F472114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 645 | 316 | 614 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100013922|Ga0068855_1000139228 |
| Length | 425 |
| Sequence | MCKLANLKMKYQEAKAFSICRTCPDMSGFSNFQINIMHTSKRLEGIGEYYFSQKLREIDELNKQGKNVINLGIGSPDLPPHPDVIKTLQEESAKPNVHGYQSYKGSPILRKAISDWYKTWYKVDLNADTEILPLIGSKEGIMHICMTYLNEGDKALVPNPGYPTYRSAVKLAGGECVDYDLKEENNWEPDFDQLEKLVAGVKIMWINYPQMPTGQLPTKALFEKIVAFGKKHNILICHDNPYSFILNDNPLSLLHVPGAKDTAIELNSLSKSHNMAGWRVGALCGAKERIDEVLRFKSNMDSGMFLPMQLAAAKALQLPESWYNEVNSVYKKRQQRAFELLDLLECAYDKNQAGMFVWAKVPAGYKTGYELSDEVLYNTAVFITPGGIFGNAGDGYIRVSLCSPEEKFAESIKRIKSFLPALKVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 4 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 5 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 6 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 7 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 8 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 9 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 10 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 11 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 12 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 13 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 14 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 15 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 16 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 17 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 18 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 19 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 20 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 21 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 22 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 23 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 24 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 25 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 26 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 27 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 28 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 29 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 30 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 31 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 34 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 35 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 192 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 193 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 194 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 220 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 221 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 271 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 273 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 279 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 280 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 281 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 297 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 299 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 300 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 301 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 313 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 314 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 315 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 316 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.04 |
| Metatranscriptomes | 0 |
| Isolates | 4.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.68 |
| Nodule | 0 |
| Rhizoplane | 0.31 |
| Rhizosphere | 82.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011458 | 3300001979 | Bacteria | 3373 |
| 2 | JGI24751J29686_10001382 | 3300002459 | Bacteria | 5093 |
| 3 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 4 | rootH1_10050638 | 3300003316 | Bacteria | 3400 |
| 5 | rootH1_10169229 | 3300003316 | Bacteria | 1507 |
| 6 | rootH2_10020409 | 3300003320 | Bacteria | 10833 |
| 7 | rootH2_10030196 | 3300003320 | Bacteria | 3358 |
| 8 | rootH2_10030789 | 3300003320 | Bacteria | 26106 |
| 9 | rootL2_10033506 | 3300003322 | Bacteria | 2861 |
| 10 | rootL2_10040567 | 3300003322 | Bacteria | 5844 |
| 11 | rootL2_10042558 | 3300003322 | Bacteria | 2047 |
| 12 | rootL2_10061218 | 3300003322 | Bacteria | 4417 |
| 13 | rootL2_10134991 | 3300003322 | Bacteria | 1805 |
| 14 | rootH1_10000019 | 3300003316 | Bacteria | 18606 |
| 15 | rootH1_10000019 | 3300003323 | Bacteria | 34919 |
| 16 | rootH1_10005690 | 3300003323 | Bacteria | 14335 |
| 17 | JGI25160J50197_1000745 | 3300003354 | Bacteria | 17705 |
| 18 | JGI25160J50197_1001556 | 3300003354 | Bacteria | 11331 |
| 19 | JGI25160J50197_1010899 | 3300003354 | Bacteria | 3258 |
| 20 | Ga0055535_1005833 | 3300003761 | Bacteria | 2615 |
| 21 | Ga0055528_1001519 | 3300003790 | Bacteria | 14022 |
| 22 | Ga0055531_10000020 | 3300003794 | Bacteria | 170186 |
| 23 | Ga0055531_10000235 | 3300003794 | Bacteria | 60560 |
| 24 | Ga0065165_1000010 | 3300005262 | Bacteria | 323737 |
| 25 | Ga0065714_10003245 | 3300005288 | Bacteria | 9787 |
| 26 | Ga0065704_10080787 | 3300005289 | Bacteria | 3880 |
| 27 | Ga0065704_10096912 | 3300005289 | Bacteria | 2418 |
| 28 | Ga0065707_10111468 | 3300005295 | Bacteria | 2374 |
| 29 | Ga0070658_10046141 | 3300005327 | Bacteria | 3526 |
| 30 | Ga0070658_10063511 | 3300005327 | Bacteria | 3010 |
| 31 | Ga0070676_10002612 | 3300005328 | Bacteria | 9270 |
| 32 | Ga0070683_100006858 | 3300005329 | Bacteria | 9570 |
| 33 | Ga0070683_100016743 | 3300005329 | Bacteria | 6468 |
| 34 | Ga0070683_100065555 | 3300005329 | Bacteria | 3381 |
| 35 | Ga0070690_100022209 | 3300005330 | Bacteria | 3880 |
| 36 | Ga0070670_100204713 | 3300005331 | Bacteria | 1715 |
| 37 | Ga0068869_100006827 | 3300005334 | Bacteria | 7261 |
| 38 | Ga0068869_100043465 | 3300005334 | Bacteria | 3227 |
| 39 | Ga0068869_100054328 | 3300005334 | Bacteria | 2915 |
| 40 | Ga0068869_100064007 | 3300005334 | Bacteria | 2704 |
| 41 | Ga0068869_100065736 | 3300005334 | Bacteria | 2670 |
| 42 | Ga0070666_10000833 | 3300005335 | Bacteria | 18712 |
| 43 | Ga0070666_10014917 | 3300005335 | Bacteria | 4950 |
| 44 | Ga0070666_10113667 | 3300005335 | Bacteria | 1874 |
| 45 | Ga0070682_100009946 | 3300005337 | Bacteria | 5388 |
| 46 | Ga0070682_100045252 | 3300005337 | Unclassified | 2727 |
| 47 | Ga0070682_100091199 | 3300005337 | Bacteria | 1994 |
| 48 | Ga0068868_100010161 | 3300005338 | Bacteria | 6802 |
| 49 | Ga0068868_100025719 | 3300005338 | Bacteria | 4481 |
| 50 | Ga0070660_100169369 | 3300005339 | Bacteria | 1763 |
| 51 | Ga0070660_100189154 | 3300005339 | Bacteria | 1667 |
| 52 | Ga0070689_100034428 | 3300005340 | Bacteria | 3864 |
| 53 | Ga0070689_100085924 | 3300005340 | Bacteria | 2474 |
| 54 | Ga0070689_100122795 | 3300005340 | Bacteria | 2075 |
| 55 | Ga0070689_100193106 | 3300005340 | Unclassified | 1658 |
| 56 | Ga0070687_100041952 | 3300005343 | Unclassified | 2316 |
| 57 | Ga0070661_100001301 | 3300005344 | Bacteria | 17525 |
| 58 | Ga0070668_100060261 | 3300005347 | Bacteria | 2939 |
| 59 | Ga0070668_100067305 | 3300005347 | Bacteria | 2782 |
| 60 | Ga0070675_100013523 | 3300005354 | Bacteria | 6415 |
| 61 | Ga0070675_100017829 | 3300005354 | Bacteria | 5648 |
| 62 | Ga0070675_100095460 | 3300005354 | Bacteria | 2496 |
| 63 | Ga0070675_100283682 | 3300005354 | Bacteria | 1456 |
| 64 | Ga0070671_100068086 | 3300005355 | Bacteria | 2969 |
| 65 | Ga0070671_100098288 | 3300005355 | Bacteria | 2455 |
| 66 | Ga0070671_100170246 | 3300005355 | Bacteria | 1842 |
| 67 | Ga0070671_100218802 | 3300005355 | Unclassified | 1616 |
| 68 | Ga0070674_100054359 | 3300005356 | Bacteria | 2769 |
| 69 | Ga0070673_100033564 | 3300005364 | Bacteria | 3877 |
| 70 | Ga0070673_100049558 | 3300005364 | Bacteria | 3279 |
| 71 | Ga0070673_100128020 | 3300005364 | Bacteria | 2127 |
| 72 | Ga0070673_100206650 | 3300005364 | Bacteria | 1693 |
| 73 | Ga0070688_100027767 | 3300005365 | Unclassified | 3372 |
| 74 | Ga0070688_100059983 | 3300005365 | Bacteria | 2401 |
| 75 | Ga0070659_100009963 | 3300005366 | Bacteria | 6992 |
| 76 | Ga0070659_100014216 | 3300005366 | Bacteria | 5942 |
| 77 | Ga0070659_100225285 | 3300005366 | Unclassified | 1548 |
| 78 | Ga0070678_100011496 | 3300005456 | Bacteria | 5466 |
| 79 | Ga0070662_100012250 | 3300005457 | Bacteria | 5679 |
| 80 | Ga0070662_100016887 | 3300005457 | Bacteria | 4907 |
| 81 | Ga0070662_100065140 | 3300005457 | Bacteria | 2671 |
| 82 | Ga0070681_10006155 | 3300005458 | Bacteria | 11657 |
| 83 | Ga0070681_10095387 | 3300005458 | Bacteria | 2923 |
| 84 | Ga0070681_10098929 | 3300005458 | Bacteria | 2863 |
| 85 | Ga0070681_10186665 | 3300005458 | Bacteria | 1994 |
| 86 | Ga0068867_100021159 | 3300005459 | Bacteria | 4639 |
| 87 | Ga0070698_100005366 | 3300005471 | Bacteria | 14020 |
| 88 | Ga0070698_100038442 | 3300005471 | Bacteria | 4930 |
| 89 | Ga0070679_100008640 | 3300005530 | Bacteria | 9598 |
| 90 | Ga0070679_100011686 | 3300005530 | Bacteria | 8371 |
| 91 | Ga0070679_100231532 | 3300005530 | Bacteria | 1807 |
| 92 | Ga0070684_100000443 | 3300005535 | Bacteria | 28390 |
| 93 | Ga0070684_100004554 | 3300005535 | Bacteria | 10564 |
| 94 | Ga0070684_100008847 | 3300005535 | Bacteria | 7896 |
| 95 | Ga0068853_100006515 | 3300005539 | Bacteria | 9292 |
| 96 | Ga0068853_100106307 | 3300005539 | Bacteria | 2487 |
| 97 | Ga0070686_100166234 | 3300005544 | Bacteria | 1557 |
| 98 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 99 | Ga0070665_100023532 | 3300005548 | Bacteria | 6202 |
