863
275 Ga0207705_10005269 3300025909 Bacteria 9687
276 Ga0207705_10018678 3300025909 Bacteria 4960
277 Ga0207705_10038479 3300025909 Bacteria 3425
278 Ga0207705_10041231 3300025909 Bacteria 3312
279 Ga0207684_10011251 3300025910 Bacteria 7837
280 Ga0207684_10017624 3300025910 Bacteria 6126
281 Ga0207684_10113131 3300025910 Bacteria 2323
282 Ga0207654_10000290 3300025911 Bacteria 30508
283 Ga0207707_10001641 3300025912 Bacteria 20640
284 Ga0207707_10001671 3300025912 Bacteria 20472
285 Ga0207707_10004239 3300025912 Bacteria 12694
286 Ga0207707_10004248 3300025912 Bacteria 12679
287 Ga0207707_10007801 3300025912 Bacteria 9317
288 Ga0207707_10017444 3300025912 Bacteria 6258
289 Ga0207707_10024002 3300025912 Bacteria 5332
290 Ga0207707_10033327 3300025912 Bacteria 4508
291 Ga0207695_10008710 3300025913 Bacteria 12652
292 Ga0207695_10023571 3300025913 Bacteria 6949
293 Ga0207695_10024059 3300025913 Bacteria 6865
294 Ga0207695_10059814 3300025913 Bacteria 3948
295 Ga0207695_10076592 3300025913 Bacteria 3400
296 Ga0207671_10015355 3300025914 Bacteria 5999
297 Ga0207671_10016818 3300025914 Bacteria 5668
298 Ga0207693_10012123 3300025915 Bacteria 6967
299 Ga0207663_10000106 3300025916 Bacteria 40255
300 Ga0207663_10055675 3300025916 Bacteria 2483
301 Ga0207663_10057948 3300025916 Bacteria 2443
302 Ga0207660_10009785 3300025917 Bacteria 6207
303 Ga0207660_10045986 3300025917 Bacteria 3078
304 Ga0207660_10049297 3300025917 Bacteria 2984
305 Ga0207660_10052763 3300025917 Bacteria 2896
306 Ga0207662_10003356 3300025918 Bacteria 8219
307 Ga0207657_10016679 3300025919 Bacteria 7078
308 Ga0207657_10050089 3300025919 Bacteria 3636
309 Ga0207657_10109465 3300025919 Bacteria 2283
310 Ga0207649_10001390 3300025920 Bacteria 14332
311 Ga0207649_10007372 3300025920 Bacteria 5984
312 Ga0207652_10016873 3300025921 Bacteria 5970
313 Ga0207646_10002930 3300025922 Bacteria 19786
314 Ga0207646_10003253 3300025922 Bacteria 18518
315 Ga0207646_10003824 3300025922 Bacteria 16723
316 Ga0207646_10017019 3300025922 Bacteria 6813
317 Ga0207646_10067303 3300025922 Bacteria 3198
318 Ga0207681_10007051 3300025923 Bacteria 6896
319 Ga0207681_10011189 3300025923 Bacteria 5508
320 Ga0207681_10029762 3300025923 Bacteria 3552
321 Ga0207694_10000038 3300025924 Bacteria 186790
322 Ga0207650_10011179 3300025925 Bacteria 6173
323 Ga0207659_10006685 3300025926 Bacteria 7083
324 Ga0207700_10006944 3300025928 Bacteria 6887
325 Ga0207664_10049801 3300025929 Bacteria 3300
326 Ga0207644_10015509 3300025931 Bacteria 5116
327 Ga0207690_10047223 3300025932 Bacteria 2855
328 Ga0207706_10000367 3300025933 Bacteria 48890
329 Ga0207706_10000555 3300025933 Bacteria 39750
330 Ga0207706_10000642 3300025933 Bacteria 37073
331 Ga0207706_10004642 3300025933 Bacteria 12878
332 Ga0207686_10000049 3300025934 Bacteria 115396
333 Ga0207686_10013777 3300025934 Bacteria 4485
334 Ga0207670_10024254 3300025936 Bacteria 3789
335 Ga0207669_10000494 3300025937 Bacteria 17245
336 Ga0207669_10026554 3300025937 Bacteria 3152
337 Ga0207704_10000404 3300025938 Bacteria 19630
338 Ga0207704_10026782 3300025938 Bacteria 3168
339 Ga0207665_10003407 3300025939 Bacteria 10644
340 Ga0207665_10015181 3300025939 Bacteria 5058
341 Ga0207691_10000611 3300025940 Bacteria 35529
342 Ga0207711_10025139 3300025941 Bacteria 4997
343 Ga0207689_10002001 3300025942 Bacteria 19239
344 Ga0207689_10008498 3300025942 Bacteria 8947
345 Ga0207661_10005943 3300025944 Bacteria 8619
346 Ga0207661_10012607 3300025944 Bacteria 6151
347 Ga0207661_10018034 3300025944 Bacteria 5239
348 Ga0207661_10066694 3300025944 Bacteria 2924
349 Ga0207679_10005618 3300025945 Bacteria 7865
350 Ga0207679_10071429 3300025945 Bacteria 2618
351 Ga0207667_10005098 3300025949 Bacteria 16045
352 Ga0207667_10017066 3300025949 Bacteria 8188
353 Ga0207667_10052353 3300025949 Bacteria 4300
354 Ga0207667_10088233 3300025949 Bacteria 3208
355 Ga0207667_10215869 3300025949 Bacteria 1966
356 Ga0207651_10024555 3300025960 Bacteria 3731
357 Ga0207651_10041348 3300025960 Bacteria 3059
358 Ga0207651_10118354 3300025960 Bacteria 2004
359 Ga0207712_10000773 3300025961 Bacteria 23843
360 Ga0207712_10006230 3300025961 Bacteria 7518
361 Ga0207712_10014565 3300025961 Bacteria 5063
362 Ga0207712_10044790 3300025961 Bacteria 3060
363 Ga0207668_10022820 3300025972 Bacteria 4011
364 Ga0207668_10025346 3300025972 Bacteria 3837
