F472114

General Info

Members Datasets Scaffolds Average Seq Length
645 316 614 389

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100013922|Ga0068855_1000139228
Length 425
Sequence MCKLANLKMKYQEAKAFSICRTCPDMSGFSNFQINIMHTSKRLEGIGEYYFSQKLREIDELNKQGKNVINLGIGSPDLPPHPDVIKTLQEESAKPNVHGYQSYKGSPILRKAISDWYKTWYKVDLNADTEILPLIGSKEGIMHICMTYLNEGDKALVPNPGYPTYRSAVKLAGGECVDYDLKEENNWEPDFDQLEKLVAGVKIMWINYPQMPTGQLPTKALFEKIVAFGKKHNILICHDNPYSFILNDNPLSLLHVPGAKDTAIELNSLSKSHNMAGWRVGALCGAKERIDEVLRFKSNMDSGMFLPMQLAAAKALQLPESWYNEVNSVYKKRQQRAFELLDLLECAYDKNQAGMFVWAKVPAGYKTGYELSDEVLYNTAVFITPGGIFGNAGDGYIRVSLCSPEEKFAESIKRIKSFLPALKVK

Samples

Sample ID Description Type Environment
1 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
7 2818991444 Filimonas endophytica 3197 Isolate Unclassified
8 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
9 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
10 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
11 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
12 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
13 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
14 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
15 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
16 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
17 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
18 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
19 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
20 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
21 2914759650 Rhizosphaericola mali Isolate Rhizosphere
22 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
23 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
24 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
25 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
26 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
27 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
28 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
29 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
30 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
31 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
34 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
193 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
194 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
220 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
221 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
271 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
272 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
273 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
274 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
275 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
276 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
279 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
280 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
281 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
286 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
287 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
297 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
316 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.04
Metatranscriptomes 0
Isolates 4.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0
Rhizoplane 0.31
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 8.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011458 3300001979 Bacteria 3373
2 JGI24751J29686_10001382 3300002459 Bacteria 5093
3 JGI25154J39366_1000007 3300002738 Bacteria 335932
4 rootH1_10050638 3300003316 Bacteria 3400
5 rootH1_10169229 3300003316 Bacteria 1507
6 rootH2_10020409 3300003320 Bacteria 10833
7 rootH2_10030196 3300003320 Bacteria 3358
8 rootH2_10030789 3300003320 Bacteria 26106
9 rootL2_10033506 3300003322 Bacteria 2861
10 rootL2_10040567 3300003322 Bacteria 5844
11 rootL2_10042558 3300003322 Bacteria 2047
12 rootL2_10061218 3300003322 Bacteria 4417
13 rootL2_10134991 3300003322 Bacteria 1805
14 rootH1_10000019 3300003316 Bacteria 18606
15 rootH1_10000019 3300003323 Bacteria 34919
16 rootH1_10005690 3300003323 Bacteria 14335
17 JGI25160J50197_1000745 3300003354 Bacteria 17705
18 JGI25160J50197_1001556 3300003354 Bacteria 11331
19 JGI25160J50197_1010899 3300003354 Bacteria 3258
20 Ga0055535_1005833 3300003761 Bacteria 2615
21 Ga0055528_1001519 3300003790 Bacteria 14022
22 Ga0055531_10000020 3300003794 Bacteria 170186
23 Ga0055531_10000235 3300003794 Bacteria 60560
24 Ga0065165_1000010 3300005262 Bacteria 323737
25 Ga0065714_10003245 3300005288 Bacteria 9787
26 Ga0065704_10080787 3300005289 Bacteria 3880
27 Ga0065704_10096912 3300005289 Bacteria 2418
28 Ga0065707_10111468 3300005295 Bacteria 2374
29 Ga0070658_10046141 3300005327 Bacteria 3526
30 Ga0070658_10063511 3300005327 Bacteria 3010
31 Ga0070676_10002612 3300005328 Bacteria 9270
32 Ga0070683_100006858 3300005329 Bacteria 9570
33 Ga0070683_100016743 3300005329 Bacteria 6468
34 Ga0070683_100065555 3300005329 Bacteria 3381
35 Ga0070690_100022209 3300005330 Bacteria 3880
36 Ga0070670_100204713 3300005331 Bacteria 1715
37 Ga0068869_100006827 3300005334 Bacteria 7261
38 Ga0068869_100043465 3300005334 Bacteria 3227
39 Ga0068869_100054328 3300005334 Bacteria 2915
40 Ga0068869_100064007 3300005334 Bacteria 2704
41 Ga0068869_100065736 3300005334 Bacteria 2670
42 Ga0070666_10000833 3300005335 Bacteria 18712
43 Ga0070666_10014917 3300005335 Bacteria 4950
44 Ga0070666_10113667 3300005335 Bacteria 1874
45 Ga0070682_100009946 3300005337 Bacteria 5388
46 Ga0070682_100045252 3300005337 Unclassified 2727
47 Ga0070682_100091199 3300005337 Bacteria 1994
48 Ga0068868_100010161 3300005338 Bacteria 6802
49 Ga0068868_100025719 3300005338 Bacteria 4481
50 Ga0070660_100169369 3300005339 Bacteria 1763
51 Ga0070660_100189154 3300005339 Bacteria 1667
52 Ga0070689_100034428 3300005340 Bacteria 3864
53 Ga0070689_100085924 3300005340 Bacteria 2474
54 Ga0070689_100122795 3300005340 Bacteria 2075
55 Ga0070689_100193106 3300005340 Unclassified 1658
56 Ga0070687_100041952 3300005343 Unclassified 2316
57 Ga0070661_100001301 3300005344 Bacteria 17525
58 Ga0070668_100060261 3300005347 Bacteria 2939
59 Ga0070668_100067305 3300005347 Bacteria 2782
60 Ga0070675_100013523 3300005354 Bacteria 6415
61 Ga0070675_100017829 3300005354 Bacteria 5648
62 Ga0070675_100095460 3300005354 Bacteria 2496
63 Ga0070675_100283682 3300005354 Bacteria 1456
64 Ga0070671_100068086 3300005355 Bacteria 2969
65 Ga0070671_100098288 3300005355 Bacteria 2455
66 Ga0070671_100170246 3300005355 Bacteria 1842
67 Ga0070671_100218802 3300005355 Unclassified 1616
68 Ga0070674_100054359 3300005356 Bacteria 2769
69 Ga0070673_100033564 3300005364 Bacteria 3877
70 Ga0070673_100049558 3300005364 Bacteria 3279
71 Ga0070673_100128020 3300005364 Bacteria 2127
72 Ga0070673_100206650 3300005364 Bacteria 1693
73 Ga0070688_100027767 3300005365 Unclassified 3372
74 Ga0070688_100059983 3300005365 Bacteria 2401
75 Ga0070659_100009963 3300005366 Bacteria 6992
76 Ga0070659_100014216 3300005366 Bacteria 5942
77 Ga0070659_100225285 3300005366 Unclassified 1548
78 Ga0070678_100011496 3300005456 Bacteria 5466
79 Ga0070662_100012250 3300005457 Bacteria 5679
80 Ga0070662_100016887 3300005457 Bacteria 4907
81 Ga0070662_100065140 3300005457 Bacteria 2671
82 Ga0070681_10006155 3300005458 Bacteria 11657
83 Ga0070681_10095387 3300005458 Bacteria 2923
84 Ga0070681_10098929 3300005458 Bacteria 2863
85 Ga0070681_10186665 3300005458 Bacteria 1994
86 Ga0068867_100021159 3300005459 Bacteria 4639
87 Ga0070698_100005366 3300005471 Bacteria 14020
88 Ga0070698_100038442 3300005471 Bacteria 4930
89 Ga0070679_100008640 3300005530 Bacteria 9598
90 Ga0070679_100011686 3300005530 Bacteria 8371
91 Ga0070679_100231532 3300005530 Bacteria 1807
92 Ga0070684_100000443 3300005535 Bacteria 28390
93 Ga0070684_100004554 3300005535 Bacteria 10564
94 Ga0070684_100008847 3300005535 Bacteria 7896
95 Ga0068853_100006515 3300005539 Bacteria 9292
96 Ga0068853_100106307 3300005539 Bacteria 2487
97 Ga0070686_100166234 3300005544 Bacteria 1557
98 Ga0070665_100000001 3300005548 Bacteria 1083363
99 Ga0070665_100023532 3300005548 Bacteria 6202
100 Ga0068855_100000089 3300005563 Bacteria 110845
101 Ga0068855_100013922 3300005563 Bacteria 9701
102 Ga0068855_100070039 3300005563 Bacteria 4081
103 Ga0070664_100005313 3300005564 Bacteria 10331
104 Ga0070664_100042458 3300005564 Bacteria 3838
105 Ga0070664_100163416 3300005564 Bacteria 1971
106 Ga0068857_100005164 3300005577 Bacteria 11101
107 Ga0068857_100020778 3300005577 Bacteria 5776
108 Ga0068857_100259176 3300005577 Bacteria 1595
109 Ga0068856_100040959 3300005614 Bacteria 4551
110 Ga0068856_100068956 3300005614 Bacteria 3496
111 Ga0068856_100167880 3300005614 Bacteria 2206
112 Ga0068856_100209792 3300005614 Unclassified 1963
113 Ga0068852_100003650 3300005616 Bacteria 10781
114 Ga0068852_100009439 3300005616 Bacteria 7246
115 Ga0068852_100018147 3300005616 Bacteria 5538
116 Ga0068852_100042013 3300005616 Unclassified 3869
117 Ga0068859_100000100 3300005617 Bacteria 79844
118 Ga0068859_100001471 3300005617 Bacteria 24005
119 Ga0068859_100033120 3300005617 Bacteria 5190