| 100 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 101 | Ga0068855_100013922 | 3300005563 | Bacteria | 9701 |
| 102 | Ga0068855_100070039 | 3300005563 | Bacteria | 4081 |
| 103 | Ga0070664_100005313 | 3300005564 | Bacteria | 10331 |
| 104 | Ga0070664_100042458 | 3300005564 | Bacteria | 3838 |
| 105 | Ga0070664_100163416 | 3300005564 | Bacteria | 1971 |
| 106 | Ga0068857_100005164 | 3300005577 | Bacteria | 11101 |
| 107 | Ga0068857_100020778 | 3300005577 | Bacteria | 5776 |
| 108 | Ga0068857_100259176 | 3300005577 | Bacteria | 1595 |
| 109 | Ga0068856_100040959 | 3300005614 | Bacteria | 4551 |
| 110 | Ga0068856_100068956 | 3300005614 | Bacteria | 3496 |
| 111 | Ga0068856_100167880 | 3300005614 | Bacteria | 2206 |
| 112 | Ga0068856_100209792 | 3300005614 | Unclassified | 1963 |
| 113 | Ga0068852_100003650 | 3300005616 | Bacteria | 10781 |
| 114 | Ga0068852_100009439 | 3300005616 | Bacteria | 7246 |
| 115 | Ga0068852_100018147 | 3300005616 | Bacteria | 5538 |
| 116 | Ga0068852_100042013 | 3300005616 | Unclassified | 3869 |
| 117 | Ga0068859_100000100 | 3300005617 | Bacteria | 79844 |
| 118 | Ga0068859_100001471 | 3300005617 | Bacteria | 24005 |
| 119 | Ga0068859_100033120 | 3300005617 | Bacteria | 5190 |
| 120 | Ga0068859_100250772 | 3300005617 | Bacteria | 1861 |
| 121 | Ga0068859_100267612 | 3300005617 | Unclassified | 1801 |
| 122 | Ga0068859_100281598 | 3300005617 | Bacteria | 1755 |
| 123 | Ga0068864_100004900 | 3300005618 | Bacteria | 10966 |
| 124 | Ga0068864_100037342 | 3300005618 | Bacteria | 4145 |
| 125 | Ga0068864_100078151 | 3300005618 | Bacteria | 2895 |
| 126 | Ga0068864_100169840 | 3300005618 | Bacteria | 1988 |
| 127 | Ga0068861_100000225 | 3300005719 | Bacteria | 30713 |
| 128 | Ga0068861_100001813 | 3300005719 | Bacteria | 13764 |
| 129 | Ga0068861_100122608 | 3300005719 | Bacteria | 2099 |
| 130 | Ga0068861_100153289 | 3300005719 | Bacteria | 1893 |
| 131 | Ga0068851_10016501 | 3300005834 | Bacteria | 3534 |
| 132 | Ga0068851_10059534 | 3300005834 | Bacteria | 1954 |
| 133 | Ga0068863_100005412 | 3300005841 | Bacteria | 12587 |
| 134 | Ga0068863_100015000 | 3300005841 | Bacteria | 7443 |
| 135 | Ga0068863_100048920 | 3300005841 | Bacteria | 4009 |
| 136 | Ga0068863_100117105 | 3300005841 | Unclassified | 2539 |
| 137 | Ga0068858_100092421 | 3300005842 | Bacteria | 2816 |
| 138 | Ga0068858_100381899 | 3300005842 | Unclassified | 1352 |
| 139 | Ga0068860_100000111 | 3300005843 | Bacteria | 131004 |
| 140 | Ga0068860_100000846 | 3300005843 | Bacteria | 34263 |
| 141 | Ga0068860_100006347 | 3300005843 | Bacteria | 11865 |
| 142 | Ga0068860_100007815 | 3300005843 | Bacteria | 10678 |
| 143 | Ga0068860_100007843 | 3300005843 | Bacteria | 10655 |
| 144 | Ga0068860_100009731 | 3300005843 | Bacteria | 9546 |
| 145 | Ga0068860_100102438 | 3300005843 | Bacteria | 2732 |
| 146 | Ga0068860_100109808 | 3300005843 | Bacteria | 2636 |
| 147 | Ga0068862_100002891 | 3300005844 | Bacteria | 15027 |
| 148 | Ga0068862_100245456 | 3300005844 | Bacteria | 1630 |
| 149 | Ga0081540_1004465 | 3300005983 | Bacteria | 10652 |
| 150 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 151 | Ga0081539_10089725 | 3300005985 | Bacteria | 1591 |
| 152 | Ga0075366_10015955 | 3300006195 | Bacteria | 4312 |
| 153 | Ga0075366_10020734 | 3300006195 | Bacteria | 3815 |
| 154 | Ga0075366_10052491 | 3300006195 | Bacteria | 2422 |
| 155 | Ga0097621_100000063 | 3300006237 | Bacteria | 55571 |
| 156 | Ga0097621_100008879 | 3300006237 | Bacteria | 7266 |
| 157 | Ga0097621_100009982 | 3300006237 | Bacteria | 6920 |
| 158 | Ga0097621_100027100 | 3300006237 | Bacteria | 4503 |
| 159 | Ga0068871_100000952 | 3300006358 | Bacteria | 19348 |
| 160 | Ga0068871_100015878 | 3300006358 | Bacteria | 5653 |
| 161 | Ga0068871_100263512 | 3300006358 | Unclassified | 1504 |
| 162 | Ga0075428_100003382 | 3300006844 | Bacteria | 17450 |
| 163 | Ga0075428_100359513 | 3300006844 | Bacteria | 1562 |
| 164 | Ga0075431_100020834 | 3300006847 | Bacteria | 6699 |
| 165 | Ga0075429_100004591 | 3300006880 | Bacteria | 11873 |
| 166 | Ga0068865_100223731 | 3300006881 | Bacteria | 1472 |
| 167 | Ga0068865_100242369 | 3300006881 | Bacteria | 1419 |
| 168 | Ga0097620_100000100 | 3300006931 | Bacteria | 79844 |
| 169 | Ga0097620_100001471 | 3300006931 | Bacteria | 24005 |
| 170 | Ga0097620_100033125 | 3300006931 | Bacteria | 5190 |
| 171 | Ga0097620_100250786 | 3300006931 | Bacteria | 1861 |
| 172 | Ga0097620_100267581 | 3300006931 | Unclassified | 1801 |
| 173 | Ga0097620_100281597 | 3300006931 | Bacteria | 1755 |
| 174 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 175 | Ga0105240_10004146 | 3300009093 | Bacteria | 22202 |
| 176 | Ga0105240_10009825 | 3300009093 | Bacteria | 13507 |
| 177 | Ga0105240_10010395 | 3300009093 | Bacteria | 13080 |
| 178 | Ga0105240_10017446 | 3300009093 | Bacteria | 9673 |
| 179 | Ga0105240_10042382 | 3300009093 | Bacteria | 5800 |
| 180 | Ga0105240_10065585 | 3300009093 | Bacteria | 4507 |
| 181 | Ga0105240_10281859 | 3300009093 | Bacteria | 1909 |
| 182 | Ga0105240_10488768 | 3300009093 | Bacteria | 1371 |
| 183 | Ga0111539_10069907 | 3300009094 | Bacteria | 4145 |
| 184 | Ga0105247_10001601 | 3300009101 | Bacteria | 16023 |
| 185 | Ga0105247_10109234 | 3300009101 | Bacteria | 1778 |
| 186 | Ga0105247_10182066 | 3300009101 | Bacteria | 1403 |
| 187 | Ga0114129_10017306 | 3300009147 | Bacteria | 10263 |
| 188 | Ga0114129_10264897 | 3300009147 | Bacteria | 2301 |
| 189 | Ga0105243_10000025 | 3300009148 | Bacteria | 193732 |
| 190 | Ga0105241_10000286 | 3300009174 | Bacteria | 37584 |
| 191 | Ga0105241_10000674 | 3300009174 | Bacteria | 25718 |
| 192 | Ga0105241_10017896 | 3300009174 | Bacteria | 5210 |
| 193 | Ga0105242_10144388 | 3300009176 | Bacteria | 2069 |
| 194 | Ga0105242_10168370 | 3300009176 | Bacteria | 1923 |
| 195 | Ga0105248_10036134 | 3300009177 | Bacteria | 5526 |
| 196 | Ga0105248_10329969 | 3300009177 | Bacteria | 1718 |
| 197 | Ga0105237_10000528 | 3300009545 | Bacteria | 53756 |
| 198 | Ga0105237_10005531 | 3300009545 | Bacteria | 14245 |
| 199 | Ga0105237_10005745 | 3300009545 | Bacteria | 13938 |
| 200 | Ga0105237_10009236 | 3300009545 | Bacteria | 10577 |
| 201 | Ga0105237_10011435 | 3300009545 | Bacteria | 9389 |
| 202 | Ga0105237_10018995 | 3300009545 | Bacteria | 7103 |
| 203 | Ga0105237_10030026 | 3300009545 | Bacteria | 5522 |
| 204 | Ga0105237_10069836 | 3300009545 | Bacteria | 3508 |
| 205 | Ga0105238_10002521 | 3300009551 | Bacteria | 18308 |
| 206 | Ga0105249_10002924 | 3300009553 | Bacteria | 14735 |
| 207 | Ga0105249_10023429 | 3300009553 | Bacteria | 5540 |
| 208 | Ga0105249_10032412 | 3300009553 | Bacteria | 4727 |
| 209 | Ga0105249_10055349 | 3300009553 | Bacteria | 3628 |
| 210 | Ga0105249_10097436 | 3300009553 | Bacteria | 2761 |
| 211 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 212 | Ga0105239_10000314 | 3300010375 | Bacteria | 71313 |
| 213 | Ga0105239_10001973 | 3300010375 | Bacteria | 26693 |
| 214 | Ga0105239_10044989 | 3300010375 | Bacteria | 4838 |
| 215 | Ga0105239_10046042 | 3300010375 | Bacteria | 4779 |
| 216 | Ga0105239_10079944 | 3300010375 | Bacteria | 3597 |
| 217 | Ga0105239_10220684 | 3300010375 | Unclassified | 2126 |
| 218 | Ga0157373_10005431 | 3300013100 | Bacteria | 9573 |
| 219 | Ga0157373_10009939 | 3300013100 | Bacteria | 7011 |
| 220 | Ga0157373_10013229 | 3300013100 | Bacteria | 6058 |
| 221 | Ga0157373_10097498 | 3300013100 | Unclassified | 2070 |
| 222 | Ga0157371_10038253 | 3300013102 | Bacteria | 3433 |
| 223 | Ga0157371_10038895 | 3300013102 | Bacteria | 3402 |
| 224 | Ga0157371_10048833 | 3300013102 | Bacteria | 3008 |
| 225 | Ga0157371_10061630 | 3300013102 | Unclassified | 2659 |
| 226 | Ga0157371_10077058 | 3300013102 | Bacteria | 2361 |
| 227 | Ga0157370_10001963 | 3300013104 | Bacteria | 25346 |
| 228 | Ga0157370_10024821 | 3300013104 | Bacteria | 5935 |
| 229 | Ga0157370_10037282 | 3300013104 | Bacteria | 4713 |
| 230 | Ga0157370_10083787 | 3300013104 | Bacteria | 2998 |
| 231 | Ga0157369_10010269 | 3300013105 | Bacteria | 10682 |
| 232 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 233 | Ga0157374_10198484 | 3300013296 | Bacteria | 1964 |
| 234 | Ga0157374_10463402 | 3300013296 | Bacteria | 1269 |
| 235 | Ga0157378_10025743 | 3300013297 | Bacteria | 5183 |
| 236 | Ga0157378_10033102 | 3300013297 | Bacteria | 4569 |
| 237 | Ga0157378_10051960 | 3300013297 | Bacteria | 3646 |
| 238 | Ga0157378_10056720 | 3300013297 | Bacteria | 3491 |
| 239 | Ga0157378_10125513 | 3300013297 | Bacteria | 2370 |
| 240 | Ga0157378_10286243 | 3300013297 | Unclassified | 1590 |
| 241 | Ga0157378_10401523 | 3300013297 | Bacteria | 1351 |
| 242 | Ga0163162_10000101 | 3300013306 | Bacteria | 77114 |
| 243 | Ga0163162_10000158 | 3300013306 | Bacteria | 62514 |
| 244 | Ga0163162_10005078 | 3300013306 | Bacteria | 12676 |
| 245 | Ga0163162_10008877 | 3300013306 | Bacteria | 9776 |
| 246 | Ga0163162_10012192 | 3300013306 | Bacteria | 8390 |
| 247 | Ga0163162_10057369 | 3300013306 | Unclassified | 3922 |
| 248 | Ga0163162_10070287 | 3300013306 | Bacteria | 3552 |
| 249 | Ga0163162_10091098 | 3300013306 | Bacteria | 3132 |
| 250 | Ga0163162_10223498 | 3300013306 | Bacteria | 2012 |
| 251 | Ga0163162_10335351 | 3300013306 | Bacteria | 1645 |
| 252 | Ga0163162_10387968 | 3300013306 | Bacteria | 1529 |
| 253 | Ga0163162_10592855 | 3300013306 | Bacteria | 1235 |
| 254 | Ga0157372_10001128 | 3300013307 | Bacteria | 28999 |
| 255 | Ga0157372_10040582 | 3300013307 | Bacteria | 5141 |
| 256 | Ga0157372_10058956 | 3300013307 | Bacteria | 4292 |