365 Ga0207668_10029336 3300025972 Bacteria 3605
366 Ga0207658_10022174 3300025986 Bacteria 4419
367 Ga0207677_10023414 3300026023 Bacteria 3815
368 Ga0207703_10066154 3300026035 Bacteria 2972
369 Ga0207703_10092133 3300026035 Bacteria 2550
370 Ga0207639_10017550 3300026041 Bacteria 5075
371 Ga0207639_10019506 3300026041 Bacteria 4838
372 Ga0207639_10098365 3300026041 Bacteria 2358
373 Ga0207639_10106771 3300026041 Bacteria 2273
374 Ga0207678_10025904 3300026067 Bacteria 5118
375 Ga0207708_10045598 3300026075 Bacteria 3340
376 Ga0207641_10082452 3300026088 Bacteria 2794
377 Ga0207641_10182332 3300026088 Bacteria 1924
378 Ga0207648_10000460 3300026089 Bacteria 45268
379 Ga0207648_10014203 3300026089 Bacteria 7366
380 Ga0207674_10000569 3300026116 Bacteria 48396
381 Ga0207674_10003260 3300026116 Bacteria 19964
382 Ga0207674_10005593 3300026116 Bacteria 14898
383 Ga0207674_10057811 3300026116 Bacteria 3931
384 Ga0207675_100000052 3300026118 Bacteria 83169
385 Ga0207675_100036022 3300026118 Bacteria 4615
386 Ga0207675_100219552 3300026118 Bacteria 1831
387 Ga0207683_10032254 3300026121 Bacteria 4551
388 Ga0209588_1000148 3300027671 Bacteria 20232
389 Ga0209588_1000226 3300027671 Bacteria 15186
390 Ga0207428_10017312 3300027907 Bacteria 6187
391 Ga0268265_10008109 3300028380 Bacteria 7098
392 Ga0268264_10045562 3300028381 Bacteria 3641
393 Ga0265332_10006129 3300031238 Bacteria 5488
394 Ga0307408_100004752 3300031548 Bacteria 9155
395 Ga0307408_100004993 3300031548 Bacteria 8908
396 Ga0307408_100014329 3300031548 Bacteria 5267
397 Ga0307408_100019647 3300031548 Bacteria 4551
398 Ga0307408_100028174 3300031548 Bacteria 3879
399 Ga0307408_100028440 3300031548 Bacteria 3863
400 Ga0316579_10009416 3300031691 Bacteria 4107
401 Ga0265314_10005781 3300031711 Bacteria 11099
402 Ga0265314_10016769 3300031711 Bacteria 5772
403 Ga0265342_10017531 3300031712 Bacteria 4654
404 Ga0316576_10044486 3300031727 Bacteria 3207
405 Ga0316576_10076710 3300031727 Bacteria 2473
406 Ga0316578_10015146 3300031728 Bacteria 4140
407 Ga0307405_10004882 3300031731 Bacteria 6401
408 Ga0316577_10010930 3300031733 Bacteria 4910
409 Ga0307413_10000494 3300031824 Bacteria 12967
410 Ga0307413_10015807 3300031824 Bacteria 3878
411 Ga0307413_10021796 3300031824 Bacteria 3439
412 Ga0307413_10084564 3300031824 Bacteria 2045
413 Ga0307410_10005291 3300031852 Bacteria 6811
414 Ga0307410_10006308 3300031852 Bacteria 6389
415 Ga0307410_10011130 3300031852 Bacteria 5132
416 Ga0307410_10012688 3300031852 Bacteria 4883
417 Ga0307410_10042299 3300031852 Bacteria 3011
418 Ga0307406_10000913 3300031901 Bacteria 16569
419 Ga0307406_10011898 3300031901 Bacteria 4945
420 Ga0307406_10015375 3300031901 Bacteria 4427
421 Ga0307406_10019210 3300031901 Bacteria 4009
422 Ga0307406_10033088 3300031901 Bacteria 3161
423 Ga0307407_10003342 3300031903 Bacteria 6556
424 Ga0307407_10003894 3300031903 Bacteria 6226
425 Ga0307407_10033742 3300031903 Bacteria 2795
426 Ga0307412_10037951 3300031911 Bacteria 3098
427 Ga0307412_10062520 3300031911 Bacteria 2507
428 Ga0307409_100007257 3300031995 Bacteria 6611
429 Ga0307409_100011578 3300031995 Bacteria 5573
430 Ga0307409_100016080 3300031995 Bacteria 4937
431 Ga0307409_100019894 3300031995 Bacteria 4559
432 Ga0307409_100062581 3300031995 Bacteria 2914
433 Ga0307416_100000296 3300032002 Bacteria 26049
434 Ga0307416_100007269 3300032002 Bacteria 7021
435 Ga0307414_10012636 3300032004 Bacteria 5003
436 Ga0307414_10042490 3300032004 Bacteria 3089
437 Ga0307414_10069671 3300032004 Bacteria 2529
438 Ga0307411_10004331 3300032005 Bacteria 6775
439 Ga0307411_10010719 3300032005 Bacteria 4902
440 Ga0307411_10011540 3300032005 Bacteria 4775
441 Ga0307411_10029500 3300032005 Bacteria 3350
442 Ga0307411_10067618 3300032005 Bacteria 2405
443 Ga0307411_10072683 3300032005 Bacteria 2336
444 Ga0307415_100003460 3300032126 Bacteria 8039
445 Ga0307415_100007365 3300032126 Bacteria 6016
446 Ga0307415_100012741 3300032126 Bacteria 4875
447 Ga0316583_10000455 3300032133 Bacteria 12086
448 Ga0316585_10007880 3300032137 Bacteria 3080
449 Ga0316580_10001554 3300032139 Bacteria 6053
450 Ga0373959_0000613 3300034820 Bacteria 6260
451 Ga0373926_0012757 3300035083 Bacteria 2844
452 Ga0373923_0011096 3300035111 Bacteria 3297
453 Ga0373941_0000095 3300035115 Bacteria 14480
454 Ga0373956_0001230 3300035119 Bacteria 10597