120 Ga0068859_100250772 3300005617 Bacteria 1861
121 Ga0068859_100267612 3300005617 Unclassified 1801
122 Ga0068859_100281598 3300005617 Bacteria 1755
123 Ga0068864_100004900 3300005618 Bacteria 10966
124 Ga0068864_100037342 3300005618 Bacteria 4145
125 Ga0068864_100078151 3300005618 Bacteria 2895
126 Ga0068864_100169840 3300005618 Bacteria 1988
127 Ga0068861_100000225 3300005719 Bacteria 30713
128 Ga0068861_100001813 3300005719 Bacteria 13764
129 Ga0068861_100122608 3300005719 Bacteria 2099
130 Ga0068861_100153289 3300005719 Bacteria 1893
131 Ga0068851_10016501 3300005834 Bacteria 3534
132 Ga0068851_10059534 3300005834 Bacteria 1954
133 Ga0068863_100005412 3300005841 Bacteria 12587
134 Ga0068863_100015000 3300005841 Bacteria 7443
135 Ga0068863_100048920 3300005841 Bacteria 4009
136 Ga0068863_100117105 3300005841 Unclassified 2539
137 Ga0068858_100092421 3300005842 Bacteria 2816
138 Ga0068858_100381899 3300005842 Unclassified 1352
139 Ga0068860_100000111 3300005843 Bacteria 131004
140 Ga0068860_100000846 3300005843 Bacteria 34263
141 Ga0068860_100006347 3300005843 Bacteria 11865
142 Ga0068860_100007815 3300005843 Bacteria 10678
143 Ga0068860_100007843 3300005843 Bacteria 10655
144 Ga0068860_100009731 3300005843 Bacteria 9546
145 Ga0068860_100102438 3300005843 Bacteria 2732
146 Ga0068860_100109808 3300005843 Bacteria 2636
147 Ga0068862_100002891 3300005844 Bacteria 15027
148 Ga0068862_100245456 3300005844 Bacteria 1630
149 Ga0081540_1004465 3300005983 Bacteria 10652
150 Ga0081539_10000037 3300005985 Bacteria 296160
151 Ga0081539_10089725 3300005985 Bacteria 1591
152 Ga0075366_10015955 3300006195 Bacteria 4312
153 Ga0075366_10020734 3300006195 Bacteria 3815
154 Ga0075366_10052491 3300006195 Bacteria 2422
155 Ga0097621_100000063 3300006237 Bacteria 55571
156 Ga0097621_100008879 3300006237 Bacteria 7266
157 Ga0097621_100009982 3300006237 Bacteria 6920
158 Ga0097621_100027100 3300006237 Bacteria 4503
159 Ga0068871_100000952 3300006358 Bacteria 19348
160 Ga0068871_100015878 3300006358 Bacteria 5653
161 Ga0068871_100263512 3300006358 Unclassified 1504
162 Ga0075428_100003382 3300006844 Bacteria 17450
163 Ga0075428_100359513 3300006844 Bacteria 1562
164 Ga0075431_100020834 3300006847 Bacteria 6699
165 Ga0075429_100004591 3300006880 Bacteria 11873
166 Ga0068865_100223731 3300006881 Bacteria 1472
167 Ga0068865_100242369 3300006881 Bacteria 1419
168 Ga0097620_100000100 3300006931 Bacteria 79844
169 Ga0097620_100001471 3300006931 Bacteria 24005
170 Ga0097620_100033125 3300006931 Bacteria 5190
171 Ga0097620_100250786 3300006931 Bacteria 1861
172 Ga0097620_100267581 3300006931 Unclassified 1801
173 Ga0097620_100281597 3300006931 Bacteria 1755
174 Ga0105240_10000074 3300009093 Bacteria 199611
175 Ga0105240_10004146 3300009093 Bacteria 22202
176 Ga0105240_10009825 3300009093 Bacteria 13507
177 Ga0105240_10010395 3300009093 Bacteria 13080
178 Ga0105240_10017446 3300009093 Bacteria 9673
179 Ga0105240_10042382 3300009093 Bacteria 5800
180 Ga0105240_10065585 3300009093 Bacteria 4507
181 Ga0105240_10281859 3300009093 Bacteria 1909
182 Ga0105240_10488768 3300009093 Bacteria 1371
183 Ga0111539_10069907 3300009094 Bacteria 4145
184 Ga0105247_10001601 3300009101 Bacteria 16023
185 Ga0105247_10109234 3300009101 Bacteria 1778
186 Ga0105247_10182066 3300009101 Bacteria 1403
187 Ga0114129_10017306 3300009147 Bacteria 10263
188 Ga0114129_10264897 3300009147 Bacteria 2301
189 Ga0105243_10000025 3300009148 Bacteria 193732
190 Ga0105241_10000286 3300009174 Bacteria 37584
191 Ga0105241_10000674 3300009174 Bacteria 25718
192 Ga0105241_10017896 3300009174 Bacteria 5210
193 Ga0105242_10144388 3300009176 Bacteria 2069
194 Ga0105242_10168370 3300009176 Bacteria 1923
195 Ga0105248_10036134 3300009177 Bacteria 5526
196 Ga0105248_10329969 3300009177 Bacteria 1718
197 Ga0105237_10000528 3300009545 Bacteria 53756
198 Ga0105237_10005531 3300009545 Bacteria 14245
199 Ga0105237_10005745 3300009545 Bacteria 13938
200 Ga0105237_10009236 3300009545 Bacteria 10577
201 Ga0105237_10011435 3300009545 Bacteria 9389
202 Ga0105237_10018995 3300009545 Bacteria 7103
203 Ga0105237_10030026 3300009545 Bacteria 5522
204 Ga0105237_10069836 3300009545 Bacteria 3508
205 Ga0105238_10002521 3300009551 Bacteria 18308
206 Ga0105249_10002924 3300009553 Bacteria 14735
207 Ga0105249_10023429 3300009553 Bacteria 5540
208 Ga0105249_10032412 3300009553 Bacteria 4727
209 Ga0105249_10055349 3300009553 Bacteria 3628
210 Ga0105249_10097436 3300009553 Bacteria 2761
211 Ga0105239_10000048 3300010375 Bacteria 177855
212 Ga0105239_10000314 3300010375 Bacteria 71313
213 Ga0105239_10001973 3300010375 Bacteria 26693
214 Ga0105239_10044989 3300010375 Bacteria 4838
215 Ga0105239_10046042 3300010375 Bacteria 4779
216 Ga0105239_10079944 3300010375 Bacteria 3597
217 Ga0105239_10220684 3300010375 Unclassified 2126
218 Ga0157373_10005431 3300013100 Bacteria 9573
219 Ga0157373_10009939 3300013100 Bacteria 7011
220 Ga0157373_10013229 3300013100 Bacteria 6058
221 Ga0157373_10097498 3300013100 Unclassified 2070
222 Ga0157371_10038253 3300013102 Bacteria 3433
223 Ga0157371_10038895 3300013102 Bacteria 3402
224 Ga0157371_10048833 3300013102 Bacteria 3008
225 Ga0157371_10061630 3300013102 Unclassified 2659
226 Ga0157371_10077058 3300013102 Bacteria 2361
227 Ga0157370_10001963 3300013104 Bacteria 25346
228 Ga0157370_10024821 3300013104 Bacteria 5935
229 Ga0157370_10037282 3300013104 Bacteria 4713
230 Ga0157370_10083787 3300013104 Bacteria 2998
231 Ga0157369_10010269 3300013105 Bacteria 10682
232 Ga0157374_10000001 3300013296 Bacteria 1077351
233 Ga0157374_10198484 3300013296 Bacteria 1964
234 Ga0157374_10463402 3300013296 Bacteria 1269
235 Ga0157378_10025743 3300013297 Bacteria 5183
236 Ga0157378_10033102 3300013297 Bacteria 4569
237 Ga0157378_10051960 3300013297 Bacteria 3646
238 Ga0157378_10056720 3300013297 Bacteria 3491
239 Ga0157378_10125513 3300013297 Bacteria 2370
240 Ga0157378_10286243 3300013297 Unclassified 1590
241 Ga0157378_10401523 3300013297 Bacteria 1351
242 Ga0163162_10000101 3300013306 Bacteria 77114
243 Ga0163162_10000158 3300013306 Bacteria 62514
244 Ga0163162_10005078 3300013306 Bacteria 12676
245 Ga0163162_10008877 3300013306 Bacteria 9776
246 Ga0163162_10012192 3300013306 Bacteria 8390
247 Ga0163162_10057369 3300013306 Unclassified 3922
248 Ga0163162_10070287 3300013306 Bacteria 3552
249 Ga0163162_10091098 3300013306 Bacteria 3132
250 Ga0163162_10223498 3300013306 Bacteria 2012
251 Ga0163162_10335351 3300013306 Bacteria 1645
252 Ga0163162_10387968 3300013306 Bacteria 1529
253 Ga0163162_10592855 3300013306 Bacteria 1235
254 Ga0157372_10001128 3300013307 Bacteria 28999
255 Ga0157372_10040582 3300013307 Bacteria 5141
256 Ga0157372_10058956 3300013307 Bacteria 4292
257 Ga0157372_10085932 3300013307 Bacteria 3569
258 Ga0157372_10111690 3300013307 Bacteria 3131
259 Ga0157372_10196808 3300013307 Bacteria 2334
260 Ga0157372_10232205 3300013307 Unclassified 2139
261 Ga0157372_10330484 3300013307 Bacteria 1775
262 Ga0157375_10000228 3300013308 Bacteria 52278
263 Ga0157375_10009098 3300013308 Bacteria 8700
264 Ga0157375_10058807 3300013308 Bacteria 3805
265 Ga0157375_10071616 3300013308 Bacteria 3480
266 Ga0157375_10075797 3300013308 Bacteria 3389
267 Ga0157375_10171061 3300013308 Bacteria 2320
268 Ga0157375_10546949 3300013308 Bacteria 1320
269 Ga0163163_10002069 3300014325 Bacteria 16954
270 Ga0163163_10191362 3300014325 Bacteria 2094
271 Ga0157380_10002418 3300014326 Bacteria 12574
272 Ga0157380_10055241 3300014326 Bacteria 3153
273 Ga0157380_10137805 3300014326 Bacteria 2091
274 Ga0157380_10265741 3300014326 Bacteria 1561
275 Ga0157377_10000289 3300014745 Bacteria 23989
276 Ga0157379_10001931 3300014968 Bacteria 17146
277 Ga0157376_10000439 3300014969 Bacteria 26775
278 Ga0157376_10004247 3300014969 Bacteria 9945
279 Ga0157376_10010209 3300014969 Bacteria 6857
280 Ga0157376_10088300 3300014969 Bacteria 2678
281 Ga0182006_1019242 3300015261 Bacteria 2875
282 Ga0182005_1000450 3300015265 Bacteria 21827
283 Ga0163161_10084079 3300017792 Bacteria 2346
284 Ga0213876_10004814 3300021384 Bacteria 7491
285 Ga0209436_104925 3300025208 Bacteria 3197
286 Ga0209258_100293 3300025242 Bacteria 82199
287 Ga0209646_1000002 3300025246 Bacteria 1425781
288 Ga0209646_1002568 3300025246 Bacteria 3950
289 Ga0209026_1000524 3300025250 Bacteria 27023
290 Ga0209148_1000278 3300025254 Bacteria 79641
291 Ga0209673_1000530 3300025273 Bacteria 62542
292 Ga0209130_1003135 3300025284 Bacteria 7334
293 Ga0209564_1038777 3300025295 Bacteria 1320
294 Ga0209758_1007117 3300025297 Bacteria 7738
295 Ga0209758_1044976 3300025297 Bacteria 1607
296 Ga0209758_1059768 3300025297 Bacteria 1266
297 Ga0209050_1000134 3300025298 Bacteria 184417
298 Ga0207426_1000002 3300025302 Bacteria 1249660
299 Ga0207426_1000051 3300025302 Bacteria 391700
300 Ga0207426_1000841 3300025302 Bacteria 32428
301 Ga0207426_1001206 3300025302 Bacteria 22940
302 Ga0209257_1000001 3300025304 Bacteria 2274655
303 Ga0209257_1000023 3300025304 Bacteria 753019
304 Ga0209257_1001323 3300025304 Bacteria 30130
305 Ga0207697_10055201 3300025315 Bacteria 1647
306 Ga0207656_10041215 3300025321 Bacteria 1961