| 257 | Ga0157372_10085932 | 3300013307 | Bacteria | 3569 |
| 258 | Ga0157372_10111690 | 3300013307 | Bacteria | 3131 |
| 259 | Ga0157372_10196808 | 3300013307 | Bacteria | 2334 |
| 260 | Ga0157372_10232205 | 3300013307 | Unclassified | 2139 |
| 261 | Ga0157372_10330484 | 3300013307 | Bacteria | 1775 |
| 262 | Ga0157375_10000228 | 3300013308 | Bacteria | 52278 |
| 263 | Ga0157375_10009098 | 3300013308 | Bacteria | 8700 |
| 264 | Ga0157375_10058807 | 3300013308 | Bacteria | 3805 |
| 265 | Ga0157375_10071616 | 3300013308 | Bacteria | 3480 |
| 266 | Ga0157375_10075797 | 3300013308 | Bacteria | 3389 |
| 267 | Ga0157375_10171061 | 3300013308 | Bacteria | 2320 |
| 268 | Ga0157375_10546949 | 3300013308 | Bacteria | 1320 |
| 269 | Ga0163163_10002069 | 3300014325 | Bacteria | 16954 |
| 270 | Ga0163163_10191362 | 3300014325 | Bacteria | 2094 |
| 271 | Ga0157380_10002418 | 3300014326 | Bacteria | 12574 |
| 272 | Ga0157380_10055241 | 3300014326 | Bacteria | 3153 |
| 273 | Ga0157380_10137805 | 3300014326 | Bacteria | 2091 |
| 274 | Ga0157380_10265741 | 3300014326 | Bacteria | 1561 |
| 275 | Ga0157377_10000289 | 3300014745 | Bacteria | 23989 |
| 276 | Ga0157379_10001931 | 3300014968 | Bacteria | 17146 |
| 277 | Ga0157376_10000439 | 3300014969 | Bacteria | 26775 |
| 278 | Ga0157376_10004247 | 3300014969 | Bacteria | 9945 |
| 279 | Ga0157376_10010209 | 3300014969 | Bacteria | 6857 |
| 280 | Ga0157376_10088300 | 3300014969 | Bacteria | 2678 |
| 281 | Ga0182006_1019242 | 3300015261 | Bacteria | 2875 |
| 282 | Ga0182005_1000450 | 3300015265 | Bacteria | 21827 |
| 283 | Ga0163161_10084079 | 3300017792 | Bacteria | 2346 |
| 284 | Ga0213876_10004814 | 3300021384 | Bacteria | 7491 |
| 285 | Ga0209436_104925 | 3300025208 | Bacteria | 3197 |
| 286 | Ga0209258_100293 | 3300025242 | Bacteria | 82199 |
| 287 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 288 | Ga0209646_1002568 | 3300025246 | Bacteria | 3950 |
| 289 | Ga0209026_1000524 | 3300025250 | Bacteria | 27023 |
| 290 | Ga0209148_1000278 | 3300025254 | Bacteria | 79641 |
| 291 | Ga0209673_1000530 | 3300025273 | Bacteria | 62542 |
| 292 | Ga0209130_1003135 | 3300025284 | Bacteria | 7334 |
| 293 | Ga0209564_1038777 | 3300025295 | Bacteria | 1320 |
| 294 | Ga0209758_1007117 | 3300025297 | Bacteria | 7738 |
| 295 | Ga0209758_1044976 | 3300025297 | Bacteria | 1607 |
| 296 | Ga0209758_1059768 | 3300025297 | Bacteria | 1266 |
| 297 | Ga0209050_1000134 | 3300025298 | Bacteria | 184417 |
| 298 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 299 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 300 | Ga0207426_1000841 | 3300025302 | Bacteria | 32428 |
| 301 | Ga0207426_1001206 | 3300025302 | Bacteria | 22940 |
| 302 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 303 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 304 | Ga0209257_1001323 | 3300025304 | Bacteria | 30130 |
| 305 | Ga0207697_10055201 | 3300025315 | Bacteria | 1647 |
| 306 | Ga0207656_10041215 | 3300025321 | Bacteria | 1961 |
| 307 | Ga0207682_10050505 | 3300025893 | Bacteria | 1719 |
| 308 | Ga0207642_10009627 | 3300025899 | Bacteria | 3370 |
| 309 | Ga0207710_10004709 | 3300025900 | Bacteria | 5917 |
| 310 | Ga0207710_10055960 | 3300025900 | Bacteria | 1779 |
| 311 | Ga0207680_10000648 | 3300025903 | Bacteria | 16407 |
| 312 | Ga0207647_10000418 | 3300025904 | Bacteria | 34995 |
| 313 | Ga0207647_10006021 | 3300025904 | Bacteria | 8838 |
| 314 | Ga0207647_10025443 | 3300025904 | Unclassified | 3888 |
| 315 | Ga0207645_10000545 | 3300025907 | Bacteria | 31363 |
| 316 | Ga0207705_10076070 | 3300025909 | Bacteria | 2440 |
| 317 | Ga0207654_10000259 | 3300025911 | Bacteria | 32195 |
| 318 | Ga0207654_10001858 | 3300025911 | Bacteria | 10926 |
| 319 | Ga0207654_10166830 | 3300025911 | Bacteria | 1426 |
| 320 | Ga0207707_10126928 | 3300025912 | Bacteria | 2231 |
| 321 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 322 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 323 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 324 | Ga0207695_10003138 | 3300025913 | Bacteria | 23612 |
| 325 | Ga0207695_10018788 | 3300025913 | Bacteria | 7977 |
| 326 | Ga0207695_10119350 | 3300025913 | Bacteria | 2607 |
| 327 | Ga0207671_10001584 | 3300025914 | Bacteria | 25863 |
| 328 | Ga0207671_10001605 | 3300025914 | Bacteria | 25707 |
| 329 | Ga0207671_10011203 | 3300025914 | Bacteria | 7318 |
| 330 | Ga0207671_10011494 | 3300025914 | Bacteria | 7196 |
| 331 | Ga0207671_10032210 | 3300025914 | Bacteria | 3902 |
| 332 | Ga0207657_10010280 | 3300025919 | Bacteria | 9342 |
| 333 | Ga0207657_10033005 | 3300025919 | Bacteria | 4670 |
| 334 | Ga0207657_10166136 | 3300025919 | Bacteria | 1790 |
| 335 | Ga0207657_10180556 | 3300025919 | Bacteria | 1706 |
| 336 | Ga0207649_10002618 | 3300025920 | Bacteria | 9989 |
| 337 | Ga0207649_10041340 | 3300025920 | Bacteria | 2806 |
| 338 | Ga0207652_10000663 | 3300025921 | Bacteria | 33730 |
| 339 | Ga0207694_10015117 | 3300025924 | Bacteria | 5820 |
| 340 | Ga0207650_10015855 | 3300025925 | Bacteria | 5257 |
| 341 | Ga0207650_10085240 | 3300025925 | Bacteria | 2403 |
| 342 | Ga0207650_10099597 | 3300025925 | Bacteria | 2235 |
| 343 | Ga0207659_10237693 | 3300025926 | Bacteria | 1472 |
| 344 | Ga0207659_10255274 | 3300025926 | Bacteria | 1424 |
| 345 | Ga0207690_10077456 | 3300025932 | Bacteria | 2311 |
| 346 | Ga0207706_10006721 | 3300025933 | Bacteria | 10633 |
| 347 | Ga0207706_10039880 | 3300025933 | Bacteria | 4163 |
| 348 | Ga0207709_10000003 | 3300025935 | Bacteria | 1050072 |
| 349 | Ga0207670_10061866 | 3300025936 | Bacteria | 2556 |
| 350 | Ga0207691_10037596 | 3300025940 | Bacteria | 4483 |
| 351 | Ga0207691_10100753 | 3300025940 | Bacteria | 2578 |
| 352 | Ga0207711_10020151 | 3300025941 | Bacteria | 5558 |
| 353 | Ga0207689_10000466 | 3300025942 | Bacteria | 37961 |
| 354 | Ga0207689_10004619 | 3300025942 | Bacteria | 12455 |
| 355 | Ga0207689_10010064 | 3300025942 | Bacteria | 8151 |
| 356 | Ga0207689_10011747 | 3300025942 | Bacteria | 7507 |
| 357 | Ga0207689_10045750 | 3300025942 | Bacteria | 3618 |
| 358 | Ga0207689_10046166 | 3300025942 | Bacteria | 3601 |
| 359 | Ga0207689_10070286 | 3300025942 | Bacteria | 2876 |
| 360 | Ga0207689_10115264 | 3300025942 | Bacteria | 2209 |
| 361 | Ga0207661_10000316 | 3300025944 | Bacteria | 30845 |
| 362 | Ga0207661_10043325 | 3300025944 | Bacteria | 3552 |
| 363 | Ga0207661_10070749 | 3300025944 | Bacteria | 2849 |
| 364 | Ga0207661_10082183 | 3300025944 | Bacteria | 2663 |
| 365 | Ga0207679_10003340 | 3300025945 | Bacteria | 9910 |
| 366 | Ga0207679_10155272 | 3300025945 | Unclassified | 1868 |
| 367 | Ga0207679_10288256 | 3300025945 | Bacteria | 1410 |
| 368 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 369 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 370 | Ga0207667_10013971 | 3300025949 | Bacteria | 9172 |
| 371 | Ga0207651_10029174 | 3300025960 | Bacteria | 3492 |
| 372 | Ga0207651_10123729 | 3300025960 | Bacteria | 1967 |
| 373 | Ga0207651_10130679 | 3300025960 | Bacteria | 1922 |
| 374 | Ga0207712_10002096 | 3300025961 | Bacteria | 13067 |
| 375 | Ga0207712_10002540 | 3300025961 | Bacteria | 11739 |
| 376 | Ga0207712_10017094 | 3300025961 | Bacteria | 4706 |
| 377 | Ga0207712_10023201 | 3300025961 | Bacteria | 4092 |
| 378 | Ga0207668_10012966 | 3300025972 | Bacteria | 5122 |
| 379 | Ga0207658_10093946 | 3300025986 | Bacteria | 2333 |
| 380 | Ga0207677_10030784 | 3300026023 | Unclassified | 3430 |
| 381 | Ga0207677_10214345 | 3300026023 | Bacteria | 1540 |
| 382 | Ga0207703_10006506 | 3300026035 | Bacteria | 9328 |
| 383 | Ga0207639_10016908 | 3300026041 | Bacteria | 5168 |
| 384 | Ga0207639_10050695 | 3300026041 | Bacteria | 3153 |
| 385 | Ga0207639_10063181 | 3300026041 | Bacteria | 2866 |
| 386 | Ga0207639_10125924 | 3300026041 | Bacteria | 2113 |
| 387 | Ga0207639_10199881 | 3300026041 | Bacteria | 1713 |
| 388 | Ga0207702_10180253 | 3300026078 | Bacteria | 1945 |
| 389 | Ga0207702_10241122 | 3300026078 | Unclassified | 1694 |
| 390 | Ga0207702_10274960 | 3300026078 | Bacteria | 1590 |
| 391 | Ga0207641_10001151 | 3300026088 | Bacteria | 26569 |
| 392 | Ga0207641_10007016 | 3300026088 | Bacteria | 9416 |
| 393 | Ga0207641_10037350 | 3300026088 | Bacteria | 4056 |
| 394 | Ga0207641_10179710 | 3300026088 | Unclassified | 1937 |
| 395 | Ga0207641_10221017 | 3300026088 | Bacteria | 1756 |
| 396 | Ga0207648_10006809 | 3300026089 | Bacteria | 11325 |
| 397 | Ga0207648_10009817 | 3300026089 | Bacteria | 9141 |
| 398 | Ga0207676_10005000 | 3300026095 | Bacteria | 9389 |
| 399 | Ga0207676_10167621 | 3300026095 | Bacteria | 1910 |
| 400 | Ga0207674_10000854 | 3300026116 | Bacteria | 39788 |
| 401 | Ga0207674_10003870 | 3300026116 | Bacteria | 18250 |
| 402 | Ga0207674_10025545 | 3300026116 | Bacteria | 6296 |
| 403 | Ga0207674_10052730 | 3300026116 | Bacteria | 4147 |
| 404 | Ga0207675_100000386 | 3300026118 | Bacteria | 42305 |
| 405 | Ga0207675_100007652 | 3300026118 | Bacteria | 10201 |
| 406 | Ga0207683_10005186 | 3300026121 | Bacteria | 11188 |
| 407 | Ga0207683_10019980 | 3300026121 | Bacteria | 5722 |
| 408 | Ga0207683_10047043 | 3300026121 | Bacteria | 3778 |
| 409 | Ga0207683_10318198 | 3300026121 | Unclassified | 1425 |
| 410 | Ga0207698_10007891 | 3300026142 | Bacteria | 6702 |
| 411 | Ga0207698_10056506 | 3300026142 | Bacteria | 3031 |
| 412 | Ga0207698_10060559 | 3300026142 | Bacteria | 2944 |
| 413 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 414 | Ga0268265_10011436 | 3300028380 | Bacteria | 5999 |