455 Ga0373961_0003939 3300035241 Bacteria 3625
456 Ga0316574_0008298 3300035398 Bacteria 5761
457 Ga0373935_0006515 3300035692 Bacteria 6978
458 Ga0373933_0007619 3300035724 Bacteria 5909
459 Ga0373947_0000201 3300035725 Bacteria 33184
460 Ga0373937_0016355 3300036401 Bacteria 6586
461 Ga0316582_0011128 3300036647 Bacteria 4965
462 Ga0316584_0000493 3300036712 Bacteria 20854
463 Ga0316584_0029943 3300036712 Bacteria 4020
464 Ga0373925_0000393 3300037068 Bacteria 44676
465 Ga0395899_0007203 3300037312 Bacteria 8610
466 Ga0395899_0022248 3300037312 Bacteria 4809
467 Ga0395900_0005004 3300037418 Bacteria 13914
468 Ga0395898_0030430 3300037466 Bacteria 5402
469 Ga0395905_0047325 3300037471 Bacteria 4031
470 Ga0395905_0080046 3300037471 Bacteria 3062
471 Ga0316581_0010776 3300037588 Bacteria 2543
472 Ga0436364_0083375 3300037853 Bacteria 12645
473 Ga0395901_0005668 3300038443 Bacteria 12639
474 Ga0395901_0011179 3300038443 Bacteria 9097
475 Ga0242420_002805 3300038996 Bacteria 2522
476 Ga0436365_0001265 3300039437 Bacteria 13169
477 Ga0439435_0008975 3300042436 Bacteria 2334
478 Ga0451577_0000001 3300042876 Bacteria 2461803
479 Ga0451577_0001762 3300042876 Bacteria 27859
480 Ga0451577_0045185 3300042876 Bacteria 3942
481 Ga0451577_0135106 3300042876 Bacteria 2215
482 Ga0453683_0006326 3300044673 Bacteria 8134
483 Ga0453683_0017586 3300044673 Bacteria 4603
484 Ga0453684_0001192 3300044712 Bacteria 80361
485 Ga0453684_0210500 3300044712 Bacteria 2260
486 Ga0466959_0055224 3300045049 Bacteria 2900
487 Ga0451576_0002874 3300045051 Bacteria 24638
488 Ga0451576_0012277 3300045051 Bacteria 9640
489 Ga0495603_0013912 3300046455 Bacteria 4867
490 Ga0495603_0047928 3300046455 Bacteria 2544
491 Ga0495651_0000171 3300046462 Bacteria 47887
492 Ga0495653_0000065 3300046463 Bacteria 92073
493 Ga0495580_0000328 3300046472 Bacteria 38913
494 Ga0495582_0000632 3300046473 Bacteria 19400
495 Ga0495639_0000109 3300046475 Bacteria 41070
496 Ga0495594_0012692 3300046499 Bacteria 4394
497 Ga0495608_0001750 3300046511 Bacteria 15507
498 Ga0495628_0030183 3300046516 Bacteria 4391
499 Ga0495630_0001471 3300046517 Bacteria 16297
500 Ga0495630_0021711 3300046517 Bacteria 4740
501 Ga0495643_0000013 3300046522 Bacteria 315700
502 Ga0495652_0029639 3300046529 Bacteria 4807
503 Ga0495652_0061234 3300046529 Bacteria 3178
504 Ga0495665_0000084 3300046531 Bacteria 41465
505 Ga0495587_0005011 3300046536 Bacteria 8675
506 Ga0495587_0043582 3300046536 Bacteria 2672
507 Ga0495645_0045343 3300046543 Bacteria 3207
508 Ga0495667_0001283 3300046559 Bacteria 16447
509 Ga0495667_0001422 3300046559 Bacteria 15752
510 Ga0495667_0077992 3300046559 Bacteria 2154
511 Ga0495635_0008357 3300046663 Bacteria 7226
512 Ga0495635_0030930 3300046663 Bacteria 3718
513 Ga0495588_0000222 3300046674 Bacteria 53304
514 Ga0495657_0036329 3300046675 Bacteria 3405
515 Ga0495599_0009356 3300046678 Bacteria 5986
516 Ga0495623_0082051 3300046679 Bacteria 1993
517 Ga0495646_0002036 3300046680 Bacteria 12256
518 Ga0495658_0004014 3300046683 Bacteria 7256
519 Ga0495613_0001957 3300046689 Bacteria 15634
520 Ga0495613_0059478 3300046689 Bacteria 2801
521 Ga0495613_0065314 3300046689 Bacteria 2659
522 Ga0495624_0046677 3300046690 Bacteria 2754
523 Ga0495600_0009352 3300046809 Bacteria 6053
524 Ga0495600_0045065 3300046809 Bacteria 2877
525 Ga0495581_0001669 3300047315 Bacteria 12361
526 Ga0495604_0057136 3300047317 Bacteria 3001
527 Ga0495680_0021867 3300047322 Bacteria 5344
528 Ga0495680_0040959 3300047322 Bacteria 3686
529 Ga0495675_0041633 3300047444 Bacteria 2927
530 Ga0495675_0062235 3300047444 Bacteria 2363
531 Ga0495684_0000049 3300047471 Bacteria 87765
532 Ga0495684_0002481 3300047471 Bacteria 14708
533 Ga0495684_0071605 3300047471 Bacteria 2634
534 Ga0495593_0000119 3300047673 Bacteria 37938
535 Ga0495614_0000036 3300048089 Bacteria 40655
536 Ga0496101_0011273 3300048904 Bacteria 5925
537 Ga0496102_0016793 3300048905 Bacteria 6401
538 Ga0496102_0094593 3300048905 Bacteria 2769
539 Ga0496102_0156957 3300048905 Bacteria 2139
540 Ga0496103_0047168 3300048906 Bacteria 2661
541 Ga0496104_0007470 3300048907 Bacteria 9660
542 Ga0496104_0035369 3300048907 Bacteria 4664
543 Ga0496104_0048241 3300048907 Bacteria 4015
544 Ga0496104_0151297 3300048907 Bacteria 2227
545 Ga0496105_0175650 3300048908 Bacteria 1755
546 Ga0496106_0026266 3300048909 Bacteria 4335