307 Ga0207682_10050505 3300025893 Bacteria 1719
308 Ga0207642_10009627 3300025899 Bacteria 3370
309 Ga0207710_10004709 3300025900 Bacteria 5917
310 Ga0207710_10055960 3300025900 Bacteria 1779
311 Ga0207680_10000648 3300025903 Bacteria 16407
312 Ga0207647_10000418 3300025904 Bacteria 34995
313 Ga0207647_10006021 3300025904 Bacteria 8838
314 Ga0207647_10025443 3300025904 Unclassified 3888
315 Ga0207645_10000545 3300025907 Bacteria 31363
316 Ga0207705_10076070 3300025909 Bacteria 2440
317 Ga0207654_10000259 3300025911 Bacteria 32195
318 Ga0207654_10001858 3300025911 Bacteria 10926
319 Ga0207654_10166830 3300025911 Bacteria 1426
320 Ga0207707_10126928 3300025912 Bacteria 2231
321 Ga0207695_10000071 3300025913 Bacteria 315568
322 Ga0207695_10000084 3300025913 Bacteria 282392
323 Ga0207695_10000323 3300025913 Bacteria 114265
324 Ga0207695_10003138 3300025913 Bacteria 23612
325 Ga0207695_10018788 3300025913 Bacteria 7977
326 Ga0207695_10119350 3300025913 Bacteria 2607
327 Ga0207671_10001584 3300025914 Bacteria 25863
328 Ga0207671_10001605 3300025914 Bacteria 25707
329 Ga0207671_10011203 3300025914 Bacteria 7318
330 Ga0207671_10011494 3300025914 Bacteria 7196
331 Ga0207671_10032210 3300025914 Bacteria 3902
332 Ga0207657_10010280 3300025919 Bacteria 9342
333 Ga0207657_10033005 3300025919 Bacteria 4670
334 Ga0207657_10166136 3300025919 Bacteria 1790
335 Ga0207657_10180556 3300025919 Bacteria 1706
336 Ga0207649_10002618 3300025920 Bacteria 9989
337 Ga0207649_10041340 3300025920 Bacteria 2806
338 Ga0207652_10000663 3300025921 Bacteria 33730
339 Ga0207694_10015117 3300025924 Bacteria 5820
340 Ga0207650_10015855 3300025925 Bacteria 5257
341 Ga0207650_10085240 3300025925 Bacteria 2403
342 Ga0207650_10099597 3300025925 Bacteria 2235
343 Ga0207659_10237693 3300025926 Bacteria 1472
344 Ga0207659_10255274 3300025926 Bacteria 1424
345 Ga0207690_10077456 3300025932 Bacteria 2311
346 Ga0207706_10006721 3300025933 Bacteria 10633
347 Ga0207706_10039880 3300025933 Bacteria 4163
348 Ga0207709_10000003 3300025935 Bacteria 1050072
349 Ga0207670_10061866 3300025936 Bacteria 2556
350 Ga0207691_10037596 3300025940 Bacteria 4483
351 Ga0207691_10100753 3300025940 Bacteria 2578
352 Ga0207711_10020151 3300025941 Bacteria 5558
353 Ga0207689_10000466 3300025942 Bacteria 37961
354 Ga0207689_10004619 3300025942 Bacteria 12455
355 Ga0207689_10010064 3300025942 Bacteria 8151
356 Ga0207689_10011747 3300025942 Bacteria 7507
357 Ga0207689_10045750 3300025942 Bacteria 3618
358 Ga0207689_10046166 3300025942 Bacteria 3601
359 Ga0207689_10070286 3300025942 Bacteria 2876
360 Ga0207689_10115264 3300025942 Bacteria 2209
361 Ga0207661_10000316 3300025944 Bacteria 30845
362 Ga0207661_10043325 3300025944 Bacteria 3552
363 Ga0207661_10070749 3300025944 Bacteria 2849
364 Ga0207661_10082183 3300025944 Bacteria 2663
365 Ga0207679_10003340 3300025945 Bacteria 9910
366 Ga0207679_10155272 3300025945 Unclassified 1868
367 Ga0207679_10288256 3300025945 Bacteria 1410
368 Ga0207667_10000135 3300025949 Bacteria 111565
369 Ga0207667_10000177 3300025949 Bacteria 92852
370 Ga0207667_10013971 3300025949 Bacteria 9172
371 Ga0207651_10029174 3300025960 Bacteria 3492
372 Ga0207651_10123729 3300025960 Bacteria 1967
373 Ga0207651_10130679 3300025960 Bacteria 1922
374 Ga0207712_10002096 3300025961 Bacteria 13067
375 Ga0207712_10002540 3300025961 Bacteria 11739
376 Ga0207712_10017094 3300025961 Bacteria 4706
377 Ga0207712_10023201 3300025961 Bacteria 4092
378 Ga0207668_10012966 3300025972 Bacteria 5122
379 Ga0207658_10093946 3300025986 Bacteria 2333
380 Ga0207677_10030784 3300026023 Unclassified 3430
381 Ga0207677_10214345 3300026023 Bacteria 1540
382 Ga0207703_10006506 3300026035 Bacteria 9328
383 Ga0207639_10016908 3300026041 Bacteria 5168
384 Ga0207639_10050695 3300026041 Bacteria 3153
385 Ga0207639_10063181 3300026041 Bacteria 2866
386 Ga0207639_10125924 3300026041 Bacteria 2113
387 Ga0207639_10199881 3300026041 Bacteria 1713
388 Ga0207702_10180253 3300026078 Bacteria 1945
389 Ga0207702_10241122 3300026078 Unclassified 1694
390 Ga0207702_10274960 3300026078 Bacteria 1590
391 Ga0207641_10001151 3300026088 Bacteria 26569
392 Ga0207641_10007016 3300026088 Bacteria 9416
393 Ga0207641_10037350 3300026088 Bacteria 4056
394 Ga0207641_10179710 3300026088 Unclassified 1937
395 Ga0207641_10221017 3300026088 Bacteria 1756
396 Ga0207648_10006809 3300026089 Bacteria 11325
397 Ga0207648_10009817 3300026089 Bacteria 9141
398 Ga0207676_10005000 3300026095 Bacteria 9389
399 Ga0207676_10167621 3300026095 Bacteria 1910
400 Ga0207674_10000854 3300026116 Bacteria 39788
401 Ga0207674_10003870 3300026116 Bacteria 18250
402 Ga0207674_10025545 3300026116 Bacteria 6296
403 Ga0207674_10052730 3300026116 Bacteria 4147
404 Ga0207675_100000386 3300026118 Bacteria 42305
405 Ga0207675_100007652 3300026118 Bacteria 10201
406 Ga0207683_10005186 3300026121 Bacteria 11188
407 Ga0207683_10019980 3300026121 Bacteria 5722
408 Ga0207683_10047043 3300026121 Bacteria 3778
409 Ga0207683_10318198 3300026121 Unclassified 1425
410 Ga0207698_10007891 3300026142 Bacteria 6702
411 Ga0207698_10056506 3300026142 Bacteria 3031
412 Ga0207698_10060559 3300026142 Bacteria 2944
413 Ga0268266_10000049 3300028379 Bacteria 307763
414 Ga0268265_10011436 3300028380 Bacteria 5999
415 Ga0268265_10120843 3300028380 Unclassified 2158
416 Ga0268264_10000313 3300028381 Bacteria 77820
417 Ga0268264_10001221 3300028381 Bacteria 24720
418 Ga0268264_10003143 3300028381 Bacteria 14302
419 Ga0268264_10003175 3300028381 Bacteria 14234
420 Ga0268264_10003379 3300028381 Bacteria 13782
421 Ga0268264_10034103 3300028381 Bacteria 4185
422 Ga0307515_10000002 3300028794 Bacteria 1231751
423 Ga0307511_10000042 3300030521 Bacteria 102114
424 Ga0316177_1065037 3300030731 Bacteria 15063
425 Ga0316176_1059625 3300030732 Bacteria 4872
426 Ga0316183_1106482 3300030742 Bacteria 31361
427 Ga0316181_1079013 3300030744 Bacteria 1212
428 Ga0316181_1079031 3300030744 Bacteria 1212
429 Ga0265327_10000168 3300031251 Bacteria 141392
430 Ga0265327_10000531 3300031251 Bacteria 65562
431 Ga0265327_10005050 3300031251 Bacteria 11274
432 Ga0265316_10131527 3300031344 Unclassified 1884
433 Ga0307513_10046519 3300031456 Bacteria 4729
434 Ga0307513_10101547 3300031456 Bacteria 2898
435 Ga0307509_10046584 3300031507 Bacteria 4668
436 Ga0307509_10077295 3300031507 Bacteria 3452
437 Ga0307509_10311188 3300031507 Bacteria 1317
438 Ga0307508_10000923 3300031616 Bacteria 34113
439 Ga0265342_10027866 3300031712 Bacteria 3524
440 Ga0316576_10118081 3300031727 Bacteria 1991
441 Ga0307516_10001770 3300031730 Bacteria 29691
442 Ga0307518_10150604 3300031838 Bacteria 1610
443 Ga0307410_10141454 3300031852 Bacteria 1781
444 Ga0307412_10000029 3300031911 Bacteria 209074
445 Ga0307414_10003311 3300032004 Bacteria 8590
446 Ga0307414_10013799 3300032004 Bacteria 4821
447 Ga0307414_10029758 3300032004 Bacteria 3559
448 Ga0307414_10035397 3300032004 Bacteria 3322
449 Ga0307414_10131792 3300032004 Bacteria 1942
450 Ga0307415_100074531 3300032126 Bacteria 2399
451 Ga0307507_10083163 3300033179 Bacteria 2801
452 Ga0307510_10000091 3300033180 Bacteria 68694
453 Ga0373935_0202456 3300035692 Bacteria 1372
454 Ga0373927_0023032 3300035695 Bacteria 4080
455 Ga0395900_0054281 3300037418 Bacteria 4126
456 Ga0395900_0236344 3300037418 Bacteria 1835
457 Ga0395898_0066231 3300037466 Bacteria 3501
458 Ga0395905_0002545 3300037471 Bacteria 20113
459 Ga0395905_0086853 3300037471 Bacteria 2932
460 Ga0395905_0192301 3300037471 Bacteria 1914
461 Ga0395901_0249571 3300038443 Bacteria 1849
462 Ga0436365_0145209 3300039437 Bacteria 10292
463 Ga0436365_0396402 3300039437 Bacteria 1673
464 Ga0436363_1490087 3300039450 Bacteria 1511
465 Ga0439431_0000679 3300041997 Bacteria 7296
466 Ga0439431_0004552 3300041997 Bacteria 3048
467 Ga0439457_000560 3300042014 Bacteria 10851
468 Ga0439457_012398 3300042014 Bacteria 1922
469 Ga0450894_006180 3300042131 Bacteria 1547
470 Ga0450898_003560 3300042134 Bacteria 2246
471 Ga0439434_0000955 3300042435 Bacteria 8334
472 Ga0451577_0032206 3300042876 Unclassified 4724
473 Ga0451577_0082190 3300042876 Unclassified 2873
474 Ga0451577_0185411 3300042876 Unclassified 1876
475 Ga0451577_0299599 3300042876 Bacteria 1457
476 Ga0466969_0001246 3300044656 Bacteria 13732
477 Ga0466969_0052312 3300044656 Bacteria 2007
478 Ga0466972_0000003 3300044658 Bacteria 391452
479 Ga0466972_0000013 3300044658 Bacteria 229345
480 Ga0466972_0010132 3300044658 Bacteria 4735
481 Ga0466972_0049834 3300044658 Bacteria 2022
482 Ga0453683_0049421 3300044673 Bacteria 2636
483 Ga0453683_0179870 3300044673 Bacteria 1341
484 Ga0466966_0000045 3300044684 Bacteria 92504
485 Ga0466961_0107579 3300044693 Bacteria 1755
486 Ga0453684_0000557 3300044712 Bacteria 140566
487 Ga0453684_0006063 3300044712 Bacteria 23362
488 Ga0453684_0066495 3300044712 Bacteria 4589
489 Ga0453684_0103123 3300044712 Bacteria 3486
490 Ga0453684_0131105 3300044712 Bacteria 3007
491 Ga0453684_0210519 3300044712 Bacteria 2260
492 Ga0453684_0291321 3300044712 Unclassified 1859
493 Ga0466968_0022253 3300044735 Bacteria 2576
494 Ga0466970_0000561 3300044765 Bacteria 18151