| 415 | Ga0268265_10120843 | 3300028380 | Unclassified | 2158 |
| 416 | Ga0268264_10000313 | 3300028381 | Bacteria | 77820 |
| 417 | Ga0268264_10001221 | 3300028381 | Bacteria | 24720 |
| 418 | Ga0268264_10003143 | 3300028381 | Bacteria | 14302 |
| 419 | Ga0268264_10003175 | 3300028381 | Bacteria | 14234 |
| 420 | Ga0268264_10003379 | 3300028381 | Bacteria | 13782 |
| 421 | Ga0268264_10034103 | 3300028381 | Bacteria | 4185 |
| 422 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 423 | Ga0307511_10000042 | 3300030521 | Bacteria | 102114 |
| 424 | Ga0316177_1065037 | 3300030731 | Bacteria | 15063 |
| 425 | Ga0316176_1059625 | 3300030732 | Bacteria | 4872 |
| 426 | Ga0316183_1106482 | 3300030742 | Bacteria | 31361 |
| 427 | Ga0316181_1079013 | 3300030744 | Bacteria | 1212 |
| 428 | Ga0316181_1079031 | 3300030744 | Bacteria | 1212 |
| 429 | Ga0265327_10000168 | 3300031251 | Bacteria | 141392 |
| 430 | Ga0265327_10000531 | 3300031251 | Bacteria | 65562 |
| 431 | Ga0265327_10005050 | 3300031251 | Bacteria | 11274 |
| 432 | Ga0265316_10131527 | 3300031344 | Unclassified | 1884 |
| 433 | Ga0307513_10046519 | 3300031456 | Bacteria | 4729 |
| 434 | Ga0307513_10101547 | 3300031456 | Bacteria | 2898 |
| 435 | Ga0307509_10046584 | 3300031507 | Bacteria | 4668 |
| 436 | Ga0307509_10077295 | 3300031507 | Bacteria | 3452 |
| 437 | Ga0307509_10311188 | 3300031507 | Bacteria | 1317 |
| 438 | Ga0307508_10000923 | 3300031616 | Bacteria | 34113 |
| 439 | Ga0265342_10027866 | 3300031712 | Bacteria | 3524 |
| 440 | Ga0316576_10118081 | 3300031727 | Bacteria | 1991 |
| 441 | Ga0307516_10001770 | 3300031730 | Bacteria | 29691 |
| 442 | Ga0307518_10150604 | 3300031838 | Bacteria | 1610 |
| 443 | Ga0307410_10141454 | 3300031852 | Bacteria | 1781 |
| 444 | Ga0307412_10000029 | 3300031911 | Bacteria | 209074 |
| 445 | Ga0307414_10003311 | 3300032004 | Bacteria | 8590 |
| 446 | Ga0307414_10013799 | 3300032004 | Bacteria | 4821 |
| 447 | Ga0307414_10029758 | 3300032004 | Bacteria | 3559 |
| 448 | Ga0307414_10035397 | 3300032004 | Bacteria | 3322 |
| 449 | Ga0307414_10131792 | 3300032004 | Bacteria | 1942 |
| 450 | Ga0307415_100074531 | 3300032126 | Bacteria | 2399 |
| 451 | Ga0307507_10083163 | 3300033179 | Bacteria | 2801 |
| 452 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 453 | Ga0373935_0202456 | 3300035692 | Bacteria | 1372 |
| 454 | Ga0373927_0023032 | 3300035695 | Bacteria | 4080 |
| 455 | Ga0395900_0054281 | 3300037418 | Bacteria | 4126 |
| 456 | Ga0395900_0236344 | 3300037418 | Bacteria | 1835 |
| 457 | Ga0395898_0066231 | 3300037466 | Bacteria | 3501 |
| 458 | Ga0395905_0002545 | 3300037471 | Bacteria | 20113 |
| 459 | Ga0395905_0086853 | 3300037471 | Bacteria | 2932 |
| 460 | Ga0395905_0192301 | 3300037471 | Bacteria | 1914 |
| 461 | Ga0395901_0249571 | 3300038443 | Bacteria | 1849 |
| 462 | Ga0436365_0145209 | 3300039437 | Bacteria | 10292 |
| 463 | Ga0436365_0396402 | 3300039437 | Bacteria | 1673 |
| 464 | Ga0436363_1490087 | 3300039450 | Bacteria | 1511 |
| 465 | Ga0439431_0000679 | 3300041997 | Bacteria | 7296 |
| 466 | Ga0439431_0004552 | 3300041997 | Bacteria | 3048 |
| 467 | Ga0439457_000560 | 3300042014 | Bacteria | 10851 |
| 468 | Ga0439457_012398 | 3300042014 | Bacteria | 1922 |
| 469 | Ga0450894_006180 | 3300042131 | Bacteria | 1547 |
| 470 | Ga0450898_003560 | 3300042134 | Bacteria | 2246 |
| 471 | Ga0439434_0000955 | 3300042435 | Bacteria | 8334 |
| 472 | Ga0451577_0032206 | 3300042876 | Unclassified | 4724 |
| 473 | Ga0451577_0082190 | 3300042876 | Unclassified | 2873 |
| 474 | Ga0451577_0185411 | 3300042876 | Unclassified | 1876 |
| 475 | Ga0451577_0299599 | 3300042876 | Bacteria | 1457 |
| 476 | Ga0466969_0001246 | 3300044656 | Bacteria | 13732 |
| 477 | Ga0466969_0052312 | 3300044656 | Bacteria | 2007 |
| 478 | Ga0466972_0000003 | 3300044658 | Bacteria | 391452 |
| 479 | Ga0466972_0000013 | 3300044658 | Bacteria | 229345 |
| 480 | Ga0466972_0010132 | 3300044658 | Bacteria | 4735 |
| 481 | Ga0466972_0049834 | 3300044658 | Bacteria | 2022 |
| 482 | Ga0453683_0049421 | 3300044673 | Bacteria | 2636 |
| 483 | Ga0453683_0179870 | 3300044673 | Bacteria | 1341 |
| 484 | Ga0466966_0000045 | 3300044684 | Bacteria | 92504 |
| 485 | Ga0466961_0107579 | 3300044693 | Bacteria | 1755 |
| 486 | Ga0453684_0000557 | 3300044712 | Bacteria | 140566 |
| 487 | Ga0453684_0006063 | 3300044712 | Bacteria | 23362 |
| 488 | Ga0453684_0066495 | 3300044712 | Bacteria | 4589 |
| 489 | Ga0453684_0103123 | 3300044712 | Bacteria | 3486 |
| 490 | Ga0453684_0131105 | 3300044712 | Bacteria | 3007 |
| 491 | Ga0453684_0210519 | 3300044712 | Bacteria | 2260 |
| 492 | Ga0453684_0291321 | 3300044712 | Unclassified | 1859 |
| 493 | Ga0466968_0022253 | 3300044735 | Bacteria | 2576 |
| 494 | Ga0466970_0000561 | 3300044765 | Bacteria | 18151 |
| 495 | Ga0466970_0075033 | 3300044765 | Unclassified | 1821 |
| 496 | Ga0466970_0136183 | 3300044765 | Bacteria | 1351 |
| 497 | Ga0466957_0000070 | 3300044842 | Bacteria | 39824 |
| 498 | Ga0466957_0012809 | 3300044842 | Bacteria | 4860 |
| 499 | Ga0466960_0018563 | 3300044901 | Bacteria | 3051 |
| 500 | Ga0466959_0000023 | 3300045049 | Bacteria | 124545 |
| 501 | Ga0466959_0002572 | 3300045049 | Bacteria | 11650 |
| 502 | Ga0451576_0000375 | 3300045051 | Bacteria | 105551 |
| 503 | Ga0451576_0008513 | 3300045051 | Bacteria | 12031 |
| 504 | Ga0451576_0034344 | 3300045051 | Bacteria | 5387 |
| 505 | Ga0451576_0045643 | 3300045051 | Bacteria | 4614 |
| 506 | Ga0451576_0058216 | 3300045051 | Bacteria | 4038 |
| 507 | Ga0451576_0064794 | 3300045051 | Bacteria | 3806 |
| 508 | Ga0466958_0035010 | 3300045836 | Unclassified | 2999 |
| 509 | Ga0495627_015663 | 3300046453 | Bacteria | 2612 |
| 510 | Ga0495638_0026796 | 3300046460 | Bacteria | 3735 |
| 511 | Ga0495638_0037051 | 3300046460 | Bacteria | 3104 |
| 512 | Ga0495653_0109865 | 3300046463 | Bacteria | 1984 |
| 513 | Ga0495606_0004249 | 3300046507 | Bacteria | 14482 |
| 514 | Ga0495643_0083420 | 3300046522 | Bacteria | 1659 |
| 515 | Ga0495648_0003927 | 3300046524 | Bacteria | 12869 |
| 516 | Ga0495633_0000090 | 3300046558 | Bacteria | 122693 |
| 517 | Ga0495668_0001773 | 3300046616 | Bacteria | 19717 |
| 518 | Ga0495611_0001562 | 3300046648 | Bacteria | 11215 |
| 519 | Ga0495672_0008093 | 3300047320 | Bacteria | 7808 |
| 520 | Ga0495672_0019793 | 3300047320 | Bacteria | 4429 |
| 521 | Ga0495672_0021888 | 3300047320 | Bacteria | 4164 |
| 522 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 523 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 524 | Ga0495686_0004044 | 3300047472 | Bacteria | 12257 |
| 525 | Ga0495686_0009844 | 3300047472 | Bacteria | 6852 |
| 526 | Ga0495686_0061888 | 3300047472 | Bacteria | 2323 |
| 527 | Ga0496108_0304395 | 3300048911 | Bacteria | 1389 |
| 528 | Ga0496110_0170720 | 3300048913 | Unclassified | 1973 |
| 529 | Ga0496117_0024737 | 3300048920 | Bacteria | 4737 |
| 530 | Ga0496118_0077022 | 3300048921 | Bacteria | 2367 |
| 531 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 532 | Ga0496122_0009224 | 3300048925 | Bacteria | 10442 |
| 533 | Ga0496123_0015993 | 3300048926 | Bacteria | 6118 |
| 534 | Ga0496124_0189179 | 3300048927 | Bacteria | 1577 |
| 535 | Ga0496125_0142252 | 3300048928 | Bacteria | 1666 |
| 536 | Ga0496126_0097477 | 3300048929 | Bacteria | 2577 |
| 537 | Ga0501298_000128 | 3300049521 | Bacteria | 9130 |
| 538 | Ga0501031_0003126 | 3300049568 | Bacteria | 10612 |
| 539 | Ga0501032_0022746 | 3300049569 | Bacteria | 4343 |
| 540 | Ga0501032_0069981 | 3300049569 | Unclassified | 2341 |
| 541 | Ga0501034_0009134 | 3300049571 | Bacteria | 10404 |
| 542 | Ga0501034_0047612 | 3300049571 | Bacteria | 4329 |
| 543 | Ga0501034_0076100 | 3300049571 | Bacteria | 3363 |
| 544 | Ga0501034_0153208 | 3300049571 | Bacteria | 2280 |
| 545 | Ga0501036_0012338 | 3300049572 | Bacteria | 7075 |
| 546 | Ga0501036_0104638 | 3300049572 | Bacteria | 2393 |
| 547 | Ga0501037_0031631 | 3300049573 | Bacteria | 3908 |
| 548 | Ga0501038_0006153 | 3300049574 | Bacteria | 11107 |
| 549 | Ga0501039_0069358 | 3300049575 | Bacteria | 2738 |
| 550 | Ga0501039_0071405 | 3300049575 | Bacteria | 2697 |
| 551 | Ga0501043_0008310 | 3300049579 | Bacteria | 8174 |
| 552 | Ga0501043_0020032 | 3300049579 | Bacteria | 5250 |
| 553 | Ga0501046_0026464 | 3300049580 | Bacteria | 4738 |
| 554 | Ga0501047_0021771 | 3300049581 | Bacteria | 6155 |
| 555 | Ga0501047_0119517 | 3300049581 | Bacteria | 2517 |
| 556 | Ga0501198_001286 | 3300049649 | Bacteria | 3252 |
| 557 | Ga0501202_000044 | 3300049652 | Bacteria | 12530 |
| 558 | Ga0501207_003913 | 3300049654 | Bacteria | 2008 |
| 559 | Ga0501222_000252 | 3300049662 | Bacteria | 9061 |
| 560 | Ga0501223_000493 | 3300049663 | Bacteria | 9571 |
| 561 | Ga0501224_000255 | 3300049664 | Bacteria | 6088 |
| 562 | Ga0501233_002221 | 3300049668 | Bacteria | 3401 |
| 563 | Ga0501235_000488 | 3300049669 | Bacteria | 7877 |
| 564 | Ga0501242_000805 | 3300049674 | Bacteria | 2937 |
| 565 | Ga0501259_000401 | 3300049688 | Bacteria | 6869 |
| 566 | Ga0501219_000027 | 3300049703 | Bacteria | 23249 |
| 567 | Ga0501221_000844 | 3300049704 | Bacteria | 4999 |
| 568 | Ga0501225_0000846 | 3300049705 | Bacteria | 9521 |
| 569 | Ga0501225_0016895 | 3300049705 | Bacteria | 2028 |
| 570 | Ga0501245_000641 | 3300049708 | Bacteria | 4316 |
| 571 | Ga0501080_0011972 | 3300049742 | Bacteria | 7945 |
| 572 | Ga0501241_014825 | 3300049758 | Bacteria | 1417 |
| 573 | Ga0501271_000609 | 3300049768 | Bacteria | 3083 |
| 574 | Ga0501280_014334 | 3300049776 | Bacteria | 1128 |