547 Ga0496106_0032402 3300048909 Bacteria 3896
548 Ga0496108_0001661 3300048911 Bacteria 17638
549 Ga0496108_0003957 3300048911 Bacteria 11901
550 Ga0496108_0017492 3300048911 Bacteria 5865
551 Ga0496108_0098028 3300048911 Bacteria 2498
552 Ga0496109_0011100 3300048912 Bacteria 7724
553 Ga0496109_0033297 3300048912 Bacteria 4635
554 Ga0496109_0092689 3300048912 Bacteria 2794
555 Ga0496109_0162443 3300048912 Bacteria 2093
556 Ga0496110_0027805 3300048913 Bacteria 4851
557 Ga0496110_0034584 3300048913 Bacteria 4379
558 Ga0496111_0001088 3300048914 Bacteria 15011
559 Ga0496111_0005965 3300048914 Bacteria 7863
560 Ga0496112_0001400 3300048915 Bacteria 18427
561 Ga0496112_0006248 3300048915 Bacteria 10439
562 Ga0496112_0028795 3300048915 Bacteria 5365
563 Ga0496113_0001928 3300048916 Bacteria 11871
564 Ga0496113_0034288 3300048916 Bacteria 3703
565 Ga0496113_0039575 3300048916 Bacteria 3470
566 Ga0496113_0064615 3300048916 Bacteria 2767
567 Ga0496115_0003297 3300048918 Bacteria 11594
568 Ga0501033_0016031 3300049570 Bacteria 5676
569 Ga0501034_0082091 3300049571 Bacteria 3225
570 Ga0501041_0033507 3300049577 Bacteria 3108
571 Ga0501043_0099396 3300049579 Bacteria 2287
572 Ga0501046_0078067 3300049580 Bacteria 2562
573 Ga0501047_0005043 3300049581 Bacteria 12392
574 Ga0501047_0114672 3300049581 Bacteria 2577
575 Ga0501048_0050204 3300049582 Bacteria 2971
576 Ga0501048_0056926 3300049582 Bacteria 2773
577 Ga0501068_0000905 3300049584 Bacteria 15515
578 Ga0501068_0007137 3300049584 Bacteria 6182
579 Ga0501069_0001124 3300049585 Bacteria 12912
580 Ga0501070_0001649 3300049586 Bacteria 19793
581 Ga0501070_0016753 3300049586 Bacteria 6152
582 Ga0501070_0087000 3300049586 Bacteria 2587
583 Ga0501070_0102197 3300049586 Bacteria 2371
584 Ga0501071_0006293 3300049587 Bacteria 7704
585 Ga0501072_0001056 3300049588 Bacteria 20408
586 Ga0501073_0070970 3300049589 Bacteria 2427
587 Ga0501074_0000889 3300049590 Bacteria 19103
588 Ga0501074_0008253 3300049590 Bacteria 7549
589 Ga0501075_0070145 3300049591 Bacteria 2649
590 Ga0501076_0019171 3300049592 Bacteria 5224
591 Ga0501076_0044350 3300049592 Bacteria 3507
592 Ga0501076_0201170 3300049592 Bacteria 1626
593 Ga0501077_0044943 3300049593 Bacteria 2805
594 Ga0501079_0062827 3300049741 Bacteria 2864
595 Ga0501080_0023233 3300049742 Bacteria 5749
596 Ga0501080_0091963 3300049742 Bacteria 2818
597 Ga0501080_0137979 3300049742 Bacteria 2256
598 Ga0501081_0024510 3300049743 Bacteria 4051
599 Ga0501083_0008243 3300049744 Bacteria 7367
600 Ga0501267_000578 3300049764 Bacteria 2895
601 Ga0501273_000309 3300049770 Bacteria 3791
602 Ga0501035_0000238 3300049822 Bacteria 65886
603 nmdc:mga05p37_107813_c1 3300050507 Bacteria 3427
604 nmdc:mga05p37_11168_c1 3300050507 Bacteria 10673
605 nmdc:mga05p37_11533_c1 3300050507 Bacteria 10528
606 nmdc:mga05p37_137583_c1 3300050507 Bacteria 2994
607 nmdc:mga05p37_40112_c1 3300050507 Bacteria 5749
608 nmdc:mga05p37_75928_c1 3300050507 Bacteria 4137
609 nmdc:mga09592_16428_c1 3300050508 Bacteria 6054
610 nmdc:mga09592_61189_c1 3300050508 Bacteria 3184
611 nmdc:mga09592_66270_c1 3300050508 Bacteria 3060
612 nmdc:mga09592_792_c2 3300050508 Bacteria 23663
613 nmdc:mga09592_88317_c1 3300050508 Bacteria 2647
614 nmdc:mga0qj67_140234_c1 3300050509 Bacteria 1960
615 nmdc:mga0qj67_26978_c1 3300050509 Bacteria 4449
616 nmdc:mga0qj67_34334_c1 3300050509 Bacteria 3962
617 nmdc:mga06r32_128782_c1 3300050510 Bacteria 2501
618 nmdc:mga08y16_156448_c1 3300050511 Bacteria 2368
619 nmdc:mga08y16_169059_c1 3300050511 Bacteria 2271
620 nmdc:mga08y16_28594_c1 3300050511 Bacteria 5876
621 nmdc:mga08y16_46267_c1 3300050511 Bacteria 4555
622 nmdc:mga0n895_118737_c1 3300050512 Bacteria 2665
623 nmdc:mga0n895_226912_c1 3300050512 Bacteria 1896
624 nmdc:mga0n895_695_c1 3300050512 Bacteria 23607
625 nmdc:mga0n895_7056_c1 3300050512 Bacteria 9598
626 nmdc:mga0n895_9683_c1 3300050512 Bacteria 8451
627 nmdc:mga0rr50_11248_c1 3300050513 Bacteria 5717
628 nmdc:mga0rr50_86628_c1 3300050513 Bacteria 2430
629 nmdc:mga0rr50_97936_c1 3300050513 Bacteria 2298
630 nmdc:mga08x19_47809_c1 3300050514 Bacteria 2739
631 nmdc:mga0a205_201_c1 3300050515 Bacteria 41667
632 nmdc:mga0a205_30283_c1 3300050515 Bacteria 5180
633 nmdc:mga0a205_33304_c1 3300050515 Bacteria 4941
634 nmdc:mga0a205_9278_c1 3300050515 Bacteria 8986