495 Ga0466970_0075033 3300044765 Unclassified 1821
496 Ga0466970_0136183 3300044765 Bacteria 1351
497 Ga0466957_0000070 3300044842 Bacteria 39824
498 Ga0466957_0012809 3300044842 Bacteria 4860
499 Ga0466960_0018563 3300044901 Bacteria 3051
500 Ga0466959_0000023 3300045049 Bacteria 124545
501 Ga0466959_0002572 3300045049 Bacteria 11650
502 Ga0451576_0000375 3300045051 Bacteria 105551
503 Ga0451576_0008513 3300045051 Bacteria 12031
504 Ga0451576_0034344 3300045051 Bacteria 5387
505 Ga0451576_0045643 3300045051 Bacteria 4614
506 Ga0451576_0058216 3300045051 Bacteria 4038
507 Ga0451576_0064794 3300045051 Bacteria 3806
508 Ga0466958_0035010 3300045836 Unclassified 2999
509 Ga0495627_015663 3300046453 Bacteria 2612
510 Ga0495638_0026796 3300046460 Bacteria 3735
511 Ga0495638_0037051 3300046460 Bacteria 3104
512 Ga0495653_0109865 3300046463 Bacteria 1984
513 Ga0495606_0004249 3300046507 Bacteria 14482
514 Ga0495643_0083420 3300046522 Bacteria 1659
515 Ga0495648_0003927 3300046524 Bacteria 12869
516 Ga0495633_0000090 3300046558 Bacteria 122693
517 Ga0495668_0001773 3300046616 Bacteria 19717
518 Ga0495611_0001562 3300046648 Bacteria 11215
519 Ga0495672_0008093 3300047320 Bacteria 7808
520 Ga0495672_0019793 3300047320 Bacteria 4429
521 Ga0495672_0021888 3300047320 Bacteria 4164
522 Ga0495687_000001 3300047443 Bacteria 1215582
523 Ga0495686_0000004 3300047472 Bacteria 869019
524 Ga0495686_0004044 3300047472 Bacteria 12257
525 Ga0495686_0009844 3300047472 Bacteria 6852
526 Ga0495686_0061888 3300047472 Bacteria 2323
527 Ga0496108_0304395 3300048911 Bacteria 1389
528 Ga0496110_0170720 3300048913 Unclassified 1973
529 Ga0496117_0024737 3300048920 Bacteria 4737
530 Ga0496118_0077022 3300048921 Bacteria 2367
531 Ga0496121_0000020 3300048924 Bacteria 498732
532 Ga0496122_0009224 3300048925 Bacteria 10442
533 Ga0496123_0015993 3300048926 Bacteria 6118
534 Ga0496124_0189179 3300048927 Bacteria 1577
535 Ga0496125_0142252 3300048928 Bacteria 1666
536 Ga0496126_0097477 3300048929 Bacteria 2577
537 Ga0501298_000128 3300049521 Bacteria 9130
538 Ga0501031_0003126 3300049568 Bacteria 10612
539 Ga0501032_0022746 3300049569 Bacteria 4343
540 Ga0501032_0069981 3300049569 Unclassified 2341
541 Ga0501034_0009134 3300049571 Bacteria 10404
542 Ga0501034_0047612 3300049571 Bacteria 4329
543 Ga0501034_0076100 3300049571 Bacteria 3363
544 Ga0501034_0153208 3300049571 Bacteria 2280
545 Ga0501036_0012338 3300049572 Bacteria 7075
546 Ga0501036_0104638 3300049572 Bacteria 2393
547 Ga0501037_0031631 3300049573 Bacteria 3908
548 Ga0501038_0006153 3300049574 Bacteria 11107
549 Ga0501039_0069358 3300049575 Bacteria 2738
550 Ga0501039_0071405 3300049575 Bacteria 2697
551 Ga0501043_0008310 3300049579 Bacteria 8174
552 Ga0501043_0020032 3300049579 Bacteria 5250
553 Ga0501046_0026464 3300049580 Bacteria 4738
554 Ga0501047_0021771 3300049581 Bacteria 6155
555 Ga0501047_0119517 3300049581 Bacteria 2517
556 Ga0501198_001286 3300049649 Bacteria 3252
557 Ga0501202_000044 3300049652 Bacteria 12530
558 Ga0501207_003913 3300049654 Bacteria 2008
559 Ga0501222_000252 3300049662 Bacteria 9061
560 Ga0501223_000493 3300049663 Bacteria 9571
561 Ga0501224_000255 3300049664 Bacteria 6088
562 Ga0501233_002221 3300049668 Bacteria 3401
563 Ga0501235_000488 3300049669 Bacteria 7877
564 Ga0501242_000805 3300049674 Bacteria 2937
565 Ga0501259_000401 3300049688 Bacteria 6869
566 Ga0501219_000027 3300049703 Bacteria 23249
567 Ga0501221_000844 3300049704 Bacteria 4999
568 Ga0501225_0000846 3300049705 Bacteria 9521
569 Ga0501225_0016895 3300049705 Bacteria 2028
570 Ga0501245_000641 3300049708 Bacteria 4316
571 Ga0501080_0011972 3300049742 Bacteria 7945
572 Ga0501241_014825 3300049758 Bacteria 1417
573 Ga0501271_000609 3300049768 Bacteria 3083
574 Ga0501280_014334 3300049776 Bacteria 1128
575 Ga0501035_0024149 3300049822 Bacteria 5577
576 Ga0501044_0003348 3300049823 Bacteria 18071
577 Ga0501044_0008339 3300049823 Bacteria 11357
578 Ga0501044_0042041 3300049823 Bacteria 4757
579 Ga0501044_0056459 3300049823 Bacteria 4032
580 Ga0501044_0059938 3300049823 Bacteria 3899
581 Ga0501044_0103977 3300049823 Bacteria 2854
582 Ga0501284_00021 3300050005 Bacteria 89729
583 nmdc:mga0k408_26104_c1 3300050493 Bacteria 3311
584 nmdc:mga0k408_40490_c1 3300050493 Bacteria 2681
585 nmdc:mga0k408_4623_c1 3300050493 Bacteria 7296
586 nmdc:mga05p37_12189_c1 3300050507 Bacteria 10264
587 nmdc:mga09592_3366_c1 3300050508 Bacteria 12924
588 nmdc:mga08y16_13394_c1 3300050511 Bacteria 8626
589 nmdc:mga0n895_172750_c1 3300050512 Bacteria 2193
590 Ga0500578_0001147 3300053086 Bacteria 28253
591 Ga0500644_0000119 3300053088 Bacteria 49309
592 Ga0500646_0016476 3300053090 Bacteria 1930
593 Ga0500583_0000108 3300053092 Bacteria 41760
594 Ga0500583_0000870 3300053092 Bacteria 8703
595 Ga0500651_0000635 3300053093 Bacteria 17479
596 Ga0500651_0015723 3300053093 Bacteria 4650
597 Ga0500562_000138 3300053108 Bacteria 21490
598 Ga0500562_002256 3300053108 Bacteria 4819
599 Ga0500569_000066 3300053109 Bacteria 17371
600 Ga0500652_016558 3300053131 Bacteria 2686
601 Ga0500658_0004173 3300053134 Bacteria 5425
602 Ga0500559_0061405 3300053136 Bacteria 1676
603 Ga0500568_0000306 3300053139 Bacteria 39150
604 Ga0500604_0000265 3300053151 Bacteria 14657
605 Ga0500616_0014645 3300053153 Bacteria 4500
606 Ga0500622_0000929 3300053156 Bacteria 24916
607 Ga0500622_0002384 3300053156 Bacteria 13622
608 Ga0500622_0002452 3300053156 Bacteria 13375
609 Ga0500633_0010972 3300053160 Bacteria 2445
610 Ga0500634_0040806 3300053161 Bacteria 2522
611 Ga0500637_0073188 3300053178 Bacteria 1973
612 Ga0500611_000028 3300053727 Bacteria 93696
613 Ga0500645_003971 3300053730 Bacteria 5819
614 Ga0500661_001909 3300055283 Bacteria 3932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049776 Ga0501280_014334 Ga0501280_014334_83_1009 307
2 3300026121 Ga0207683_10318198 Ga0207683_103181981 310
3 3300006881 Ga0068865_100242369 Ga0068865_1002423691 325
4 3300053160 Ga0500633_0010972 Ga0500633_0010972_35_1054 339
5 3300003794 Ga0055531_10000235 Ga0055531_1000023518 354
6 3300025304 Ga0209257_1000023 Ga0209257_1000023129 354
7 3300037471 Ga0395905_0192301 Ga0395905_0192301_834_1904 355
8 3300003322 rootL2_10033506 rootL2_100335062 356
9 3300005288 Ga0065714_10003245 Ga0065714_1000324510 360
10 3300005340 Ga0070689_100085924 Ga0070689_1000859242 360
11 3300013296 Ga0157374_10463402 Ga0157374_104634021 360
12 3300013306 Ga0163162_10057369 Ga0163162_100573692 360
13 3300005618 Ga0068864_100078151 Ga0068864_1000781512 361
14 3300026095 Ga0207676_10167621 Ga0207676_101676212 361
15 3300044765 Ga0466970_0136183 Ga0466970_0136183_34_1119 361
16 3300005459 Ga0068867_100021159 Ga0068867_1000211594 362
17 3300026089 Ga0207648_10006809 Ga0207648_100068093 362
18 3300005843 Ga0068860_100109808 Ga0068860_1001098082 365
19 3300005365 Ga0070688_100027767 Ga0070688_1000277673 367
20 3300006844 Ga0075428_100359513 Ga0075428_1003595132 367
21 3300013308 Ga0157375_10546949 Ga0157375_105469492 367
22 3300048913 Ga0496110_0170720 Ga0496110_0170720_25_1182 367
23 3300005329 Ga0070683_100006858 Ga0070683_1000068586 368
24 3300005337 Ga0070682_100045252 Ga0070682_1000452522 368
25 3300005458 Ga0070681_10098929 Ga0070681_100989293 368
26 3300005530 Ga0070679_100008640 Ga0070679_1000086405 368
27 3300005530 Ga0070679_100011686 Ga0070679_1000116867 368
28 3300005564 Ga0070664_100163416 Ga0070664_1001634162 368
29 3300005616 Ga0068852_100018147 Ga0068852_1000181475 368
30 3300005618 Ga0068864_100037342 Ga0068864_1000373422 368
31 3300005843 Ga0068860_100009731 Ga0068860_1000097314 368
32 3300010375 Ga0105239_10220684 Ga0105239_102206842 368
33 3300013100 Ga0157373_10097498 Ga0157373_100974982 368
34 3300013102 Ga0157371_10061630 Ga0157371_100616302 368
35 3300013306 Ga0163162_10008877 Ga0163162_100088773 368
36 3300013307 Ga0157372_10232205 Ga0157372_102322052 368
37 3300025909 Ga0207705_10076070 Ga0207705_100760702 368
38 3300025919 Ga0207657_10033005 Ga0207657_100330053 368
39 3300025944 Ga0207661_10070749 Ga0207661_100707493 368
40 3300028381 Ga0268264_10003379 Ga0268264_100033797 368
41 3300005337 Ga0070682_100091199 Ga0070682_1000911992 369
42 3300005366 Ga0070659_100009963 Ga0070659_1000099637 369
43 3300005535 Ga0070684_100000443 Ga0070684_10000044319 369
44 3300025920 Ga0207649_10002618 Ga0207649_100026183 369
45 3300025944 Ga0207661_10000316 Ga0207661_1000031616 369
46 3300025945 Ga0207679_10003340 Ga0207679_100033402 369
47 3300026041 Ga0207639_10016908 Ga0207639_100169084 369
48 3300026116 Ga0207674_10000854 Ga0207674_100008547 369
49 3300003322 rootL2_10061218 rootL2_100612183 370
50 3300005330 Ga0070690_100022209 Ga0070690_1000222094 370
51 3300005335 Ga0070666_10113667 Ga0070666_101136672 370
52 3300005338 Ga0068868_100025719 Ga0068868_1000257194 370
53 3300005339 Ga0070660_100169369 Ga0070660_1001693692 370
54 3300005355 Ga0070671_100098288 Ga0070671_1000982883 370
55 3300005364 Ga0070673_100128020 Ga0070673_1001280202 370
56 3300005457 Ga0070662_100016887 Ga0070662_1000168875 370
57 3300005544 Ga0070686_100166234 Ga0070686_1001662342 370
58 3300006237 Ga0097621_100027100 Ga0097621_1000271002 370