| 575 | Ga0501035_0024149 | 3300049822 | Bacteria | 5577 |
| 576 | Ga0501044_0003348 | 3300049823 | Bacteria | 18071 |
| 577 | Ga0501044_0008339 | 3300049823 | Bacteria | 11357 |
| 578 | Ga0501044_0042041 | 3300049823 | Bacteria | 4757 |
| 579 | Ga0501044_0056459 | 3300049823 | Bacteria | 4032 |
| 580 | Ga0501044_0059938 | 3300049823 | Bacteria | 3899 |
| 581 | Ga0501044_0103977 | 3300049823 | Bacteria | 2854 |
| 582 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 583 | nmdc:mga0k408_26104_c1 | 3300050493 | Bacteria | 3311 |
| 584 | nmdc:mga0k408_40490_c1 | 3300050493 | Bacteria | 2681 |
| 585 | nmdc:mga0k408_4623_c1 | 3300050493 | Bacteria | 7296 |
| 586 | nmdc:mga05p37_12189_c1 | 3300050507 | Bacteria | 10264 |
| 587 | nmdc:mga09592_3366_c1 | 3300050508 | Bacteria | 12924 |
| 588 | nmdc:mga08y16_13394_c1 | 3300050511 | Bacteria | 8626 |
| 589 | nmdc:mga0n895_172750_c1 | 3300050512 | Bacteria | 2193 |
| 590 | Ga0500578_0001147 | 3300053086 | Bacteria | 28253 |
| 591 | Ga0500644_0000119 | 3300053088 | Bacteria | 49309 |
| 592 | Ga0500646_0016476 | 3300053090 | Bacteria | 1930 |
| 593 | Ga0500583_0000108 | 3300053092 | Bacteria | 41760 |
| 594 | Ga0500583_0000870 | 3300053092 | Bacteria | 8703 |
| 595 | Ga0500651_0000635 | 3300053093 | Bacteria | 17479 |
| 596 | Ga0500651_0015723 | 3300053093 | Bacteria | 4650 |
| 597 | Ga0500562_000138 | 3300053108 | Bacteria | 21490 |
| 598 | Ga0500562_002256 | 3300053108 | Bacteria | 4819 |
| 599 | Ga0500569_000066 | 3300053109 | Bacteria | 17371 |
| 600 | Ga0500652_016558 | 3300053131 | Bacteria | 2686 |
| 601 | Ga0500658_0004173 | 3300053134 | Bacteria | 5425 |
| 602 | Ga0500559_0061405 | 3300053136 | Bacteria | 1676 |
| 603 | Ga0500568_0000306 | 3300053139 | Bacteria | 39150 |
| 604 | Ga0500604_0000265 | 3300053151 | Bacteria | 14657 |
| 605 | Ga0500616_0014645 | 3300053153 | Bacteria | 4500 |
| 606 | Ga0500622_0000929 | 3300053156 | Bacteria | 24916 |
| 607 | Ga0500622_0002384 | 3300053156 | Bacteria | 13622 |
| 608 | Ga0500622_0002452 | 3300053156 | Bacteria | 13375 |
| 609 | Ga0500633_0010972 | 3300053160 | Bacteria | 2445 |
| 610 | Ga0500634_0040806 | 3300053161 | Bacteria | 2522 |
| 611 | Ga0500637_0073188 | 3300053178 | Bacteria | 1973 |
| 612 | Ga0500611_000028 | 3300053727 | Bacteria | 93696 |
| 613 | Ga0500645_003971 | 3300053730 | Bacteria | 5819 |
| 614 | Ga0500661_001909 | 3300055283 | Bacteria | 3932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049776 | Ga0501280_014334 | Ga0501280_014334_83_1009 | 307 |
| 2 | 3300026121 | Ga0207683_10318198 | Ga0207683_103181981 | 310 |
| 3 | 3300006881 | Ga0068865_100242369 | Ga0068865_1002423691 | 325 |
| 4 | 3300053160 | Ga0500633_0010972 | Ga0500633_0010972_35_1054 | 339 |
| 5 | 3300003794 | Ga0055531_10000235 | Ga0055531_1000023518 | 354 |
| 6 | 3300025304 | Ga0209257_1000023 | Ga0209257_1000023129 | 354 |
| 7 | 3300037471 | Ga0395905_0192301 | Ga0395905_0192301_834_1904 | 355 |
| 8 | 3300003322 | rootL2_10033506 | rootL2_100335062 | 356 |
| 9 | 3300005288 | Ga0065714_10003245 | Ga0065714_1000324510 | 360 |
| 10 | 3300005340 | Ga0070689_100085924 | Ga0070689_1000859242 | 360 |
| 11 | 3300013296 | Ga0157374_10463402 | Ga0157374_104634021 | 360 |
| 12 | 3300013306 | Ga0163162_10057369 | Ga0163162_100573692 | 360 |
| 13 | 3300005618 | Ga0068864_100078151 | Ga0068864_1000781512 | 361 |
| 14 | 3300026095 | Ga0207676_10167621 | Ga0207676_101676212 | 361 |
| 15 | 3300044765 | Ga0466970_0136183 | Ga0466970_0136183_34_1119 | 361 |
| 16 | 3300005459 | Ga0068867_100021159 | Ga0068867_1000211594 | 362 |
| 17 | 3300026089 | Ga0207648_10006809 | Ga0207648_100068093 | 362 |
| 18 | 3300005843 | Ga0068860_100109808 | Ga0068860_1001098082 | 365 |
| 19 | 3300005365 | Ga0070688_100027767 | Ga0070688_1000277673 | 367 |
| 20 | 3300006844 | Ga0075428_100359513 | Ga0075428_1003595132 | 367 |
| 21 | 3300013308 | Ga0157375_10546949 | Ga0157375_105469492 | 367 |
| 22 | 3300048913 | Ga0496110_0170720 | Ga0496110_0170720_25_1182 | 367 |
| 23 | 3300005329 | Ga0070683_100006858 | Ga0070683_1000068586 | 368 |
| 24 | 3300005337 | Ga0070682_100045252 | Ga0070682_1000452522 | 368 |
| 25 | 3300005458 | Ga0070681_10098929 | Ga0070681_100989293 | 368 |
| 26 | 3300005530 | Ga0070679_100008640 | Ga0070679_1000086405 | 368 |
| 27 | 3300005530 | Ga0070679_100011686 | Ga0070679_1000116867 | 368 |
| 28 | 3300005564 | Ga0070664_100163416 | Ga0070664_1001634162 | 368 |
| 29 | 3300005616 | Ga0068852_100018147 | Ga0068852_1000181475 | 368 |
| 30 | 3300005618 | Ga0068864_100037342 | Ga0068864_1000373422 | 368 |
| 31 | 3300005843 | Ga0068860_100009731 | Ga0068860_1000097314 | 368 |
| 32 | 3300010375 | Ga0105239_10220684 | Ga0105239_102206842 | 368 |
| 33 | 3300013100 | Ga0157373_10097498 | Ga0157373_100974982 | 368 |
| 34 | 3300013102 | Ga0157371_10061630 | Ga0157371_100616302 | 368 |
| 35 | 3300013306 | Ga0163162_10008877 | Ga0163162_100088773 | 368 |
| 36 | 3300013307 | Ga0157372_10232205 | Ga0157372_102322052 | 368 |
| 37 | 3300025909 | Ga0207705_10076070 | Ga0207705_100760702 | 368 |
| 38 | 3300025919 | Ga0207657_10033005 | Ga0207657_100330053 | 368 |
| 39 | 3300025944 | Ga0207661_10070749 | Ga0207661_100707493 | 368 |
| 40 | 3300028381 | Ga0268264_10003379 | Ga0268264_100033797 | 368 |
| 41 | 3300005337 | Ga0070682_100091199 | Ga0070682_1000911992 | 369 |
| 42 | 3300005366 | Ga0070659_100009963 | Ga0070659_1000099637 | 369 |
| 43 | 3300005535 | Ga0070684_100000443 | Ga0070684_10000044319 | 369 |
| 44 | 3300025920 | Ga0207649_10002618 | Ga0207649_100026183 | 369 |
| 45 | 3300025944 | Ga0207661_10000316 | Ga0207661_1000031616 | 369 |
| 46 | 3300025945 | Ga0207679_10003340 | Ga0207679_100033402 | 369 |
| 47 | 3300026041 | Ga0207639_10016908 | Ga0207639_100169084 | 369 |
| 48 | 3300026116 | Ga0207674_10000854 | Ga0207674_100008547 | 369 |
| 49 | 3300003322 | rootL2_10061218 | rootL2_100612183 | 370 |
| 50 | 3300005330 | Ga0070690_100022209 | Ga0070690_1000222094 | 370 |
| 51 | 3300005335 | Ga0070666_10113667 | Ga0070666_101136672 | 370 |
| 52 | 3300005338 | Ga0068868_100025719 | Ga0068868_1000257194 | 370 |
| 53 | 3300005339 | Ga0070660_100169369 | Ga0070660_1001693692 | 370 |
| 54 | 3300005355 | Ga0070671_100098288 | Ga0070671_1000982883 | 370 |
| 55 | 3300005364 | Ga0070673_100128020 | Ga0070673_1001280202 | 370 |
| 56 | 3300005457 | Ga0070662_100016887 | Ga0070662_1000168875 | 370 |
| 57 | 3300005544 | Ga0070686_100166234 | Ga0070686_1001662342 | 370 |
| 58 | 3300006237 | Ga0097621_100027100 | Ga0097621_1000271002 | 370 |
| 59 | 3300009176 | Ga0105242_10144388 | Ga0105242_101443882 | 370 |
| 60 | 3300013296 | Ga0157374_10198484 | Ga0157374_101984841 | 370 |
| 61 | 3300013306 | Ga0163162_10091098 | Ga0163162_100910982 | 370 |
| 62 | 3300013308 | Ga0157375_10009098 | Ga0157375_100090986 | 370 |
| 63 | 3300014325 | Ga0163163_10191362 | Ga0163163_101913622 | 370 |
| 64 | 3300014969 | Ga0157376_10088300 | Ga0157376_100883003 | 370 |
| 65 | 3300017792 | Ga0163161_10084079 | Ga0163161_100840792 | 370 |
| 66 | 3300025942 | Ga0207689_10115264 | Ga0207689_101152642 | 370 |
| 67 | 3300025960 | Ga0207651_10123729 | Ga0207651_101237291 | 370 |
| 68 | 3300026121 | Ga0207683_10019980 | Ga0207683_100199802 | 370 |
| 69 | 3300046463 | Ga0495653_0109865 | Ga0495653_0109865_790_1959 | 370 |
| 70 | 3300050512 | nmdc:mga0n895_172750_c1 | nmdc:mga0n895_172750_c1_56_1225 | 370 |
| 71 | 3300005355 | Ga0070671_100218802 | Ga0070671_1002188021 | 371 |
| 72 | 3300013297 | Ga0157378_10286243 | Ga0157378_102862432 | 371 |
| 73 | 3300013307 | Ga0157372_10001128 | Ga0157372_1000112822 | 371 |
| 74 | 3300025945 | Ga0207679_10155272 | Ga0207679_101552722 | 371 |
| 75 | 3300026088 | Ga0207641_10179710 | Ga0207641_101797102 | 371 |
| 76 | 3300032004 | Ga0307414_10013799 | Ga0307414_100137994 | 371 |
| 77 | 3300005331 | Ga0070670_100204713 | Ga0070670_1002047132 | 372 |
| 78 | 3300005471 | Ga0070698_100038442 | Ga0070698_1000384425 | 372 |
| 79 | 3300003322 | rootL2_10040567 | rootL2_100405672 | 373 |
| 80 | 3300005329 | Ga0070683_100065555 | Ga0070683_1000655552 | 373 |
| 81 | 3300005340 | Ga0070689_100193106 | Ga0070689_1001931062 | 373 |
| 82 | 3300005365 | Ga0070688_100059983 | Ga0070688_1000599831 | 373 |
| 83 | 3300005564 | Ga0070664_100042458 | Ga0070664_1000424582 | 373 |
| 84 | 3300005841 | Ga0068863_100117105 | Ga0068863_1001171052 | 373 |
| 85 | 3300005842 | Ga0068858_100381899 | Ga0068858_1003818992 | 373 |
| 86 | 3300006195 | Ga0075366_10020734 | Ga0075366_100207342 | 373 |
| 87 | 3300006195 | Ga0075366_10052491 | Ga0075366_100524913 | 373 |
| 88 | 3300009093 | Ga0105240_10065585 | Ga0105240_100655854 | 373 |
| 89 | 3300009101 | Ga0105247_10182066 | Ga0105247_101820661 | 373 |
| 90 | 3300009147 | Ga0114129_10264897 | Ga0114129_102648972 | 373 |
| 91 | 3300009545 | Ga0105237_10005745 | Ga0105237_1000574513 | 373 |
| 92 | 3300009553 | Ga0105249_10097436 | Ga0105249_100974361 | 373 |
| 93 | 3300013308 | Ga0157375_10071616 | Ga0157375_100716163 | 373 |
| 94 | 3300025936 | Ga0207670_10061866 | Ga0207670_100618662 | 373 |
| 95 | 3300025944 | Ga0207661_10043325 | Ga0207661_100433253 | 373 |
| 96 | 3300025961 | Ga0207712_10017094 | Ga0207712_100170944 | 373 |
| 97 | 3300050493 | nmdc:mga0k408_26104_c1 | nmdc:mga0k408_26104_c1_1187_2362 | 373 |
| 98 | 3300050493 | nmdc:mga0k408_4623_c1 | nmdc:mga0k408_4623_c1_941_2101 | 373 |
| 99 | 3300005337 | Ga0070682_100009946 | Ga0070682_1000099464 | 374 |
| 100 | 3300005340 | Ga0070689_100122795 | Ga0070689_1001227952 | 374 |
| 101 | 3300005617 | Ga0068859_100281598 | Ga0068859_1002815982 | 374 |