635 Ga0495619_0035683 3300053085 Bacteria 3235
636 Ga0500628_000842 3300053129 Bacteria 5450
637 Ga0501084_0001417 3300054114 Bacteria 19002
638 Ga0501084_0019659 3300054114 Bacteria 5627
639 Ga0501084_0105602 3300054114 Bacteria 2366
640 Ga0590071_002740 3300059421 Bacteria 4413
641 Ga0590071_003358 3300059421 Bacteria 3940
642 Ga0590071_004270 3300059421 Bacteria 3476
643 Ga0590077_004956 3300059426 Bacteria 2724
644 Ga0501082_0001678 3300060353 Bacteria 19538
645 Ga0501082_0008033 3300060353 Bacteria 9109
646 Ga0105241_10000457
647 JGI24737J22298_10006759
648 Ga0065715_10005641
649 Ga0065715_10093316
650 Ga0065715_10095668
651 Ga0065715_10122869
652 Ga0065707_10087905
653 Ga0070658_10011653
654 Ga0070658_10013996
655 Ga0070676_10001981
656 Ga0070676_10059141
657 Ga0070683_100004860
658 Ga0070683_100012786
659 Ga0070683_100032178
660 Ga0070670_100006929
661 Ga0068869_100006453
662 Ga0070680_100001098
663 Ga0070680_100057565
664 Ga0070680_100068748
665 Ga0070680_100069665
666 Ga0070682_100000484
667 Ga0070682_100000820
668 Ga0070682_100000832
669 Ga0068868_100005066
670 Ga0070660_100014184
671 Ga0070689_100078081
672 Ga0070691_10050757
673 Ga0070691_10074807
674 Ga0070687_100001604
675 Ga0070687_100001914
676 Ga0070661_100009939
677 Ga0070661_100015360
678 Ga0070661_100015567
679 Ga0070692_10013114
680 Ga0070668_100000943
681 Ga0070668_100009748
682 Ga0070668_100030966
683 Ga0070669_100000295
684 Ga0070669_100006385
685 Ga0070669_100007216
686 Ga0070675_100008383
687 Ga0070675_100055553
688 Ga0070671_100003568
689 Ga0070674_100000041
690 Ga0070674_100026834
691 Ga0070674_100028160
692 Ga0070673_100052356
693 Ga0070688_100019954
694 Ga0070659_100058688
695 Ga0070659_100069185
696 Ga0070667_100032000
697 Ga0070709_10000929
698 Ga0070709_10003801
699 Ga0070709_10010601
700 Ga0070709_10014644
701 Ga0070709_10018774
702 Ga0070709_10081281
703 Ga0070714_100005536
704 Ga0070714_100010177
705 Ga0070714_100013506
706 Ga0070713_100000145
707 Ga0070713_100014533
708 Ga0070701_10056111
709 Ga0070711_100000039
710 Ga0070711_100041854
711 Ga0070705_100000667
712 Ga0070705_100009454
713 Ga0070705_100033023
714 Ga0070705_100042937
715 Ga0070700_100029444
716 Ga0070694_100044783
717 Ga0070708_100000210
718 Ga0070708_100000357
719 Ga0070708_100001673
720 Ga0070708_100004166
721 Ga0070708_100039253
722 Ga0070708_100095162
723 Ga0070708_100096363
724 Ga0070663_100006931
725 Ga0070678_100004027
726 Ga0070662_100000533
727 Ga0070662_100002151
728 Ga0070662_100008083
729 Ga0070681_10001055
730 Ga0070681_10023925
731 Ga0070681_10034709
732 Ga0070681_10135824
733 Ga0068867_100002452
734 Ga0070685_10011283
735 Ga0070685_10018232
736 Ga0070706_100004311
737 Ga0070706_100025943
738 Ga0070706_100064667
739 Ga0070707_100000693
740 Ga0070707_100001168
741 Ga0070707_100018155
742 Ga0070707_100025529
743 Ga0070707_100054968
744 Ga0070707_100063818
745 Ga0070698_100000771
746 Ga0070698_100004921
747 Ga0070698_100017906
748 Ga0070698_100021225
749 Ga0070698_100038308
750 Ga0070698_100091494
751 Ga0070698_100107346
752 Ga0070698_100112286
753 Ga0070699_100000017
754 Ga0070699_100006261
755 Ga0070699_100010859
756 Ga0070699_100021473
757 Ga0070699_100057542
758 Ga0070679_100048661
759 Ga0070679_100060229
760 Ga0070679_100140957
761 Ga0070684_100002068
762 Ga0070684_100012928
763 Ga0070684_100033171
764 Ga0070684_100065430
765 Ga0070684_100093211
766 Ga0070697_100002276
767 Ga0070697_100065971
768 Ga0070697_100077509
769 Ga0068853_100018054
770 Ga0068853_100043231
771 Ga0068853_100049543
772 Ga0068853_100055716
773 Ga0070672_100059776
774 Ga0070686_100000004
775 Ga0070686_100002192
776 Ga0070686_100027987
777 Ga0070695_100002571
778 Ga0070695_100010783
779 Ga0070696_100000258
780 Ga0070696_100001894
781 Ga0070696_100053959
782 Ga0070696_100100755
783 Ga0070693_100001629
784 Ga0070693_100016525
785 Ga0070693_100025116
786 Ga0070665_100071931
787 Ga0070704_100000131
788 Ga0070704_100001236
789 Ga0070704_100015670
790 Ga0070704_100041394
791 Ga0070704_100045943
792 Ga0070704_100062175
793 Ga0070704_100081069
794 Ga0068855_100000955
795 Ga0068855_100104710
796 Ga0068855_100200287
797 Ga0070664_100001434
798 Ga0070664_100092991
799 Ga0068857_100006243
800 Ga0068857_100011083
801 Ga0068857_100032160
802 Ga0068857_100032447
803 Ga0068854_100023802
804 Ga0070702_100008718
805 Ga0068852_100038728
806 Ga0068859_100044269