59 3300009176 Ga0105242_10144388 Ga0105242_101443882 370
60 3300013296 Ga0157374_10198484 Ga0157374_101984841 370
61 3300013306 Ga0163162_10091098 Ga0163162_100910982 370
62 3300013308 Ga0157375_10009098 Ga0157375_100090986 370
63 3300014325 Ga0163163_10191362 Ga0163163_101913622 370
64 3300014969 Ga0157376_10088300 Ga0157376_100883003 370
65 3300017792 Ga0163161_10084079 Ga0163161_100840792 370
66 3300025942 Ga0207689_10115264 Ga0207689_101152642 370
67 3300025960 Ga0207651_10123729 Ga0207651_101237291 370
68 3300026121 Ga0207683_10019980 Ga0207683_100199802 370
69 3300046463 Ga0495653_0109865 Ga0495653_0109865_790_1959 370
70 3300050512 nmdc:mga0n895_172750_c1 nmdc:mga0n895_172750_c1_56_1225 370
71 3300005355 Ga0070671_100218802 Ga0070671_1002188021 371
72 3300013297 Ga0157378_10286243 Ga0157378_102862432 371
73 3300013307 Ga0157372_10001128 Ga0157372_1000112822 371
74 3300025945 Ga0207679_10155272 Ga0207679_101552722 371
75 3300026088 Ga0207641_10179710 Ga0207641_101797102 371
76 3300032004 Ga0307414_10013799 Ga0307414_100137994 371
77 3300005331 Ga0070670_100204713 Ga0070670_1002047132 372
78 3300005471 Ga0070698_100038442 Ga0070698_1000384425 372
79 3300003322 rootL2_10040567 rootL2_100405672 373
80 3300005329 Ga0070683_100065555 Ga0070683_1000655552 373
81 3300005340 Ga0070689_100193106 Ga0070689_1001931062 373
82 3300005365 Ga0070688_100059983 Ga0070688_1000599831 373
83 3300005564 Ga0070664_100042458 Ga0070664_1000424582 373
84 3300005841 Ga0068863_100117105 Ga0068863_1001171052 373
85 3300005842 Ga0068858_100381899 Ga0068858_1003818992 373
86 3300006195 Ga0075366_10020734 Ga0075366_100207342 373
87 3300006195 Ga0075366_10052491 Ga0075366_100524913 373
88 3300009093 Ga0105240_10065585 Ga0105240_100655854 373
89 3300009101 Ga0105247_10182066 Ga0105247_101820661 373
90 3300009147 Ga0114129_10264897 Ga0114129_102648972 373
91 3300009545 Ga0105237_10005745 Ga0105237_1000574513 373
92 3300009553 Ga0105249_10097436 Ga0105249_100974361 373
93 3300013308 Ga0157375_10071616 Ga0157375_100716163 373
94 3300025936 Ga0207670_10061866 Ga0207670_100618662 373
95 3300025944 Ga0207661_10043325 Ga0207661_100433253 373
96 3300025961 Ga0207712_10017094 Ga0207712_100170944 373
97 3300050493 nmdc:mga0k408_26104_c1 nmdc:mga0k408_26104_c1_1187_2362 373
98 3300050493 nmdc:mga0k408_4623_c1 nmdc:mga0k408_4623_c1_941_2101 373
99 3300005337 Ga0070682_100009946 Ga0070682_1000099464 374
100 3300005340 Ga0070689_100122795 Ga0070689_1001227952 374
101 3300005617 Ga0068859_100281598 Ga0068859_1002815982 374
102 3300006931 Ga0097620_100281597 Ga0097620_1002815972 374
103 3300025940 Ga0207691_10100753 Ga0207691_101007532 374
104 3300031251 Ga0265327_10000168 Ga0265327_10000168117 374
105 3300048911 Ga0496108_0304395 Ga0496108_0304395_46_1209 374
106 3300009553 Ga0105249_10055349 Ga0105249_100553493 375
107 3300013105 Ga0157369_10010269 Ga0157369_100102692 375
108 3300025961 Ga0207712_10002540 Ga0207712_100025403 375
109 3300042876 Ga0451577_0299599 Ga0451577_0299599_14_1180 375
110 iso_pu_bacteria 2738543023 2739301609 375
111 iso_pu_bacteria 2919186247 2919186653 375
112 iso_pu_bacteria 2939664404 2939666077 375
113 3300005338 Ga0068868_100010161 Ga0068868_1000101617 376
114 3300005340 Ga0070689_100034428 Ga0070689_1000344282 376
115 3300005366 Ga0070659_100225285 Ga0070659_1002252851 376
116 3300005834 Ga0068851_10059534 Ga0068851_100595342 376
117 3300013104 Ga0157370_10037282 Ga0157370_100372825 376
118 3300013297 Ga0157378_10056720 Ga0157378_100567204 376
119 3300025321 Ga0207656_10041215 Ga0207656_100412151 376
120 3300026088 Ga0207641_10221017 Ga0207641_102210172 376
121 3300044712 Ga0453684_0210519 Ga0453684_0210519_743_1897 376
122 3300049521 Ga0501298_000128 Ga0501298_000128_4754_5887 376
123 3300005295 Ga0065707_10111468 Ga0065707_101114682 377
124 3300005334 Ga0068869_100064007 Ga0068869_1000640072 377
125 3300025942 Ga0207689_10046166 Ga0207689_100461662 377
126 3300028380 Ga0268265_10120843 Ga0268265_101208432 377
127 3300031911 Ga0307412_10000029 Ga0307412_1000002962 377
128 3300032004 Ga0307414_10035397 Ga0307414_100353972 377
129 3300003320 rootH2_10020409 rootH2_100204096 378
130 3300005614 Ga0068856_100040959 Ga0068856_1000409592 378
131 3300026078 Ga0207702_10180253 Ga0207702_101802532 378
132 iso_pu_bacteria 2738541278 2738726358 378
133 3300003316 rootH1_10050638 rootH1_100506382 379
134 3300003322 rootL2_10042558 rootL2_100425582 379
135 3300005539 Ga0068853_100006515 Ga0068853_1000065156 379
136 3300005563 Ga0068855_100070039 Ga0068855_1000700392 379
137 3300005577 Ga0068857_100020778 Ga0068857_1000207784 379
138 3300005614 Ga0068856_100167880 Ga0068856_1001678802 379
139 3300005614 Ga0068856_100209792 Ga0068856_1002097922 379
140 3300005616 Ga0068852_100003650 Ga0068852_1000036502 379
141 3300005843 Ga0068860_100000846 Ga0068860_10000084622 379
142 3300009093 Ga0105240_10000074 Ga0105240_1000007489 379
143 3300009093 Ga0105240_10004146 Ga0105240_1000414611 379
144 3300009093 Ga0105240_10009825 Ga0105240_100098254 379
145 3300009093 Ga0105240_10010395 Ga0105240_100103954 379
146 3300009093 Ga0105240_10017446 Ga0105240_1001744610 379
147 3300009093 Ga0105240_10042382 Ga0105240_100423824 379
148 3300009174 Ga0105241_10000286 Ga0105241_1000028615 379
149 3300009545 Ga0105237_10005531 Ga0105237_100055314 379
150 3300009545 Ga0105237_10011435 Ga0105237_100114354 379
151 3300009545 Ga0105237_10069836 Ga0105237_100698363 379
152 3300009551 Ga0105238_10002521 Ga0105238_100025217 379
153 3300010375 Ga0105239_10001973 Ga0105239_100019733 379
154 3300010375 Ga0105239_10044989 Ga0105239_100449893 379
155 3300013104 Ga0157370_10024821 Ga0157370_100248216 379
156 3300013296 Ga0157374_10000001 Ga0157374_10000001253 379
157 3300014969 Ga0157376_10010209 Ga0157376_100102096 379
158 3300025904 Ga0207647_10006021 Ga0207647_100060216 379
159 3300025911 Ga0207654_10000259 Ga0207654_1000025911 379
160 3300025911 Ga0207654_10166830 Ga0207654_101668301 379
161 3300025913 Ga0207695_10000084 Ga0207695_10000084179 379
162 3300025913 Ga0207695_10000323 Ga0207695_1000032329 379
163 3300025913 Ga0207695_10003138 Ga0207695_1000313814 379
164 3300025913 Ga0207695_10018788 Ga0207695_100187886 379
165 3300025914 Ga0207671_10001584 Ga0207671_1000158419 379
166 3300025914 Ga0207671_10032210 Ga0207671_100322104 379
167 3300025919 Ga0207657_10166136 Ga0207657_101661362 379
168 3300025924 Ga0207694_10015117 Ga0207694_100151175 379
169 3300025949 Ga0207667_10000135 Ga0207667_1000013536 379
170 3300026041 Ga0207639_10050695 Ga0207639_100506952 379
171 3300026078 Ga0207702_10241122 Ga0207702_102411222 379
172 3300026078 Ga0207702_10274960 Ga0207702_102749601 379
173 3300026116 Ga0207674_10003870 Ga0207674_100038704 379
174 3300026142 Ga0207698_10060559 Ga0207698_100605592 379
175 3300028381 Ga0268264_10001221 Ga0268264_1000122112 379
176 3300033180 Ga0307510_10000091 Ga0307510_1000009162 379
177 3300044658 Ga0466972_0010132 Ga0466972_0010132_968_2197 379
178 3300044712 Ga0453684_0006063 Ga0453684_0006063_16318_17490 379
179 3300044735 Ga0466968_0022253 Ga0466968_0022253_919_2148 379
180 3300044765 Ga0466970_0075033 Ga0466970_0075033_202_1368 379
181 3300047472 Ga0495686_0061888 Ga0495686_0061888_1100_2263 379
182 3300049649 Ga0501198_001286 Ga0501198_001286_1583_2725 379
183 iso_pu_bacteria 2739367866 2740032054 379
184 iso_pu_bacteria 2775506987 2776612212 379
185 iso_pu_bacteria 2818991444 2819590765 379
186 3300005563 Ga0068855_100013922 Ga0068855_1000139228 380
187 3300005614 Ga0068856_100068956 Ga0068856_1000689562 380
188 3300009093 Ga0105240_10281859 Ga0105240_102818591 380
189 3300009545 Ga0105237_10009236 Ga0105237_100092367 380
190 3300010375 Ga0105239_10046042 Ga0105239_100460422 380
191 3300025913 Ga0207695_10119350 Ga0207695_101193502 380
192 3300025914 Ga0207671_10011203 Ga0207671_100112032 380
193 3300025949 Ga0207667_10013971 Ga0207667_100139717 380
194 3300031507 Ga0307509_10046584 Ga0307509_100465843 380
195 3300044842 Ga0466957_0000070 Ga0466957_0000070_36396_37598 380
196 3300053086 Ga0500578_0001147 Ga0500578_0001147_18560_19762 380
197 iso_pu_bacteria 2896317667 2896317673 380
198 iso_pu_bacteria 3003233435 3003236448 380
199 3300005327 Ga0070658_10063511 Ga0070658_100635112 381
200 3300005343 Ga0070687_100041952 Ga0070687_1000419522 381
201 3300005458 Ga0070681_10006155 Ga0070681_100061555 381
202 3300009545 Ga0105237_10000528 Ga0105237_100005288 381
203 3300013100 Ga0157373_10005431 Ga0157373_100054314 381
204 3300013100 Ga0157373_10009939 Ga0157373_100099394 381
205 3300013102 Ga0157371_10038895 Ga0157371_100388953 381
206 3300015261 Ga0182006_1019242 Ga0182006_10192422 381
207 3300025904 Ga0207647_10025443 Ga0207647_100254433 381
208 3300025914 Ga0207671_10001605 Ga0207671_1000160521 381
209 3300025921 Ga0207652_10000663 Ga0207652_1000066318 381
210 3300031251 Ga0265327_10000531 Ga0265327_1000053141 381
211 3300032004 Ga0307414_10003311 Ga0307414_100033112 381
212 3300037418 Ga0395900_0236344 Ga0395900_0236344_16_1194 381
213 3300038443 Ga0395901_0249571 Ga0395901_0249571_623_1801 381
214 3300047472 Ga0495686_0000004 Ga0495686_0000004_380178_381359 381