| 102 | 3300006931 | Ga0097620_100281597 | Ga0097620_1002815972 | 374 |
| 103 | 3300025940 | Ga0207691_10100753 | Ga0207691_101007532 | 374 |
| 104 | 3300031251 | Ga0265327_10000168 | Ga0265327_10000168117 | 374 |
| 105 | 3300048911 | Ga0496108_0304395 | Ga0496108_0304395_46_1209 | 374 |
| 106 | 3300009553 | Ga0105249_10055349 | Ga0105249_100553493 | 375 |
| 107 | 3300013105 | Ga0157369_10010269 | Ga0157369_100102692 | 375 |
| 108 | 3300025961 | Ga0207712_10002540 | Ga0207712_100025403 | 375 |
| 109 | 3300042876 | Ga0451577_0299599 | Ga0451577_0299599_14_1180 | 375 |
| 110 | iso_pu_bacteria | 2738543023 | 2739301609 | 375 |
| 111 | iso_pu_bacteria | 2919186247 | 2919186653 | 375 |
| 112 | iso_pu_bacteria | 2939664404 | 2939666077 | 375 |
| 113 | 3300005338 | Ga0068868_100010161 | Ga0068868_1000101617 | 376 |
| 114 | 3300005340 | Ga0070689_100034428 | Ga0070689_1000344282 | 376 |
| 115 | 3300005366 | Ga0070659_100225285 | Ga0070659_1002252851 | 376 |
| 116 | 3300005834 | Ga0068851_10059534 | Ga0068851_100595342 | 376 |
| 117 | 3300013104 | Ga0157370_10037282 | Ga0157370_100372825 | 376 |
| 118 | 3300013297 | Ga0157378_10056720 | Ga0157378_100567204 | 376 |
| 119 | 3300025321 | Ga0207656_10041215 | Ga0207656_100412151 | 376 |
| 120 | 3300026088 | Ga0207641_10221017 | Ga0207641_102210172 | 376 |
| 121 | 3300044712 | Ga0453684_0210519 | Ga0453684_0210519_743_1897 | 376 |
| 122 | 3300049521 | Ga0501298_000128 | Ga0501298_000128_4754_5887 | 376 |
| 123 | 3300005295 | Ga0065707_10111468 | Ga0065707_101114682 | 377 |
| 124 | 3300005334 | Ga0068869_100064007 | Ga0068869_1000640072 | 377 |
| 125 | 3300025942 | Ga0207689_10046166 | Ga0207689_100461662 | 377 |
| 126 | 3300028380 | Ga0268265_10120843 | Ga0268265_101208432 | 377 |
| 127 | 3300031911 | Ga0307412_10000029 | Ga0307412_1000002962 | 377 |
| 128 | 3300032004 | Ga0307414_10035397 | Ga0307414_100353972 | 377 |
| 129 | 3300003320 | rootH2_10020409 | rootH2_100204096 | 378 |
| 130 | 3300005614 | Ga0068856_100040959 | Ga0068856_1000409592 | 378 |
| 131 | 3300026078 | Ga0207702_10180253 | Ga0207702_101802532 | 378 |
| 132 | iso_pu_bacteria | 2738541278 | 2738726358 | 378 |
| 133 | 3300003316 | rootH1_10050638 | rootH1_100506382 | 379 |
| 134 | 3300003322 | rootL2_10042558 | rootL2_100425582 | 379 |
| 135 | 3300005539 | Ga0068853_100006515 | Ga0068853_1000065156 | 379 |
| 136 | 3300005563 | Ga0068855_100070039 | Ga0068855_1000700392 | 379 |
| 137 | 3300005577 | Ga0068857_100020778 | Ga0068857_1000207784 | 379 |
| 138 | 3300005614 | Ga0068856_100167880 | Ga0068856_1001678802 | 379 |
| 139 | 3300005614 | Ga0068856_100209792 | Ga0068856_1002097922 | 379 |
| 140 | 3300005616 | Ga0068852_100003650 | Ga0068852_1000036502 | 379 |
| 141 | 3300005843 | Ga0068860_100000846 | Ga0068860_10000084622 | 379 |
| 142 | 3300009093 | Ga0105240_10000074 | Ga0105240_1000007489 | 379 |
| 143 | 3300009093 | Ga0105240_10004146 | Ga0105240_1000414611 | 379 |
| 144 | 3300009093 | Ga0105240_10009825 | Ga0105240_100098254 | 379 |
| 145 | 3300009093 | Ga0105240_10010395 | Ga0105240_100103954 | 379 |
| 146 | 3300009093 | Ga0105240_10017446 | Ga0105240_1001744610 | 379 |
| 147 | 3300009093 | Ga0105240_10042382 | Ga0105240_100423824 | 379 |
| 148 | 3300009174 | Ga0105241_10000286 | Ga0105241_1000028615 | 379 |
| 149 | 3300009545 | Ga0105237_10005531 | Ga0105237_100055314 | 379 |
| 150 | 3300009545 | Ga0105237_10011435 | Ga0105237_100114354 | 379 |
| 151 | 3300009545 | Ga0105237_10069836 | Ga0105237_100698363 | 379 |
| 152 | 3300009551 | Ga0105238_10002521 | Ga0105238_100025217 | 379 |
| 153 | 3300010375 | Ga0105239_10001973 | Ga0105239_100019733 | 379 |
| 154 | 3300010375 | Ga0105239_10044989 | Ga0105239_100449893 | 379 |
| 155 | 3300013104 | Ga0157370_10024821 | Ga0157370_100248216 | 379 |
| 156 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001253 | 379 |
| 157 | 3300014969 | Ga0157376_10010209 | Ga0157376_100102096 | 379 |
| 158 | 3300025904 | Ga0207647_10006021 | Ga0207647_100060216 | 379 |
| 159 | 3300025911 | Ga0207654_10000259 | Ga0207654_1000025911 | 379 |
| 160 | 3300025911 | Ga0207654_10166830 | Ga0207654_101668301 | 379 |
| 161 | 3300025913 | Ga0207695_10000084 | Ga0207695_10000084179 | 379 |
| 162 | 3300025913 | Ga0207695_10000323 | Ga0207695_1000032329 | 379 |
| 163 | 3300025913 | Ga0207695_10003138 | Ga0207695_1000313814 | 379 |
| 164 | 3300025913 | Ga0207695_10018788 | Ga0207695_100187886 | 379 |
| 165 | 3300025914 | Ga0207671_10001584 | Ga0207671_1000158419 | 379 |
| 166 | 3300025914 | Ga0207671_10032210 | Ga0207671_100322104 | 379 |
| 167 | 3300025919 | Ga0207657_10166136 | Ga0207657_101661362 | 379 |
| 168 | 3300025924 | Ga0207694_10015117 | Ga0207694_100151175 | 379 |
| 169 | 3300025949 | Ga0207667_10000135 | Ga0207667_1000013536 | 379 |
| 170 | 3300026041 | Ga0207639_10050695 | Ga0207639_100506952 | 379 |
| 171 | 3300026078 | Ga0207702_10241122 | Ga0207702_102411222 | 379 |
| 172 | 3300026078 | Ga0207702_10274960 | Ga0207702_102749601 | 379 |
| 173 | 3300026116 | Ga0207674_10003870 | Ga0207674_100038704 | 379 |
| 174 | 3300026142 | Ga0207698_10060559 | Ga0207698_100605592 | 379 |
| 175 | 3300028381 | Ga0268264_10001221 | Ga0268264_1000122112 | 379 |
| 176 | 3300033180 | Ga0307510_10000091 | Ga0307510_1000009162 | 379 |
| 177 | 3300044658 | Ga0466972_0010132 | Ga0466972_0010132_968_2197 | 379 |
| 178 | 3300044712 | Ga0453684_0006063 | Ga0453684_0006063_16318_17490 | 379 |
| 179 | 3300044735 | Ga0466968_0022253 | Ga0466968_0022253_919_2148 | 379 |
| 180 | 3300044765 | Ga0466970_0075033 | Ga0466970_0075033_202_1368 | 379 |
| 181 | 3300047472 | Ga0495686_0061888 | Ga0495686_0061888_1100_2263 | 379 |
| 182 | 3300049649 | Ga0501198_001286 | Ga0501198_001286_1583_2725 | 379 |
| 183 | iso_pu_bacteria | 2739367866 | 2740032054 | 379 |
| 184 | iso_pu_bacteria | 2775506987 | 2776612212 | 379 |
| 185 | iso_pu_bacteria | 2818991444 | 2819590765 | 379 |
| 186 | 3300005563 | Ga0068855_100013922 | Ga0068855_1000139228 | 380 |
| 187 | 3300005614 | Ga0068856_100068956 | Ga0068856_1000689562 | 380 |
| 188 | 3300009093 | Ga0105240_10281859 | Ga0105240_102818591 | 380 |
| 189 | 3300009545 | Ga0105237_10009236 | Ga0105237_100092367 | 380 |
| 190 | 3300010375 | Ga0105239_10046042 | Ga0105239_100460422 | 380 |
| 191 | 3300025913 | Ga0207695_10119350 | Ga0207695_101193502 | 380 |
| 192 | 3300025914 | Ga0207671_10011203 | Ga0207671_100112032 | 380 |
| 193 | 3300025949 | Ga0207667_10013971 | Ga0207667_100139717 | 380 |
| 194 | 3300031507 | Ga0307509_10046584 | Ga0307509_100465843 | 380 |
| 195 | 3300044842 | Ga0466957_0000070 | Ga0466957_0000070_36396_37598 | 380 |
| 196 | 3300053086 | Ga0500578_0001147 | Ga0500578_0001147_18560_19762 | 380 |
| 197 | iso_pu_bacteria | 2896317667 | 2896317673 | 380 |
| 198 | iso_pu_bacteria | 3003233435 | 3003236448 | 380 |
| 199 | 3300005327 | Ga0070658_10063511 | Ga0070658_100635112 | 381 |
| 200 | 3300005343 | Ga0070687_100041952 | Ga0070687_1000419522 | 381 |
| 201 | 3300005458 | Ga0070681_10006155 | Ga0070681_100061555 | 381 |
| 202 | 3300009545 | Ga0105237_10000528 | Ga0105237_100005288 | 381 |
| 203 | 3300013100 | Ga0157373_10005431 | Ga0157373_100054314 | 381 |
| 204 | 3300013100 | Ga0157373_10009939 | Ga0157373_100099394 | 381 |
| 205 | 3300013102 | Ga0157371_10038895 | Ga0157371_100388953 | 381 |
| 206 | 3300015261 | Ga0182006_1019242 | Ga0182006_10192422 | 381 |
| 207 | 3300025904 | Ga0207647_10025443 | Ga0207647_100254433 | 381 |
| 208 | 3300025914 | Ga0207671_10001605 | Ga0207671_1000160521 | 381 |
| 209 | 3300025921 | Ga0207652_10000663 | Ga0207652_1000066318 | 381 |
| 210 | 3300031251 | Ga0265327_10000531 | Ga0265327_1000053141 | 381 |
| 211 | 3300032004 | Ga0307414_10003311 | Ga0307414_100033112 | 381 |
| 212 | 3300037418 | Ga0395900_0236344 | Ga0395900_0236344_16_1194 | 381 |
| 213 | 3300038443 | Ga0395901_0249571 | Ga0395901_0249571_623_1801 | 381 |
| 214 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_380178_381359 | 381 |
| 215 | 3300053093 | Ga0500651_0000635 | Ga0500651_0000635_14114_15268 | 381 |
| 216 | 3300053108 | Ga0500562_002256 | Ga0500562_002256_2806_3960 | 381 |
| 217 | iso_pu_bacteria | 2842903701 | 2842904782 | 381 |
| 218 | 3300003316 | rootH1_10169229 | rootH1_101692292 | 382 |
| 219 | 3300003320 | rootH2_10030789 | rootH2_1003078925 | 382 |
| 220 | 3300003323 | rootH1_10000019 | rootH1_1000001921 | 382 |
| 221 | 3300005329 | Ga0070683_100016743 | Ga0070683_1000167434 | 382 |
| 222 | 3300005335 | Ga0070666_10014917 | Ga0070666_100149172 | 382 |
| 223 | 3300005344 | Ga0070661_100001301 | Ga0070661_10000130114 | 382 |
| 224 | 3300005354 | Ga0070675_100095460 | Ga0070675_1000954602 | 382 |
| 225 | 3300005355 | Ga0070671_100170246 | Ga0070671_1001702461 | 382 |
| 226 | 3300005366 | Ga0070659_100014216 | Ga0070659_1000142163 | 382 |
| 227 | 3300005457 | Ga0070662_100012250 | Ga0070662_1000122505 | 382 |
| 228 | 3300005458 | Ga0070681_10095387 | Ga0070681_100953871 | 382 |
| 229 | 3300005458 | Ga0070681_10186665 | Ga0070681_101866652 | 382 |
| 230 | 3300005530 | Ga0070679_100231532 | Ga0070679_1002315322 | 382 |
| 231 | 3300005535 | Ga0070684_100004554 | Ga0070684_10000455411 | 382 |
| 232 | 3300005535 | Ga0070684_100008847 | Ga0070684_1000088477 | 382 |
| 233 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001672 | 382 |
| 234 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008933 | 382 |
| 235 | 3300005564 | Ga0070664_100005313 | Ga0070664_10000531313 | 382 |
| 236 | 3300005841 | Ga0068863_100015000 | Ga0068863_1000150006 | 382 |