807 Ga0068859_100078030
808 Ga0068864_100000513
809 Ga0068864_100042139
810 Ga0068866_10000879
811 Ga0068861_100002473
812 Ga0068870_10007409
813 Ga0068863_100022225
814 Ga0068858_100018041
815 Ga0068860_100007067
816 Ga0068860_100137261
817 Ga0068862_100000848
818 Ga0068862_100002981
819 Ga0081539_10000087
820 Ga0081539_10032873
821 Ga0070716_100011832
822 Ga0070716_100014045
823 Ga0070712_100049375
824 Ga0097621_100038591
825 Ga0068871_100074810
826 Ga0075428_100009899
827 Ga0075428_100024712
828 Ga0075428_100110140
829 Ga0075430_100005695
830 Ga0075430_100006469
831 Ga0075430_100009351
832 Ga0075430_100106123
833 Ga0075431_100005850
834 Ga0075431_100028370
835 Ga0075431_100068077
836 Ga0075433_10000113
837 Ga0075433_10027295
838 Ga0075433_10055257
839 Ga0075434_100000514
840 Ga0075434_100001776
841 Ga0075434_100003802
842 Ga0075434_100009886
843 Ga0075434_100113089
844 Ga0075434_100136653
845 Ga0075429_100000824
846 Ga0075429_100004806
847 Ga0068865_100004622
848 Ga0075436_100005098
849 Ga0075436_100013343
850 Ga0075436_100023652
851 Ga0075436_100028244
852 Ga0075436_100063026
853 Ga0097620_100015379
854 Ga0097620_100044266
855 Ga0097620_100078030
856 Ga0075435_100002752
857 Ga0075435_100010345
858 Ga0075435_100136017
859 Ga0099794_10000085
860 Ga0099794_10030824
861 Ga0099794_10045032
862 Ga0105240_10007698
863 Ga0105240_10058447
864 Ga0105240_10069042
865 Ga0111539_10137600
866 Ga0111539_10147344
867 Ga0111539_10319260
868 Ga0105245_10063606
869 Ga0114129_10010130
870 Ga0114129_10052359
871 Ga0114129_10096127
872 Ga0114129_10171779
873 Ga0105241_10006589
874 Ga0105241_10022305
875 Ga0105241_10068575
876 Ga0105248_10007867
877 Ga0105248_10112433
878 Ga0105237_10013619
879 Ga0105238_10001309
880 Ga0105249_10000716
881 Ga0105249_10035000
882 Ga0105239_10004042
883 Ga0105239_10073031
884 Ga0105246_10017333
885 Ga0157373_10024281
886 Ga0157371_10011126
887 Ga0157370_10031382
888 Ga0157370_10038503
889 Ga0157370_10067719
890 Ga0157369_10027456
891 Ga0157369_10039642
892 Ga0157369_10063801
893 Ga0157374_10051721
894 Ga0157374_10071777
895 Ga0157378_10000989
896 Ga0157378_10007245
897 Ga0157378_10112659
898 Ga0163162_10013541
899 Ga0163162_10040116
900 Ga0157372_10015669
901 Ga0157372_10027756
902 Ga0157372_10108820
903 Ga0157380_10005367
904 Ga0157379_10060425
905 Ga0163161_10051362
906 Ga0207697_10014138
907 Ga0207697_10023844
908 Ga0207653_10000060
909 Ga0207642_10001654
910 Ga0207642_10002850
911 Ga0207699_10003687
912 Ga0207699_10016639
913 Ga0207699_10052373
914 Ga0207645_10001348
915 Ga0207645_10006303
916 Ga0207645_10013755
917 Ga0207643_10004070
918 Ga0207643_10009035
919 Ga0207705_10002273
920 Ga0207705_10005269
921 Ga0207705_10018678
922 Ga0207705_10038479
923 Ga0207705_10041231
924 Ga0207684_10011251
925 Ga0207684_10017624
926 Ga0207684_10113131
927 Ga0207654_10000290
928 Ga0207707_10001641
929 Ga0207707_10001671
930 Ga0207707_10004239
931 Ga0207707_10004248
932 Ga0207707_10007801
933 Ga0207707_10017444
934 Ga0207707_10024002
935 Ga0207707_10033327
936 Ga0207695_10008710
937 Ga0207695_10023571
938 Ga0207695_10024059
939 Ga0207695_10059814
940 Ga0207695_10076592
941 Ga0207671_10015355
942 Ga0207671_10016818
943 Ga0207693_10012123
944 Ga0207663_10000106
945 Ga0207663_10055675
946 Ga0207663_10057948
947 Ga0207660_10009785
948 Ga0207660_10045986
949 Ga0207660_10049297
950 Ga0207660_10052763
951 Ga0207662_10003356
952 Ga0207657_10016679
953 Ga0207657_10050089
954 Ga0207657_10109465
955 Ga0207649_10001390
956 Ga0207649_10007372
957 Ga0207652_10016873
958 Ga0207646_10002930
959 Ga0207646_10003253
960 Ga0207646_10003824
961 Ga0207646_10017019
962 Ga0207646_10067303
963 Ga0207681_10007051
964 Ga0207681_10011189
965 Ga0207681_10029762
966 Ga0207694_10000038
967 Ga0207650_10011179
968 Ga0207659_10006685
969 Ga0207700_10006944
970 Ga0207664_10049801
971 Ga0207644_10015509
972 Ga0207690_10047223
973 Ga0207706_10000367
974 Ga0207706_10000555
975 Ga0207706_10000642
976 Ga0207706_10004642
977 Ga0207686_10000049
978 Ga0207686_10013777
979 Ga0207670_10024254
980 Ga0207669_10000494
981 Ga0207669_10026554
982 Ga0207704_10000404
983 Ga0207704_10026782
984 Ga0207665_10003407
985 Ga0207665_10015181
986 Ga0207691_10000611
987 Ga0207711_10025139
988 Ga0207689_10002001
989 Ga0207689_10008498
990 Ga0207661_10005943
991 Ga0207661_10012607
992 Ga0207661_10018034
993 Ga0207661_10066694