215 3300053093 Ga0500651_0000635 Ga0500651_0000635_14114_15268 381
216 3300053108 Ga0500562_002256 Ga0500562_002256_2806_3960 381
217 iso_pu_bacteria 2842903701 2842904782 381
218 3300003316 rootH1_10169229 rootH1_101692292 382
219 3300003320 rootH2_10030789 rootH2_1003078925 382
220 3300003323 rootH1_10000019 rootH1_1000001921 382
221 3300005329 Ga0070683_100016743 Ga0070683_1000167434 382
222 3300005335 Ga0070666_10014917 Ga0070666_100149172 382
223 3300005344 Ga0070661_100001301 Ga0070661_10000130114 382
224 3300005354 Ga0070675_100095460 Ga0070675_1000954602 382
225 3300005355 Ga0070671_100170246 Ga0070671_1001702461 382
226 3300005366 Ga0070659_100014216 Ga0070659_1000142163 382
227 3300005457 Ga0070662_100012250 Ga0070662_1000122505 382
228 3300005458 Ga0070681_10095387 Ga0070681_100953871 382
229 3300005458 Ga0070681_10186665 Ga0070681_101866652 382
230 3300005530 Ga0070679_100231532 Ga0070679_1002315322 382
231 3300005535 Ga0070684_100004554 Ga0070684_10000455411 382
232 3300005535 Ga0070684_100008847 Ga0070684_1000088477 382
233 3300005548 Ga0070665_100000001 Ga0070665_100000001672 382
234 3300005563 Ga0068855_100000089 Ga0068855_10000008933 382
235 3300005564 Ga0070664_100005313 Ga0070664_10000531313 382
236 3300005841 Ga0068863_100015000 Ga0068863_1000150006 382
237 3300005983 Ga0081540_1004465 Ga0081540_10044658 382
238 3300006237 Ga0097621_100008879 Ga0097621_1000088797 382
239 3300006237 Ga0097621_100009982 Ga0097621_1000099823 382
240 3300006358 Ga0068871_100015878 Ga0068871_1000158784 382
241 3300006881 Ga0068865_100223731 Ga0068865_1002237312 382
242 3300009147 Ga0114129_10017306 Ga0114129_100173063 382
243 3300009545 Ga0105237_10030026 Ga0105237_100300266 382
244 3300010375 Ga0105239_10000048 Ga0105239_1000004847 382
245 3300010375 Ga0105239_10000314 Ga0105239_1000031450 382
246 3300013102 Ga0157371_10048833 Ga0157371_100488332 382
247 3300013104 Ga0157370_10083787 Ga0157370_100837872 382
248 3300013297 Ga0157378_10401523 Ga0157378_104015232 382
249 3300013307 Ga0157372_10111690 Ga0157372_101116902 382
250 3300014326 Ga0157380_10055241 Ga0157380_100552413 382
251 3300014969 Ga0157376_10004247 Ga0157376_100042473 382
252 3300025246 Ga0209646_1002568 Ga0209646_10025683 382
253 3300025912 Ga0207707_10126928 Ga0207707_101269282 382
254 3300025913 Ga0207695_10000071 Ga0207695_10000071205 382
255 3300025919 Ga0207657_10010280 Ga0207657_100102808 382
256 3300025920 Ga0207649_10041340 Ga0207649_100413403 382
257 3300025925 Ga0207650_10015855 Ga0207650_100158554 382
258 3300025926 Ga0207659_10237693 Ga0207659_102376932 382
259 3300025932 Ga0207690_10077456 Ga0207690_100774562 382
260 3300025933 Ga0207706_10006721 Ga0207706_100067216 382
261 3300025944 Ga0207661_10082183 Ga0207661_100821832 382
262 3300025945 Ga0207679_10288256 Ga0207679_102882562 382
263 3300025949 Ga0207667_10000177 Ga0207667_1000017748 382
264 3300026041 Ga0207639_10199881 Ga0207639_101998812 382
265 3300026088 Ga0207641_10007016 Ga0207641_100070163 382
266 3300028379 Ga0268266_10000049 Ga0268266_1000004933 382
267 3300030521 Ga0307511_10000042 Ga0307511_1000004212 382
268 3300031456 Ga0307513_10046519 Ga0307513_100465191 382
269 3300031456 Ga0307513_10101547 Ga0307513_101015472 382
270 3300031507 Ga0307509_10077295 Ga0307509_100772952 382
271 3300031730 Ga0307516_10001770 Ga0307516_100017709 382
272 3300035692 Ga0373935_0202456 Ga0373935_0202456_81_1331 382
273 3300035695 Ga0373927_0023032 Ga0373927_0023032_2871_4049 382
274 3300042014 Ga0439457_000560 Ga0439457_000560_675_1853 382
275 3300044656 Ga0466969_0001246 Ga0466969_0001246_6117_7331 382
276 3300044658 Ga0466972_0000013 Ga0466972_0000013_87123_88301 382
277 3300044684 Ga0466966_0000045 Ga0466966_0000045_72182_73396 382
278 3300044693 Ga0466961_0107579 Ga0466961_0107579_78_1292 382
279 3300044712 Ga0453684_0131105 Ga0453684_0131105_249_1469 382
280 3300044842 Ga0466957_0012809 Ga0466957_0012809_31_1230 382
281 3300045049 Ga0466959_0000023 Ga0466959_0000023_78365_79579 382
282 3300045049 Ga0466959_0002572 Ga0466959_0002572_9061_10275 382
283 3300045836 Ga0466958_0035010 Ga0466958_0035010_901_2115 382
284 3300046460 Ga0495638_0026796 Ga0495638_0026796_2034_3251 382
285 3300046460 Ga0495638_0037051 Ga0495638_0037051_211_1404 382
286 3300046507 Ga0495606_0004249 Ga0495606_0004249_7298_8497 382
287 3300046524 Ga0495648_0003927 Ga0495648_0003927_8698_9915 382
288 3300046616 Ga0495668_0001773 Ga0495668_0001773_15753_16943 382
289 3300046648 Ga0495611_0001562 Ga0495611_0001562_705_1946 382
290 3300048927 Ga0496124_0189179 Ga0496124_0189179_237_1409 382
291 3300049581 Ga0501047_0119517 Ga0501047_0119517_823_2037 382
292 3300049654 Ga0501207_003913 Ga0501207_003913_93_1271 382
293 3300049823 Ga0501044_0003348 Ga0501044_0003348_9914_11107 382
294 3300050493 nmdc:mga0k408_40490_c1 nmdc:mga0k408_40490_c1_396_1574 382
295 3300050507 nmdc:mga05p37_12189_c1 nmdc:mga05p37_12189_c1_1650_2855 382
296 3300053090 Ga0500646_0016476 Ga0500646_0016476_734_1912 382
297 3300053092 Ga0500583_0000108 Ga0500583_0000108_9702_10880 382
298 3300053092 Ga0500583_0000870 Ga0500583_0000870_3904_5121 382
299 3300053131 Ga0500652_016558 Ga0500652_016558_520_1698 382
300 3300053151 Ga0500604_0000265 Ga0500604_0000265_6162_7346 382
301 3300053156 Ga0500622_0002384 Ga0500622_0002384_5130_6347 382
302 3300053178 Ga0500637_0073188 Ga0500637_0073188_55_1251 382
303 iso_pu_bacteria 2721755487 2722729489 382
304 iso_pu_bacteria 2818991442 2819573738 382
305 iso_pu_bacteria 2821136567 2821137072 382
306 iso_pu_bacteria 2904467357 2904468186 382
307 iso_pu_bacteria 2904780799 2904781150 382
308 iso_pu_bacteria 2919177583 2919178753 382
309 iso_pu_bacteria 2929154850 2929157788 382
310 3300003322 rootL2_10134991 rootL2_101349912 383
311 3300005617 Ga0068859_100001471 Ga0068859_1000014715 383
312 3300005617 Ga0068859_100267612 Ga0068859_1002676122 383
313 3300005841 Ga0068863_100048920 Ga0068863_1000489205 383
314 3300005843 Ga0068860_100000111 Ga0068860_10000011187 383
315 3300005843 Ga0068860_100007843 Ga0068860_1000078432 383
316 3300006237 Ga0097621_100000063 Ga0097621_10000006334 383
317 3300006358 Ga0068871_100000952 Ga0068871_10000095213 383
318 3300006931 Ga0097620_100001471 Ga0097620_1000014715 383
319 3300006931 Ga0097620_100267581 Ga0097620_1002675811 383
320 3300009177 Ga0105248_10036134 Ga0105248_100361346 383
321 3300009553 Ga0105249_10023429 Ga0105249_100234295 383
322 3300010375 Ga0105239_10079944 Ga0105239_100799442 383
323 3300013297 Ga0157378_10025743 Ga0157378_100257433 383
324 3300013297 Ga0157378_10125513 Ga0157378_101255132 383
325 3300013306 Ga0163162_10000101 Ga0163162_1000010148 383
326 3300013306 Ga0163162_10000158 Ga0163162_1000015820 383
327 3300013306 Ga0163162_10070287 Ga0163162_100702873 383
328 3300013308 Ga0157375_10000228 Ga0157375_1000022820 383
329 3300014325 Ga0163163_10002069 Ga0163163_100020695 383
330 3300014968 Ga0157379_10001931 Ga0157379_1000193119 383
331 3300014969 Ga0157376_10000439 Ga0157376_100004399 383
332 3300025941 Ga0207711_10020151 Ga0207711_100201512 383
333 3300026088 Ga0207641_10037350 Ga0207641_100373505 383
334 3300028381 Ga0268264_10000313 Ga0268264_1000031313 383
335 3300028381 Ga0268264_10034103 Ga0268264_100341034 383
336 3300028794 Ga0307515_10000002 Ga0307515_10000002497 383
337 3300032126 Ga0307415_100074531 Ga0307415_1000745312 383
338 3300039437 Ga0436365_0396402 Ga0436365_0396402_306_1463 383
339 3300042876 Ga0451577_0185411 Ga0451577_0185411_606_1781 383
340 3300047443 Ga0495687_000001 Ga0495687_000001_393697_394917 383
341 3300047472 Ga0495686_0004044 Ga0495686_0004044_1572_2777 383
342 iso_pu_bacteria 2818991460 2819680765 383
343 iso_pu_bacteria 2884791551 2884795512 383
344 iso_pu_bacteria 2890737413 2890740793 383
345 iso_pu_bacteria 2896344016 2896344199 383
346 iso_pu_bacteria 2898713307 2898716401 383
347 iso_pu_bacteria 2929177148 2929178913 383
348 iso_pu_bacteria 2945977869 2945981318 383
349 iso_pu_bacteria 2946013367 2946019281 383
350 3300002459 JGI24751J29686_10001382 JGI24751J29686_100013823 384
351 3300005327 Ga0070658_10046141 Ga0070658_100461411 384
352 3300005471 Ga0070698_100005366 Ga0070698_1000053669 384
353 3300005539 Ga0068853_100106307 Ga0068853_1001063072 384
354 3300005719 Ga0068861_100001813 Ga0068861_10000181315 384
355 3300005834 Ga0068851_10016501 Ga0068851_100165012 384
356 3300005985 Ga0081539_10089725 Ga0081539_100897252 384
357 3300006358 Ga0068871_100263512 Ga0068871_1002635122 384
358 3300006844 Ga0075428_100003382 Ga0075428_1000033826 384
359 3300006847 Ga0075431_100020834 Ga0075431_1000208343 384
360 3300006880 Ga0075429_100004591 Ga0075429_10000459112 384
361 3300009553 Ga0105249_10002924 Ga0105249_100029246 384
362 3300013102 Ga0157371_10077058 Ga0157371_100770582 384
363 3300013306 Ga0163162_10592855 Ga0163162_105928551 384
364 3300013307 Ga0157372_10085932 Ga0157372_100859326 384
365 3300025925 Ga0207650_10085240 Ga0207650_100852402 384
366 3300025925 Ga0207650_10099597 Ga0207650_100995972 384
367 3300025961 Ga0207712_10002096 Ga0207712_1000209612 384
368 3300026041 Ga0207639_10125924 Ga0207639_101259242 384