| 237 | 3300005983 | Ga0081540_1004465 | Ga0081540_10044658 | 382 |
| 238 | 3300006237 | Ga0097621_100008879 | Ga0097621_1000088797 | 382 |
| 239 | 3300006237 | Ga0097621_100009982 | Ga0097621_1000099823 | 382 |
| 240 | 3300006358 | Ga0068871_100015878 | Ga0068871_1000158784 | 382 |
| 241 | 3300006881 | Ga0068865_100223731 | Ga0068865_1002237312 | 382 |
| 242 | 3300009147 | Ga0114129_10017306 | Ga0114129_100173063 | 382 |
| 243 | 3300009545 | Ga0105237_10030026 | Ga0105237_100300266 | 382 |
| 244 | 3300010375 | Ga0105239_10000048 | Ga0105239_1000004847 | 382 |
| 245 | 3300010375 | Ga0105239_10000314 | Ga0105239_1000031450 | 382 |
| 246 | 3300013102 | Ga0157371_10048833 | Ga0157371_100488332 | 382 |
| 247 | 3300013104 | Ga0157370_10083787 | Ga0157370_100837872 | 382 |
| 248 | 3300013297 | Ga0157378_10401523 | Ga0157378_104015232 | 382 |
| 249 | 3300013307 | Ga0157372_10111690 | Ga0157372_101116902 | 382 |
| 250 | 3300014326 | Ga0157380_10055241 | Ga0157380_100552413 | 382 |
| 251 | 3300014969 | Ga0157376_10004247 | Ga0157376_100042473 | 382 |
| 252 | 3300025246 | Ga0209646_1002568 | Ga0209646_10025683 | 382 |
| 253 | 3300025912 | Ga0207707_10126928 | Ga0207707_101269282 | 382 |
| 254 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071205 | 382 |
| 255 | 3300025919 | Ga0207657_10010280 | Ga0207657_100102808 | 382 |
| 256 | 3300025920 | Ga0207649_10041340 | Ga0207649_100413403 | 382 |
| 257 | 3300025925 | Ga0207650_10015855 | Ga0207650_100158554 | 382 |
| 258 | 3300025926 | Ga0207659_10237693 | Ga0207659_102376932 | 382 |
| 259 | 3300025932 | Ga0207690_10077456 | Ga0207690_100774562 | 382 |
| 260 | 3300025933 | Ga0207706_10006721 | Ga0207706_100067216 | 382 |
| 261 | 3300025944 | Ga0207661_10082183 | Ga0207661_100821832 | 382 |
| 262 | 3300025945 | Ga0207679_10288256 | Ga0207679_102882562 | 382 |
| 263 | 3300025949 | Ga0207667_10000177 | Ga0207667_1000017748 | 382 |
| 264 | 3300026041 | Ga0207639_10199881 | Ga0207639_101998812 | 382 |
| 265 | 3300026088 | Ga0207641_10007016 | Ga0207641_100070163 | 382 |
| 266 | 3300028379 | Ga0268266_10000049 | Ga0268266_1000004933 | 382 |
| 267 | 3300030521 | Ga0307511_10000042 | Ga0307511_1000004212 | 382 |
| 268 | 3300031456 | Ga0307513_10046519 | Ga0307513_100465191 | 382 |
| 269 | 3300031456 | Ga0307513_10101547 | Ga0307513_101015472 | 382 |
| 270 | 3300031507 | Ga0307509_10077295 | Ga0307509_100772952 | 382 |
| 271 | 3300031730 | Ga0307516_10001770 | Ga0307516_100017709 | 382 |
| 272 | 3300035692 | Ga0373935_0202456 | Ga0373935_0202456_81_1331 | 382 |
| 273 | 3300035695 | Ga0373927_0023032 | Ga0373927_0023032_2871_4049 | 382 |
| 274 | 3300042014 | Ga0439457_000560 | Ga0439457_000560_675_1853 | 382 |
| 275 | 3300044656 | Ga0466969_0001246 | Ga0466969_0001246_6117_7331 | 382 |
| 276 | 3300044658 | Ga0466972_0000013 | Ga0466972_0000013_87123_88301 | 382 |
| 277 | 3300044684 | Ga0466966_0000045 | Ga0466966_0000045_72182_73396 | 382 |
| 278 | 3300044693 | Ga0466961_0107579 | Ga0466961_0107579_78_1292 | 382 |
| 279 | 3300044712 | Ga0453684_0131105 | Ga0453684_0131105_249_1469 | 382 |
| 280 | 3300044842 | Ga0466957_0012809 | Ga0466957_0012809_31_1230 | 382 |
| 281 | 3300045049 | Ga0466959_0000023 | Ga0466959_0000023_78365_79579 | 382 |
| 282 | 3300045049 | Ga0466959_0002572 | Ga0466959_0002572_9061_10275 | 382 |
| 283 | 3300045836 | Ga0466958_0035010 | Ga0466958_0035010_901_2115 | 382 |
| 284 | 3300046460 | Ga0495638_0026796 | Ga0495638_0026796_2034_3251 | 382 |
| 285 | 3300046460 | Ga0495638_0037051 | Ga0495638_0037051_211_1404 | 382 |
| 286 | 3300046507 | Ga0495606_0004249 | Ga0495606_0004249_7298_8497 | 382 |
| 287 | 3300046524 | Ga0495648_0003927 | Ga0495648_0003927_8698_9915 | 382 |
| 288 | 3300046616 | Ga0495668_0001773 | Ga0495668_0001773_15753_16943 | 382 |
| 289 | 3300046648 | Ga0495611_0001562 | Ga0495611_0001562_705_1946 | 382 |
| 290 | 3300048927 | Ga0496124_0189179 | Ga0496124_0189179_237_1409 | 382 |
| 291 | 3300049581 | Ga0501047_0119517 | Ga0501047_0119517_823_2037 | 382 |
| 292 | 3300049654 | Ga0501207_003913 | Ga0501207_003913_93_1271 | 382 |
| 293 | 3300049823 | Ga0501044_0003348 | Ga0501044_0003348_9914_11107 | 382 |
| 294 | 3300050493 | nmdc:mga0k408_40490_c1 | nmdc:mga0k408_40490_c1_396_1574 | 382 |
| 295 | 3300050507 | nmdc:mga05p37_12189_c1 | nmdc:mga05p37_12189_c1_1650_2855 | 382 |
| 296 | 3300053090 | Ga0500646_0016476 | Ga0500646_0016476_734_1912 | 382 |
| 297 | 3300053092 | Ga0500583_0000108 | Ga0500583_0000108_9702_10880 | 382 |
| 298 | 3300053092 | Ga0500583_0000870 | Ga0500583_0000870_3904_5121 | 382 |
| 299 | 3300053131 | Ga0500652_016558 | Ga0500652_016558_520_1698 | 382 |
| 300 | 3300053151 | Ga0500604_0000265 | Ga0500604_0000265_6162_7346 | 382 |
| 301 | 3300053156 | Ga0500622_0002384 | Ga0500622_0002384_5130_6347 | 382 |
| 302 | 3300053178 | Ga0500637_0073188 | Ga0500637_0073188_55_1251 | 382 |
| 303 | iso_pu_bacteria | 2721755487 | 2722729489 | 382 |
| 304 | iso_pu_bacteria | 2818991442 | 2819573738 | 382 |
| 305 | iso_pu_bacteria | 2821136567 | 2821137072 | 382 |
| 306 | iso_pu_bacteria | 2904467357 | 2904468186 | 382 |
| 307 | iso_pu_bacteria | 2904780799 | 2904781150 | 382 |
| 308 | iso_pu_bacteria | 2919177583 | 2919178753 | 382 |
| 309 | iso_pu_bacteria | 2929154850 | 2929157788 | 382 |
| 310 | 3300003322 | rootL2_10134991 | rootL2_101349912 | 383 |
| 311 | 3300005617 | Ga0068859_100001471 | Ga0068859_1000014715 | 383 |
| 312 | 3300005617 | Ga0068859_100267612 | Ga0068859_1002676122 | 383 |
| 313 | 3300005841 | Ga0068863_100048920 | Ga0068863_1000489205 | 383 |
| 314 | 3300005843 | Ga0068860_100000111 | Ga0068860_10000011187 | 383 |
| 315 | 3300005843 | Ga0068860_100007843 | Ga0068860_1000078432 | 383 |
| 316 | 3300006237 | Ga0097621_100000063 | Ga0097621_10000006334 | 383 |
| 317 | 3300006358 | Ga0068871_100000952 | Ga0068871_10000095213 | 383 |
| 318 | 3300006931 | Ga0097620_100001471 | Ga0097620_1000014715 | 383 |
| 319 | 3300006931 | Ga0097620_100267581 | Ga0097620_1002675811 | 383 |
| 320 | 3300009177 | Ga0105248_10036134 | Ga0105248_100361346 | 383 |
| 321 | 3300009553 | Ga0105249_10023429 | Ga0105249_100234295 | 383 |
| 322 | 3300010375 | Ga0105239_10079944 | Ga0105239_100799442 | 383 |
| 323 | 3300013297 | Ga0157378_10025743 | Ga0157378_100257433 | 383 |
| 324 | 3300013297 | Ga0157378_10125513 | Ga0157378_101255132 | 383 |
| 325 | 3300013306 | Ga0163162_10000101 | Ga0163162_1000010148 | 383 |
| 326 | 3300013306 | Ga0163162_10000158 | Ga0163162_1000015820 | 383 |
| 327 | 3300013306 | Ga0163162_10070287 | Ga0163162_100702873 | 383 |
| 328 | 3300013308 | Ga0157375_10000228 | Ga0157375_1000022820 | 383 |
| 329 | 3300014325 | Ga0163163_10002069 | Ga0163163_100020695 | 383 |
| 330 | 3300014968 | Ga0157379_10001931 | Ga0157379_1000193119 | 383 |
| 331 | 3300014969 | Ga0157376_10000439 | Ga0157376_100004399 | 383 |
| 332 | 3300025941 | Ga0207711_10020151 | Ga0207711_100201512 | 383 |
| 333 | 3300026088 | Ga0207641_10037350 | Ga0207641_100373505 | 383 |
| 334 | 3300028381 | Ga0268264_10000313 | Ga0268264_1000031313 | 383 |
| 335 | 3300028381 | Ga0268264_10034103 | Ga0268264_100341034 | 383 |
| 336 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002497 | 383 |
| 337 | 3300032126 | Ga0307415_100074531 | Ga0307415_1000745312 | 383 |
| 338 | 3300039437 | Ga0436365_0396402 | Ga0436365_0396402_306_1463 | 383 |
| 339 | 3300042876 | Ga0451577_0185411 | Ga0451577_0185411_606_1781 | 383 |
| 340 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_393697_394917 | 383 |
| 341 | 3300047472 | Ga0495686_0004044 | Ga0495686_0004044_1572_2777 | 383 |
| 342 | iso_pu_bacteria | 2818991460 | 2819680765 | 383 |
| 343 | iso_pu_bacteria | 2884791551 | 2884795512 | 383 |
| 344 | iso_pu_bacteria | 2890737413 | 2890740793 | 383 |
| 345 | iso_pu_bacteria | 2896344016 | 2896344199 | 383 |
| 346 | iso_pu_bacteria | 2898713307 | 2898716401 | 383 |
| 347 | iso_pu_bacteria | 2929177148 | 2929178913 | 383 |
| 348 | iso_pu_bacteria | 2945977869 | 2945981318 | 383 |
| 349 | iso_pu_bacteria | 2946013367 | 2946019281 | 383 |
| 350 | 3300002459 | JGI24751J29686_10001382 | JGI24751J29686_100013823 | 384 |
| 351 | 3300005327 | Ga0070658_10046141 | Ga0070658_100461411 | 384 |
| 352 | 3300005471 | Ga0070698_100005366 | Ga0070698_1000053669 | 384 |
| 353 | 3300005539 | Ga0068853_100106307 | Ga0068853_1001063072 | 384 |
| 354 | 3300005719 | Ga0068861_100001813 | Ga0068861_10000181315 | 384 |
| 355 | 3300005834 | Ga0068851_10016501 | Ga0068851_100165012 | 384 |
| 356 | 3300005985 | Ga0081539_10089725 | Ga0081539_100897252 | 384 |
| 357 | 3300006358 | Ga0068871_100263512 | Ga0068871_1002635122 | 384 |
| 358 | 3300006844 | Ga0075428_100003382 | Ga0075428_1000033826 | 384 |
| 359 | 3300006847 | Ga0075431_100020834 | Ga0075431_1000208343 | 384 |
| 360 | 3300006880 | Ga0075429_100004591 | Ga0075429_10000459112 | 384 |
| 361 | 3300009553 | Ga0105249_10002924 | Ga0105249_100029246 | 384 |
| 362 | 3300013102 | Ga0157371_10077058 | Ga0157371_100770582 | 384 |
| 363 | 3300013306 | Ga0163162_10592855 | Ga0163162_105928551 | 384 |
| 364 | 3300013307 | Ga0157372_10085932 | Ga0157372_100859326 | 384 |
| 365 | 3300025925 | Ga0207650_10085240 | Ga0207650_100852402 | 384 |
| 366 | 3300025925 | Ga0207650_10099597 | Ga0207650_100995972 | 384 |
| 367 | 3300025961 | Ga0207712_10002096 | Ga0207712_1000209612 | 384 |
| 368 | 3300026041 | Ga0207639_10125924 | Ga0207639_101259242 | 384 |
| 369 | 3300026116 | Ga0207674_10052730 | Ga0207674_100527302 | 384 |
| 370 | 3300026118 | Ga0207675_100007652 | Ga0207675_1000076524 | 384 |