994 Ga0207679_10005618
995 Ga0207679_10071429
996 Ga0207667_10005098
997 Ga0207667_10017066
998 Ga0207667_10052353
999 Ga0207667_10088233
1000 Ga0207667_10215869
1001 Ga0207651_10024555
1002 Ga0207651_10041348
1003 Ga0207651_10118354
1004 Ga0207712_10000773
1005 Ga0207712_10006230
1006 Ga0207712_10014565
1007 Ga0207712_10044790
1008 Ga0207668_10022820
1009 Ga0207668_10025346
1010 Ga0207668_10029336
1011 Ga0207658_10022174
1012 Ga0207677_10023414
1013 Ga0207703_10066154
1014 Ga0207703_10092133
1015 Ga0207639_10017550
1016 Ga0207639_10019506
1017 Ga0207639_10098365
1018 Ga0207639_10106771
1019 Ga0207678_10025904
1020 Ga0207708_10045598
1021 Ga0207641_10082452
1022 Ga0207641_10182332
1023 Ga0207648_10000460
1024 Ga0207648_10014203
1025 Ga0207674_10000569
1026 Ga0207674_10003260
1027 Ga0207674_10005593
1028 Ga0207674_10057811
1029 Ga0207675_100000052
1030 Ga0207675_100036022
1031 Ga0207675_100219552
1032 Ga0207683_10032254
1033 Ga0209588_1000148
1034 Ga0209588_1000226
1035 Ga0207428_10017312
1036 Ga0268265_10008109
1037 Ga0268264_10045562
1038 Ga0265332_10006129
1039 Ga0307408_100004752
1040 Ga0307408_100004993
1041 Ga0307408_100014329
1042 Ga0307408_100019647
1043 Ga0307408_100028174
1044 Ga0307408_100028440
1045 Ga0316579_10009416
1046 Ga0265314_10005781
1047 Ga0265314_10016769
1048 Ga0265342_10017531
1049 Ga0316576_10044486
1050 Ga0316576_10076710
1051 Ga0316578_10015146
1052 Ga0307405_10004882
1053 Ga0316577_10010930
1054 Ga0307413_10000494
1055 Ga0307413_10015807
1056 Ga0307413_10021796
1057 Ga0307413_10084564
1058 Ga0307410_10005291
1059 Ga0307410_10006308
1060 Ga0307410_10011130
1061 Ga0307410_10012688
1062 Ga0307410_10042299
1063 Ga0307406_10000913
1064 Ga0307406_10011898
1065 Ga0307406_10015375
1066 Ga0307406_10019210
1067 Ga0307406_10033088
1068 Ga0307407_10003342
1069 Ga0307407_10003894
1070 Ga0307407_10033742
1071 Ga0307412_10037951
1072 Ga0307412_10062520
1073 Ga0307409_100007257
1074 Ga0307409_100011578
1075 Ga0307409_100016080
1076 Ga0307409_100019894
1077 Ga0307409_100062581
1078 Ga0307416_100000296
1079 Ga0307416_100007269
1080 Ga0307414_10012636
1081 Ga0307414_10042490
1082 Ga0307414_10069671
1083 Ga0307411_10004331
1084 Ga0307411_10010719
1085 Ga0307411_10011540
1086 Ga0307411_10029500
1087 Ga0307411_10067618
1088 Ga0307411_10072683
1089 Ga0307415_100003460
1090 Ga0307415_100007365
1091 Ga0307415_100012741
1092 Ga0316583_10000455
1093 Ga0316585_10007880
1094 Ga0316580_10001554
1095 Ga0373959_0000613
1096 Ga0373926_0012757
1097 Ga0373923_0011096
1098 Ga0373941_0000095
1099 Ga0373956_0001230
1100 Ga0373961_0003939
1101 Ga0316574_0008298
1102 Ga0373935_0006515
1103 Ga0373933_0007619
1104 Ga0373947_0000201
1105 Ga0373937_0016355
1106 Ga0316582_0011128
1107 Ga0316584_0000493
1108 Ga0316584_0029943
1109 Ga0373925_0000393
1110 Ga0395899_0007203
1111 Ga0395899_0022248
1112 Ga0395900_0005004
1113 Ga0395898_0030430
1114 Ga0395905_0047325
1115 Ga0395905_0080046
1116 Ga0316581_0010776
1117 Ga0436364_0083375
1118 Ga0395901_0005668
1119 Ga0395901_0011179
1120 Ga0242420_002805
1121 Ga0436365_0001265
1122 Ga0439435_0008975
1123 Ga0451577_0000001
1124 Ga0451577_0001762
1125 Ga0451577_0045185
1126 Ga0451577_0135106
1127 Ga0453683_0006326
1128 Ga0453683_0017586
1129 Ga0453684_0001192
1130 Ga0453684_0210500
1131 Ga0466959_0055224
1132 Ga0451576_0002874
1133 Ga0451576_0012277
1134 Ga0495603_0013912
1135 Ga0495603_0047928
1136 Ga0495651_0000171
1137 Ga0495653_0000065
1138 Ga0495580_0000328
1139 Ga0495582_0000632
1140 Ga0495639_0000109
1141 Ga0495594_0012692
1142 Ga0495608_0001750
1143 Ga0495628_0030183
1144 Ga0495630_0001471
1145 Ga0495630_0021711
1146 Ga0495643_0000013
1147 Ga0495652_0029639
1148 Ga0495652_0061234
1149 Ga0495665_0000084
1150 Ga0495587_0005011
1151 Ga0495587_0043582
1152 Ga0495645_0045343
1153 Ga0495667_0001283
1154 Ga0495667_0001422
1155 Ga0495667_0077992
1156 Ga0495635_0008357
1157 Ga0495635_0030930
1158 Ga0495588_0000222
1159 Ga0495657_0036329
1160 Ga0495599_0009356
1161 Ga0495623_0082051
1162 Ga0495646_0002036
1163 Ga0495658_0004014
1164 Ga0495613_0001957
1165 Ga0495613_0059478
1166 Ga0495613_0065314
1167 Ga0495624_0046677
1168 Ga0495600_0009352
1169 Ga0495600_0045065
1170 Ga0495581_0001669
1171 Ga0495604_0057136
1172 Ga0495680_0021867
1173 Ga0495680_0040959
1174 Ga0495675_0041633
1175 Ga0495675_0062235
1176 Ga0495684_0000049
1177 Ga0495684_0002481