369 3300026116 Ga0207674_10052730 Ga0207674_100527302 384
370 3300026118 Ga0207675_100007652 Ga0207675_1000076524 384
371 3300032004 Ga0307414_10029758 Ga0307414_100297584 384
372 3300042131 Ga0450894_006180 Ga0450894_006180_28_1182 384
373 3300042134 Ga0450898_003560 Ga0450898_003560_684_1838 384
374 3300042435 Ga0439434_0000955 Ga0439434_0000955_4690_5844 384
375 3300042876 Ga0451577_0032206 Ga0451577_0032206_3389_4543 384
376 3300044712 Ga0453684_0000557 Ga0453684_0000557_128228_129382 384
377 3300044901 Ga0466960_0018563 Ga0466960_0018563_633_1832 384
378 3300045051 Ga0451576_0045643 Ga0451576_0045643_2052_3206 384
379 3300046522 Ga0495643_0083420 Ga0495643_0083420_114_1274 384
380 3300047320 Ga0495672_0019793 Ga0495672_0019793_1774_2928 384
381 3300047472 Ga0495686_0009844 Ga0495686_0009844_5314_6552 384
382 3300049569 Ga0501032_0022746 Ga0501032_0022746_259_1413 384
383 3300049571 Ga0501034_0009134 Ga0501034_0009134_2736_3890 384
384 3300049572 Ga0501036_0104638 Ga0501036_0104638_104_1258 384
385 3300049573 Ga0501037_0031631 Ga0501037_0031631_872_2026 384
386 3300049575 Ga0501039_0069358 Ga0501039_0069358_649_1803 384
387 3300049579 Ga0501043_0008310 Ga0501043_0008310_923_2077 384
388 3300049580 Ga0501046_0026464 Ga0501046_0026464_824_1978 384
389 3300049581 Ga0501047_0021771 Ga0501047_0021771_2739_3893 384
390 3300049703 Ga0501219_000027 Ga0501219_000027_17912_19111 384
391 3300049742 Ga0501080_0011972 Ga0501080_0011972_4071_5225 384
392 3300049823 Ga0501044_0056459 Ga0501044_0056459_1074_2228 384
393 3300050005 Ga0501284_00021 Ga0501284_00021_57656_58855 384
394 3300050508 nmdc:mga09592_3366_c1 nmdc:mga09592_3366_c1_10089_11315 384
395 3300053727 Ga0500611_000028 Ga0500611_000028_18274_19437 384
396 iso_pu_bacteria 2883068021 2883072698 384
397 iso_pu_bacteria 2896085136 2896087860 384
398 iso_pu_bacteria 2896109856 2896112417 384
399 iso_pu_bacteria 2914759650 2914762058 384
400 iso_pu_bacteria 2929239360 2929241352 384
401 iso_pu_bacteria 2929921140 2929923366 384
402 iso_pu_bacteria 8003151029 8003152236 384
403 3300003354 JGI25160J50197_1000745 JGI25160J50197_100074511 385
404 3300005328 Ga0070676_10002612 Ga0070676_100026125 385
405 3300005334 Ga0068869_100054328 Ga0068869_1000543281 385
406 3300005334 Ga0068869_100065736 Ga0068869_1000657362 385
407 3300005339 Ga0070660_100189154 Ga0070660_1001891542 385
408 3300005347 Ga0070668_100067305 Ga0070668_1000673052 385
409 3300005354 Ga0070675_100013523 Ga0070675_1000135234 385
410 3300005354 Ga0070675_100283682 Ga0070675_1002836822 385
411 3300005355 Ga0070671_100068086 Ga0070671_1000680862 385
412 3300005356 Ga0070674_100054359 Ga0070674_1000543592 385
413 3300005364 Ga0070673_100206650 Ga0070673_1002066502 385
414 3300005456 Ga0070678_100011496 Ga0070678_1000114964 385
415 3300005457 Ga0070662_100065140 Ga0070662_1000651402 385
416 3300005548 Ga0070665_100023532 Ga0070665_1000235324 385
417 3300005577 Ga0068857_100259176 Ga0068857_1002591762 385
418 3300005616 Ga0068852_100009439 Ga0068852_1000094395 385
419 3300005616 Ga0068852_100042013 Ga0068852_1000420133 385
420 3300005617 Ga0068859_100033120 Ga0068859_1000331204 385
421 3300005617 Ga0068859_100250772 Ga0068859_1002507722 385
422 3300005618 Ga0068864_100169840 Ga0068864_1001698402 385
423 3300005719 Ga0068861_100000225 Ga0068861_1000002257 385
424 3300005719 Ga0068861_100122608 Ga0068861_1001226082 385
425 3300005843 Ga0068860_100007815 Ga0068860_10000781510 385
426 3300005843 Ga0068860_100102438 Ga0068860_1001024382 385
427 3300005844 Ga0068862_100002891 Ga0068862_1000028913 385
428 3300005844 Ga0068862_100245456 Ga0068862_1002454562 385
429 3300005985 Ga0081539_10000037 Ga0081539_1000003741 385
430 3300006931 Ga0097620_100033125 Ga0097620_1000331254 385
431 3300006931 Ga0097620_100250786 Ga0097620_1002507862 385
432 3300009094 Ga0111539_10069907 Ga0111539_100699074 385
433 3300009101 Ga0105247_10001601 Ga0105247_1000160113 385
434 3300009174 Ga0105241_10017896 Ga0105241_100178962 385
435 3300009176 Ga0105242_10168370 Ga0105242_101683702 385
436 3300009177 Ga0105248_10329969 Ga0105248_103299692 385
437 3300009553 Ga0105249_10032412 Ga0105249_100324124 385
438 3300013104 Ga0157370_10001963 Ga0157370_1000196319 385
439 3300013297 Ga0157378_10033102 Ga0157378_100331023 385
440 3300013297 Ga0157378_10051960 Ga0157378_100519602 385
441 3300013306 Ga0163162_10012192 Ga0163162_100121922 385
442 3300013306 Ga0163162_10223498 Ga0163162_102234982 385
443 3300013306 Ga0163162_10335351 Ga0163162_103353512 385
444 3300013306 Ga0163162_10387968 Ga0163162_103879681 385
445 3300013307 Ga0157372_10058956 Ga0157372_100589564 385
446 3300013307 Ga0157372_10196808 Ga0157372_101968082 385
447 3300013307 Ga0157372_10330484 Ga0157372_103304841 385
448 3300013308 Ga0157375_10058807 Ga0157375_100588072 385
449 3300013308 Ga0157375_10075797 Ga0157375_100757974 385
450 3300013308 Ga0157375_10171061 Ga0157375_101710612 385
451 3300014326 Ga0157380_10002418 Ga0157380_1000241811 385
452 3300014745 Ga0157377_10000289 Ga0157377_1000028911 385
453 3300025302 Ga0207426_1000002 Ga0207426_1000002798 385
454 3300025315 Ga0207697_10055201 Ga0207697_100552012 385
455 3300025899 Ga0207642_10009627 Ga0207642_100096272 385
456 3300025900 Ga0207710_10004709 Ga0207710_100047093 385
457 3300025904 Ga0207647_10000418 Ga0207647_1000041823 385
458 3300025907 Ga0207645_10000545 Ga0207645_1000054513 385
459 3300025919 Ga0207657_10180556 Ga0207657_101805562 385
460 3300025926 Ga0207659_10255274 Ga0207659_102552742 385
461 3300025933 Ga0207706_10039880 Ga0207706_100398803 385
462 3300025942 Ga0207689_10000466 Ga0207689_1000046619 385
463 3300025942 Ga0207689_10011747 Ga0207689_100117472 385
464 3300025942 Ga0207689_10045750 Ga0207689_100457501 385
465 3300025942 Ga0207689_10070286 Ga0207689_100702863 385
466 3300025960 Ga0207651_10029174 Ga0207651_100291742 385
467 3300025961 Ga0207712_10023201 Ga0207712_100232014 385
468 3300025986 Ga0207658_10093946 Ga0207658_100939461 385
469 3300026023 Ga0207677_10030784 Ga0207677_100307843 385
470 3300026041 Ga0207639_10063181 Ga0207639_100631813 385
471 3300026089 Ga0207648_10009817 Ga0207648_100098176 385
472 3300026116 Ga0207674_10025545 Ga0207674_100255452 385
473 3300026118 Ga0207675_100000386 Ga0207675_10000038618 385
474 3300026121 Ga0207683_10005186 Ga0207683_100051868 385
475 3300026121 Ga0207683_10047043 Ga0207683_100470434 385
476 3300026142 Ga0207698_10007891 Ga0207698_100078913 385
477 3300028380 Ga0268265_10011436 Ga0268265_100114365 385
478 3300028381 Ga0268264_10003143 Ga0268264_1000314315 385
479 3300030731 Ga0316177_1065037 Ga0316177_10650379 385
480 3300030732 Ga0316176_1059625 Ga0316176_10596254 385
481 3300030742 Ga0316183_1106482 Ga0316183_110648212 385
482 3300030744 Ga0316181_1079013 Ga0316181_10790131 385
483 3300030744 Ga0316181_1079031 Ga0316181_10790311 385
484 3300033179 Ga0307507_10083163 Ga0307507_100831632 385
485 3300037418 Ga0395900_0054281 Ga0395900_0054281_751_1914 385
486 3300037466 Ga0395898_0066231 Ga0395898_0066231_928_2091 385
487 3300042014 Ga0439457_012398 Ga0439457_012398_228_1388 385
488 3300042876 Ga0451577_0082190 Ga0451577_0082190_855_2027 385
489 3300044658 Ga0466972_0049834 Ga0466972_0049834_690_1916 385
490 3300045051 Ga0451576_0008513 Ga0451576_0008513_2271_3428 385
491 3300047320 Ga0495672_0008093 Ga0495672_0008093_5865_7031 385
492 3300049823 Ga0501044_0103977 Ga0501044_0103977_548_1720 385
493 3300050511 nmdc:mga08y16_13394_c1 nmdc:mga08y16_13394_c1_2620_3783 385
494 3300053108 Ga0500562_000138 Ga0500562_000138_3137_4324 385
495 3300053139 Ga0500568_0000306 Ga0500568_0000306_30482_31645 385
496 3300053156 Ga0500622_0002452 Ga0500622_0002452_9011_10198 385
497 3300053730 Ga0500645_003971 Ga0500645_003971_4538_5725 385
498 3300005289 Ga0065704_10080787 Ga0065704_100807872 386
499 3300005334 Ga0068869_100006827 Ga0068869_1000068276 386
500 3300005335 Ga0070666_10000833 Ga0070666_100008337 386
501 3300005364 Ga0070673_100033564 Ga0070673_1000335642 386
502 3300005617 Ga0068859_100000100 Ga0068859_10000010070 386
503 3300005618 Ga0068864_100004900 Ga0068864_10000490011 386
504 3300005841 Ga0068863_100005412 Ga0068863_1000054121 386
505 3300005842 Ga0068858_100092421 Ga0068858_1000924212 386
506 3300005843 Ga0068860_100006347 Ga0068860_10000634711 386
507 3300006931 Ga0097620_100000100 Ga0097620_1000001001 386
508 3300009093 Ga0105240_10488768 Ga0105240_104887682 386
509 3300009101 Ga0105247_10109234 Ga0105247_101092342 386
510 3300009148 Ga0105243_10000025 Ga0105243_10000025161 386
511 3300009174 Ga0105241_10000674 Ga0105241_100006747 386
512 3300009545 Ga0105237_10018995 Ga0105237_100189957 386
513 3300013100 Ga0157373_10013229 Ga0157373_100132293 386
514 3300013306 Ga0163162_10005078 Ga0163162_1000507811 386
515 3300013307 Ga0157372_10040582 Ga0157372_100405822 386
516 3300015265 Ga0182005_1000450 Ga0182005_100045012 386
517 3300021384 Ga0213876_10004814 Ga0213876_100048142 386
518 3300025208 Ga0209436_104925 Ga0209436_1049252 386
519 3300025900 Ga0207710_10055960 Ga0207710_100559602 386
520 3300025903 Ga0207680_10000648 Ga0207680_1000064811 386
521 3300025911 Ga0207654_10001858 Ga0207654_1000185810 386
522 3300025914 Ga0207671_10011494 Ga0207671_100114941 386
523 3300025935 Ga0207709_10000003 Ga0207709_10000003763 386
524 3300025942 Ga0207689_10004619 Ga0207689_100046191 386
525 3300026023 Ga0207677_10214345 Ga0207677_102143451 386
526 3300026035 Ga0207703_10006506 Ga0207703_100065067 386
527 3300026088 Ga0207641_10001151 Ga0207641_1000115115 386
528 3300026095 Ga0207676_10005000 Ga0207676_100050001 386
529 3300026142 Ga0207698_10056506 Ga0207698_100565061 386
530 3300028381 Ga0268264_10003175 Ga0268264_100031755 386
531 3300031344 Ga0265316_10131527 Ga0265316_101315272 386
532 3300031507 Ga0307509_10311188 Ga0307509_103111881 386
533 3300031616 Ga0307508_10000923 Ga0307508_100009237 386
534 3300031838 Ga0307518_10150604 Ga0307518_101506042 386
535 3300031852 Ga0307410_10141454 Ga0307410_101414542 386
536 3300032004 Ga0307414_10131792 Ga0307414_101317922 386
537 3300037471 Ga0395905_0002545 Ga0395905_0002545_7307_8479 386
538 3300037471 Ga0395905_0086853 Ga0395905_0086853_1385_2557 386
539 3300039437 Ga0436365_0145209 Ga0436365_0145209_647_1813 386
540 3300039450 Ga0436363_1490087 Ga0436363_1490087_21_1190 386
541 3300044658 Ga0466972_0000003 Ga0466972_0000003_172344_173531 386
542 3300044673 Ga0453683_0179870 Ga0453683_0179870_151_1311 386
543 3300044765 Ga0466970_0000561 Ga0466970_0000561_9800_10987 386
544 3300045051 Ga0451576_0034344 Ga0451576_0034344_132_1292 386
545 3300047320 Ga0495672_0021888 Ga0495672_0021888_1923_3131 386
546 3300048920 Ga0496117_0024737 Ga0496117_0024737_806_1966 386
547 3300048921 Ga0496118_0077022 Ga0496118_0077022_298_1458 386
548 3300048924 Ga0496121_0000020 Ga0496121_0000020_366502_367662 386
549 3300048925 Ga0496122_0009224 Ga0496122_0009224_9197_10357 386
550 3300048926 Ga0496123_0015993 Ga0496123_0015993_4177_5337 386
551 3300048928 Ga0496125_0142252 Ga0496125_0142252_378_1538 386
552 3300048929 Ga0496126_0097477 Ga0496126_0097477_51_1211 386
553 3300049568 Ga0501031_0003126 Ga0501031_0003126_5846_7027 386
554 3300049569 Ga0501032_0069981 Ga0501032_0069981_607_1788 386
555 3300049571 Ga0501034_0076100 Ga0501034_0076100_760_1929 386
556 3300049571 Ga0501034_0153208 Ga0501034_0153208_30_1199 386
557 3300049572 Ga0501036_0012338 Ga0501036_0012338_154_1335 386
558 3300049574 Ga0501038_0006153 Ga0501038_0006153_58_1239 386
559 3300049575 Ga0501039_0071405 Ga0501039_0071405_307_1488 386
560 3300049579 Ga0501043_0020032 Ga0501043_0020032_1301_2482 386
561 3300049652 Ga0501202_000044 Ga0501202_000044_7680_8843 386
562 3300049662 Ga0501222_000252 Ga0501222_000252_3549_4712 386
563 3300049663 Ga0501223_000493 Ga0501223_000493_5675_6838 386
564 3300049664 Ga0501224_000255 Ga0501224_000255_2062_3225 386
565 3300049668 Ga0501233_002221 Ga0501233_002221_205_1368 386
566 3300049669 Ga0501235_000488 Ga0501235_000488_2864_4027 386
567 3300049674 Ga0501242_000805 Ga0501242_000805_108_1271 386
568 3300049688 Ga0501259_000401 Ga0501259_000401_5350_6513 386
569 3300049704 Ga0501221_000844 Ga0501221_000844_3459_4622 386
570 3300049705 Ga0501225_0000846 Ga0501225_0000846_7435_8598 386
571 3300049705 Ga0501225_0016895 Ga0501225_0016895_100_1323 386
572 3300049708 Ga0501245_000641 Ga0501245_000641_2605_3768 386
573 3300049768 Ga0501271_000609 Ga0501271_000609_1776_2939 386
574 3300049822 Ga0501035_0024149 Ga0501035_0024149_2163_3344 386
575 3300049823 Ga0501044_0008339 Ga0501044_0008339_2909_4090 386
576 3300003323 rootH1_10005690 rootH1_1000569010 387
577 3300005334 Ga0068869_100043465 Ga0068869_1000434653 387
578 3300005577 Ga0068857_100005164 Ga0068857_10000516412 387
579 3300013102 Ga0157371_10038253 Ga0157371_100382533 387
580 3300014326 Ga0157380_10265741 Ga0157380_102657411 387
581 3300025284 Ga0209130_1003135 Ga0209130_10031353 387
582 3300025302 Ga0207426_1000051 Ga0207426_1000051223 387
583 3300025942 Ga0207689_10010064 Ga0207689_100100642 387
584 3300025972 Ga0207668_10012966 Ga0207668_100129663 387
585 3300044656 Ga0466969_0052312 Ga0466969_0052312_127_1290 387
586 3300044673 Ga0453683_0049421 Ga0453683_0049421_520_1683 387
587 3300044712 Ga0453684_0103123 Ga0453684_0103123_298_1461 387
588 3300044712 Ga0453684_0291321 Ga0453684_0291321_467_1630 387
589 3300045051 Ga0451576_0000375 Ga0451576_0000375_102823_103986 387
590 3300045051 Ga0451576_0058216 Ga0451576_0058216_1715_2878 387
591 3300049758 Ga0501241_014825 Ga0501241_014825_37_1200 387
592 3300001979 JGI24740J21852_10011458 JGI24740J21852_100114583 388
593 3300002738 JGI25154J39366_1000007 JGI25154J39366_100000730 388
594 3300003320 rootH2_10030196 rootH2_100301962 388
595 3300003354 JGI25160J50197_1001556 JGI25160J50197_100155610 388
596 3300003354 JGI25160J50197_1010899 JGI25160J50197_10108993 388
597 3300003761 Ga0055535_1005833 Ga0055535_10058333 388
598 3300003790 Ga0055528_1001519 Ga0055528_10015193 388
599 3300003794 Ga0055531_10000020 Ga0055531_1000002054 388
600 3300005262 Ga0065165_1000010 Ga0065165_1000010263 388
601 3300005289 Ga0065704_10096912 Ga0065704_100969122 388
602 3300005347 Ga0070668_100060261 Ga0070668_1000602612 388
603 3300005354 Ga0070675_100017829 Ga0070675_1000178292 388
604 3300005364 Ga0070673_100049558 Ga0070673_1000495583 388
605 3300005719 Ga0068861_100153289 Ga0068861_1001532892 388
606 3300006195 Ga0075366_10015955 Ga0075366_100159552 388
607 3300014326 Ga0157380_10137805 Ga0157380_101378052 388
608 3300025242 Ga0209258_100293 Ga0209258_10029354 388
609 3300025246 Ga0209646_1000002 Ga0209646_1000002636 388
610 3300025250 Ga0209026_1000524 Ga0209026_100052414 388
611 3300025254 Ga0209148_1000278 Ga0209148_100027822 388
612 3300025273 Ga0209673_1000530 Ga0209673_100053044 388
613 3300025295 Ga0209564_1038777 Ga0209564_10387771 388
614 3300025297 Ga0209758_1007117 Ga0209758_10071176 388
615 3300025297 Ga0209758_1044976 Ga0209758_10449761 388
616 3300025297 Ga0209758_1059768 Ga0209758_10597681 388
617 3300025298 Ga0209050_1000134 Ga0209050_100013415 388
618 3300025302 Ga0207426_1000841 Ga0207426_100084119 388
619 3300025302 Ga0207426_1001206 Ga0207426_10012061 388
620 3300025304 Ga0209257_1000001 Ga0209257_10000011330 388
621 3300025304 Ga0209257_1001323 Ga0209257_10013235 388
622 3300025893 Ga0207682_10050505 Ga0207682_100505051 388
623 3300025940 Ga0207691_10037596 Ga0207691_100375962 388
624 3300025960 Ga0207651_10130679 Ga0207651_101306792 388
625 3300031251 Ga0265327_10005050 Ga0265327_100050502 388
626 3300031712 Ga0265342_10027866 Ga0265342_100278663 388
627 3300031727 Ga0316576_10118081 Ga0316576_101180812 388
628 3300041997 Ga0439431_0000679 Ga0439431_0000679_4639_5823 388
629 3300041997 Ga0439431_0004552 Ga0439431_0004552_347_1513 388
630 3300044712 Ga0453684_0066495 Ga0453684_0066495_3152_4327 388
631 3300045051 Ga0451576_0064794 Ga0451576_0064794_1915_3081 388
632 3300046453 Ga0495627_015663 Ga0495627_015663_984_2150 388
633 3300046558 Ga0495633_0000090 Ga0495633_0000090_96585_97751 388
634 3300049571 Ga0501034_0047612 Ga0501034_0047612_2233_3417 388
635 3300049823 Ga0501044_0042041 Ga0501044_0042041_370_1542 388
636 3300049823 Ga0501044_0059938 Ga0501044_0059938_1154_2335 388
637 3300053088 Ga0500644_0000119 Ga0500644_0000119_7595_8761 388
638 3300053093 Ga0500651_0015723 Ga0500651_0015723_220_1386 388
639 3300053109 Ga0500569_000066 Ga0500569_000066_12420_13586 388
640 3300053134 Ga0500658_0004173 Ga0500658_0004173_270_1436 388
641 3300053136 Ga0500559_0061405 Ga0500559_0061405_418_1584 388
642 3300053153 Ga0500616_0014645 Ga0500616_0014645_1326_2492 388
643 3300053156 Ga0500622_0000929 Ga0500622_0000929_5429_6595 388
644 3300053161 Ga0500634_0040806 Ga0500634_0040806_1256_2422 388
645 3300055283 Ga0500661_001909 Ga0500661_001909_76_1242 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

66

415

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l1n-assembly1.cif.gz_A substrate bound bacf structure from bacillus subtillis 0.9573 1 384
6l1l-assembly1.cif.gz_A apo-bacf structure from bacillus subtillis 0.956 1 384
6l1o-assembly1.cif.gz_B product bound bacf structure from bacillus subtillis 0.9503 1 384
6l1n-assembly1.cif.gz_B substrate bound bacf structure from bacillus subtillis 0.9485 1 384
6l1n-assembly1.cif.gz_A substrate bound bacf structure from bacillus subtillis 0.9453 1 384
ID Description Score Start End Superfamily
af_Q58786_71_297_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.959 59 284 3.40.640.10
af_Q58786_71_297_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9508 59 284 3.40.640.10
2o1bA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9502 65 285 3.40.640.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9484 64 285 3.40.640.10
2o1bA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.946 65 285 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A4Q6ADX2-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9857 41 386 GO:0008483
GO:0009058
GO:0030170
AF-A0A348Y621-F1-model_v4 deleted 0.9824 2 331
AF-A0A348Y621-F1-model_v4 deleted 0.9794 2 331
AF-A0A4Q3NYQ4-F1-model_v4 deleted 0.9747 104 383
AF-A0A3D1E6C4-F1-model_v4 Aminotransferase 0.9729 270 383 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.97 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map