1178 Ga0495684_0071605
1179 Ga0495593_0000119
1180 Ga0495614_0000036
1181 Ga0496101_0011273
1182 Ga0496102_0016793
1183 Ga0496102_0094593
1184 Ga0496102_0156957
1185 Ga0496103_0047168
1186 Ga0496104_0007470
1187 Ga0496104_0035369
1188 Ga0496104_0048241
1189 Ga0496104_0151297
1190 Ga0496105_0175650
1191 Ga0496106_0026266
1192 Ga0496106_0032402
1193 Ga0496108_0001661
1194 Ga0496108_0003957
1195 Ga0496108_0017492
1196 Ga0496108_0098028
1197 Ga0496109_0011100
1198 Ga0496109_0033297
1199 Ga0496109_0092689
1200 Ga0496109_0162443
1201 Ga0496110_0027805
1202 Ga0496110_0034584
1203 Ga0496111_0001088
1204 Ga0496111_0005965
1205 Ga0496112_0001400
1206 Ga0496112_0006248
1207 Ga0496112_0028795
1208 Ga0496113_0001928
1209 Ga0496113_0034288
1210 Ga0496113_0039575
1211 Ga0496113_0064615
1212 Ga0496115_0003297
1213 Ga0501033_0016031
1214 Ga0501034_0082091
1215 Ga0501041_0033507
1216 Ga0501043_0099396
1217 Ga0501046_0078067
1218 Ga0501047_0005043
1219 Ga0501047_0114672
1220 Ga0501048_0050204
1221 Ga0501048_0056926
1222 Ga0501068_0000905
1223 Ga0501068_0007137
1224 Ga0501069_0001124
1225 Ga0501070_0001649
1226 Ga0501070_0016753
1227 Ga0501070_0087000
1228 Ga0501070_0102197
1229 Ga0501071_0006293
1230 Ga0501072_0001056
1231 Ga0501073_0070970
1232 Ga0501074_0000889
1233 Ga0501074_0008253
1234 Ga0501075_0070145
1235 Ga0501076_0019171
1236 Ga0501076_0044350
1237 Ga0501076_0201170
1238 Ga0501077_0044943
1239 Ga0501079_0062827
1240 Ga0501080_0023233
1241 Ga0501080_0091963
1242 Ga0501080_0137979
1243 Ga0501081_0024510
1244 Ga0501083_0008243
1245 Ga0501267_000578
1246 Ga0501273_000309
1247 Ga0501035_0000238
1248 nmdc:mga05p37_107813_c1
1249 nmdc:mga05p37_11168_c1
1250 nmdc:mga05p37_11533_c1
1251 nmdc:mga05p37_137583_c1
1252 nmdc:mga05p37_40112_c1
1253 nmdc:mga05p37_75928_c1
1254 nmdc:mga09592_16428_c1
1255 nmdc:mga09592_61189_c1
1256 nmdc:mga09592_66270_c1
1257 nmdc:mga09592_792_c2
1258 nmdc:mga09592_88317_c1
1259 nmdc:mga0qj67_140234_c1
1260 nmdc:mga0qj67_26978_c1
1261 nmdc:mga0qj67_34334_c1
1262 nmdc:mga06r32_128782_c1
1263 nmdc:mga08y16_156448_c1
1264 nmdc:mga08y16_169059_c1
1265 nmdc:mga08y16_28594_c1
1266 nmdc:mga08y16_46267_c1
1267 nmdc:mga0n895_118737_c1
1268 nmdc:mga0n895_226912_c1
1269 nmdc:mga0n895_695_c1
1270 nmdc:mga0n895_7056_c1
1271 nmdc:mga0n895_9683_c1
1272 nmdc:mga0rr50_11248_c1
1273 nmdc:mga0rr50_86628_c1
1274 nmdc:mga0rr50_97936_c1
1275 nmdc:mga08x19_47809_c1
1276 nmdc:mga0a205_201_c1
1277 nmdc:mga0a205_30283_c1
1278 nmdc:mga0a205_33304_c1
1279 nmdc:mga0a205_9278_c1
1280 Ga0495619_0035683
1281 Ga0500628_000842
1282 Ga0501084_0001417
1283 Ga0501084_0019659
1284 Ga0501084_0105602
1285 Ga0590071_002740
1286 Ga0590071_003358
1287 Ga0590071_004270
1288 Ga0590077_004956
1289 Ga0501082_0001678
1290 Ga0501082_0008033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00437

T2SSE

Type II/IV secretion system protein

248

516

0.99

PF05157

MshEN

MshEN domain

112

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsg-assembly1.cif.gz_B-2 pilb from geobacter metallireducens bound to adp 0.9153 174 589
5tsg-assembly1.cif.gz_C-2 pilb from geobacter metallireducens bound to adp 0.9114 174 589
5tsg-assembly1.cif.gz_B-2 pilb from geobacter metallireducens bound to adp 0.8994 174 589
5tsg-assembly1.cif.gz_C-2 pilb from geobacter metallireducens bound to adp 0.8954 174 589
5tsh-assembly1.cif.gz_C pilb from geobacter metallireducens bound to amp-pnp 0.8796 173 589
ID Description Score Start End Superfamily
5tshE01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9745 175 278 3.30.450.90
5oiuB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9513 173 278 3.30.450.90
5tshE01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9476 175 278 3.30.450.90
af_Q2FY30_1_105_3.30.450.90 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9418 179 280 3.30.450.90
4phtC02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9389 172 282 3.30.450.90
ID Description Score Start End GO Terms
AF-A0A4Q5VVS5-F1-model_v4 deleted 0.945 368 589
AF-A0A2N1U4V8-F1-model_v4 Pilus assembly protein PilB 0.9429 428 589 GO:0005886
GO:0016887
AF-A0A7Y4ZG76-F1-model_v4 Type II secretion system protein GspE N-terminal domain-containing protein 0.9405 65 145
AF-A0A351SBW4-F1-model_v4 Secretion system protein E 0.9325 385 590 GO:0005524
GO:0005886
GO:0016887
AF-A0A5M9I553-F1-model_v4 deleted 0.9311 406 592

Map