| 371 | 3300032004 | Ga0307414_10029758 | Ga0307414_100297584 | 384 |
| 372 | 3300042131 | Ga0450894_006180 | Ga0450894_006180_28_1182 | 384 |
| 373 | 3300042134 | Ga0450898_003560 | Ga0450898_003560_684_1838 | 384 |
| 374 | 3300042435 | Ga0439434_0000955 | Ga0439434_0000955_4690_5844 | 384 |
| 375 | 3300042876 | Ga0451577_0032206 | Ga0451577_0032206_3389_4543 | 384 |
| 376 | 3300044712 | Ga0453684_0000557 | Ga0453684_0000557_128228_129382 | 384 |
| 377 | 3300044901 | Ga0466960_0018563 | Ga0466960_0018563_633_1832 | 384 |
| 378 | 3300045051 | Ga0451576_0045643 | Ga0451576_0045643_2052_3206 | 384 |
| 379 | 3300046522 | Ga0495643_0083420 | Ga0495643_0083420_114_1274 | 384 |
| 380 | 3300047320 | Ga0495672_0019793 | Ga0495672_0019793_1774_2928 | 384 |
| 381 | 3300047472 | Ga0495686_0009844 | Ga0495686_0009844_5314_6552 | 384 |
| 382 | 3300049569 | Ga0501032_0022746 | Ga0501032_0022746_259_1413 | 384 |
| 383 | 3300049571 | Ga0501034_0009134 | Ga0501034_0009134_2736_3890 | 384 |
| 384 | 3300049572 | Ga0501036_0104638 | Ga0501036_0104638_104_1258 | 384 |
| 385 | 3300049573 | Ga0501037_0031631 | Ga0501037_0031631_872_2026 | 384 |
| 386 | 3300049575 | Ga0501039_0069358 | Ga0501039_0069358_649_1803 | 384 |
| 387 | 3300049579 | Ga0501043_0008310 | Ga0501043_0008310_923_2077 | 384 |
| 388 | 3300049580 | Ga0501046_0026464 | Ga0501046_0026464_824_1978 | 384 |
| 389 | 3300049581 | Ga0501047_0021771 | Ga0501047_0021771_2739_3893 | 384 |
| 390 | 3300049703 | Ga0501219_000027 | Ga0501219_000027_17912_19111 | 384 |
| 391 | 3300049742 | Ga0501080_0011972 | Ga0501080_0011972_4071_5225 | 384 |
| 392 | 3300049823 | Ga0501044_0056459 | Ga0501044_0056459_1074_2228 | 384 |
| 393 | 3300050005 | Ga0501284_00021 | Ga0501284_00021_57656_58855 | 384 |
| 394 | 3300050508 | nmdc:mga09592_3366_c1 | nmdc:mga09592_3366_c1_10089_11315 | 384 |
| 395 | 3300053727 | Ga0500611_000028 | Ga0500611_000028_18274_19437 | 384 |
| 396 | iso_pu_bacteria | 2883068021 | 2883072698 | 384 |
| 397 | iso_pu_bacteria | 2896085136 | 2896087860 | 384 |
| 398 | iso_pu_bacteria | 2896109856 | 2896112417 | 384 |
| 399 | iso_pu_bacteria | 2914759650 | 2914762058 | 384 |
| 400 | iso_pu_bacteria | 2929239360 | 2929241352 | 384 |
| 401 | iso_pu_bacteria | 2929921140 | 2929923366 | 384 |
| 402 | iso_pu_bacteria | 8003151029 | 8003152236 | 384 |
| 403 | 3300003354 | JGI25160J50197_1000745 | JGI25160J50197_100074511 | 385 |
| 404 | 3300005328 | Ga0070676_10002612 | Ga0070676_100026125 | 385 |
| 405 | 3300005334 | Ga0068869_100054328 | Ga0068869_1000543281 | 385 |
| 406 | 3300005334 | Ga0068869_100065736 | Ga0068869_1000657362 | 385 |
| 407 | 3300005339 | Ga0070660_100189154 | Ga0070660_1001891542 | 385 |
| 408 | 3300005347 | Ga0070668_100067305 | Ga0070668_1000673052 | 385 |
| 409 | 3300005354 | Ga0070675_100013523 | Ga0070675_1000135234 | 385 |
| 410 | 3300005354 | Ga0070675_100283682 | Ga0070675_1002836822 | 385 |
| 411 | 3300005355 | Ga0070671_100068086 | Ga0070671_1000680862 | 385 |
| 412 | 3300005356 | Ga0070674_100054359 | Ga0070674_1000543592 | 385 |
| 413 | 3300005364 | Ga0070673_100206650 | Ga0070673_1002066502 | 385 |
| 414 | 3300005456 | Ga0070678_100011496 | Ga0070678_1000114964 | 385 |
| 415 | 3300005457 | Ga0070662_100065140 | Ga0070662_1000651402 | 385 |
| 416 | 3300005548 | Ga0070665_100023532 | Ga0070665_1000235324 | 385 |
| 417 | 3300005577 | Ga0068857_100259176 | Ga0068857_1002591762 | 385 |
| 418 | 3300005616 | Ga0068852_100009439 | Ga0068852_1000094395 | 385 |
| 419 | 3300005616 | Ga0068852_100042013 | Ga0068852_1000420133 | 385 |
| 420 | 3300005617 | Ga0068859_100033120 | Ga0068859_1000331204 | 385 |
| 421 | 3300005617 | Ga0068859_100250772 | Ga0068859_1002507722 | 385 |
| 422 | 3300005618 | Ga0068864_100169840 | Ga0068864_1001698402 | 385 |
| 423 | 3300005719 | Ga0068861_100000225 | Ga0068861_1000002257 | 385 |
| 424 | 3300005719 | Ga0068861_100122608 | Ga0068861_1001226082 | 385 |
| 425 | 3300005843 | Ga0068860_100007815 | Ga0068860_10000781510 | 385 |
| 426 | 3300005843 | Ga0068860_100102438 | Ga0068860_1001024382 | 385 |
| 427 | 3300005844 | Ga0068862_100002891 | Ga0068862_1000028913 | 385 |
| 428 | 3300005844 | Ga0068862_100245456 | Ga0068862_1002454562 | 385 |
| 429 | 3300005985 | Ga0081539_10000037 | Ga0081539_1000003741 | 385 |
| 430 | 3300006931 | Ga0097620_100033125 | Ga0097620_1000331254 | 385 |
| 431 | 3300006931 | Ga0097620_100250786 | Ga0097620_1002507862 | 385 |
| 432 | 3300009094 | Ga0111539_10069907 | Ga0111539_100699074 | 385 |
| 433 | 3300009101 | Ga0105247_10001601 | Ga0105247_1000160113 | 385 |
| 434 | 3300009174 | Ga0105241_10017896 | Ga0105241_100178962 | 385 |
| 435 | 3300009176 | Ga0105242_10168370 | Ga0105242_101683702 | 385 |
| 436 | 3300009177 | Ga0105248_10329969 | Ga0105248_103299692 | 385 |
| 437 | 3300009553 | Ga0105249_10032412 | Ga0105249_100324124 | 385 |
| 438 | 3300013104 | Ga0157370_10001963 | Ga0157370_1000196319 | 385 |
| 439 | 3300013297 | Ga0157378_10033102 | Ga0157378_100331023 | 385 |
| 440 | 3300013297 | Ga0157378_10051960 | Ga0157378_100519602 | 385 |
| 441 | 3300013306 | Ga0163162_10012192 | Ga0163162_100121922 | 385 |
| 442 | 3300013306 | Ga0163162_10223498 | Ga0163162_102234982 | 385 |
| 443 | 3300013306 | Ga0163162_10335351 | Ga0163162_103353512 | 385 |
| 444 | 3300013306 | Ga0163162_10387968 | Ga0163162_103879681 | 385 |
| 445 | 3300013307 | Ga0157372_10058956 | Ga0157372_100589564 | 385 |
| 446 | 3300013307 | Ga0157372_10196808 | Ga0157372_101968082 | 385 |
| 447 | 3300013307 | Ga0157372_10330484 | Ga0157372_103304841 | 385 |
| 448 | 3300013308 | Ga0157375_10058807 | Ga0157375_100588072 | 385 |
| 449 | 3300013308 | Ga0157375_10075797 | Ga0157375_100757974 | 385 |
| 450 | 3300013308 | Ga0157375_10171061 | Ga0157375_101710612 | 385 |
| 451 | 3300014326 | Ga0157380_10002418 | Ga0157380_1000241811 | 385 |
| 452 | 3300014745 | Ga0157377_10000289 | Ga0157377_1000028911 | 385 |
| 453 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002798 | 385 |
| 454 | 3300025315 | Ga0207697_10055201 | Ga0207697_100552012 | 385 |
| 455 | 3300025899 | Ga0207642_10009627 | Ga0207642_100096272 | 385 |
| 456 | 3300025900 | Ga0207710_10004709 | Ga0207710_100047093 | 385 |
| 457 | 3300025904 | Ga0207647_10000418 | Ga0207647_1000041823 | 385 |
| 458 | 3300025907 | Ga0207645_10000545 | Ga0207645_1000054513 | 385 |
| 459 | 3300025919 | Ga0207657_10180556 | Ga0207657_101805562 | 385 |
| 460 | 3300025926 | Ga0207659_10255274 | Ga0207659_102552742 | 385 |
| 461 | 3300025933 | Ga0207706_10039880 | Ga0207706_100398803 | 385 |
| 462 | 3300025942 | Ga0207689_10000466 | Ga0207689_1000046619 | 385 |
| 463 | 3300025942 | Ga0207689_10011747 | Ga0207689_100117472 | 385 |
| 464 | 3300025942 | Ga0207689_10045750 | Ga0207689_100457501 | 385 |
| 465 | 3300025942 | Ga0207689_10070286 | Ga0207689_100702863 | 385 |
| 466 | 3300025960 | Ga0207651_10029174 | Ga0207651_100291742 | 385 |
| 467 | 3300025961 | Ga0207712_10023201 | Ga0207712_100232014 | 385 |
| 468 | 3300025986 | Ga0207658_10093946 | Ga0207658_100939461 | 385 |
| 469 | 3300026023 | Ga0207677_10030784 | Ga0207677_100307843 | 385 |
| 470 | 3300026041 | Ga0207639_10063181 | Ga0207639_100631813 | 385 |
| 471 | 3300026089 | Ga0207648_10009817 | Ga0207648_100098176 | 385 |
| 472 | 3300026116 | Ga0207674_10025545 | Ga0207674_100255452 | 385 |
| 473 | 3300026118 | Ga0207675_100000386 | Ga0207675_10000038618 | 385 |
| 474 | 3300026121 | Ga0207683_10005186 | Ga0207683_100051868 | 385 |
| 475 | 3300026121 | Ga0207683_10047043 | Ga0207683_100470434 | 385 |
| 476 | 3300026142 | Ga0207698_10007891 | Ga0207698_100078913 | 385 |
| 477 | 3300028380 | Ga0268265_10011436 | Ga0268265_100114365 | 385 |
| 478 | 3300028381 | Ga0268264_10003143 | Ga0268264_1000314315 | 385 |
| 479 | 3300030731 | Ga0316177_1065037 | Ga0316177_10650379 | 385 |
| 480 | 3300030732 | Ga0316176_1059625 | Ga0316176_10596254 | 385 |
| 481 | 3300030742 | Ga0316183_1106482 | Ga0316183_110648212 | 385 |
| 482 | 3300030744 | Ga0316181_1079013 | Ga0316181_10790131 | 385 |
| 483 | 3300030744 | Ga0316181_1079031 | Ga0316181_10790311 | 385 |
| 484 | 3300033179 | Ga0307507_10083163 | Ga0307507_100831632 | 385 |
| 485 | 3300037418 | Ga0395900_0054281 | Ga0395900_0054281_751_1914 | 385 |
| 486 | 3300037466 | Ga0395898_0066231 | Ga0395898_0066231_928_2091 | 385 |
| 487 | 3300042014 | Ga0439457_012398 | Ga0439457_012398_228_1388 | 385 |
| 488 | 3300042876 | Ga0451577_0082190 | Ga0451577_0082190_855_2027 | 385 |
| 489 | 3300044658 | Ga0466972_0049834 | Ga0466972_0049834_690_1916 | 385 |
| 490 | 3300045051 | Ga0451576_0008513 | Ga0451576_0008513_2271_3428 | 385 |
| 491 | 3300047320 | Ga0495672_0008093 | Ga0495672_0008093_5865_7031 | 385 |
| 492 | 3300049823 | Ga0501044_0103977 | Ga0501044_0103977_548_1720 | 385 |
| 493 | 3300050511 | nmdc:mga08y16_13394_c1 | nmdc:mga08y16_13394_c1_2620_3783 | 385 |
| 494 | 3300053108 | Ga0500562_000138 | Ga0500562_000138_3137_4324 | 385 |
| 495 | 3300053139 | Ga0500568_0000306 | Ga0500568_0000306_30482_31645 | 385 |
| 496 | 3300053156 | Ga0500622_0002452 | Ga0500622_0002452_9011_10198 | 385 |
| 497 | 3300053730 | Ga0500645_003971 | Ga0500645_003971_4538_5725 | 385 |
| 498 | 3300005289 | Ga0065704_10080787 | Ga0065704_100807872 | 386 |
| 499 | 3300005334 | Ga0068869_100006827 | Ga0068869_1000068276 | 386 |
| 500 | 3300005335 | Ga0070666_10000833 | Ga0070666_100008337 | 386 |
| 501 | 3300005364 | Ga0070673_100033564 | Ga0070673_1000335642 | 386 |
| 502 | 3300005617 | Ga0068859_100000100 | Ga0068859_10000010070 | 386 |
| 503 | 3300005618 | Ga0068864_100004900 | Ga0068864_10000490011 | 386 |
| 504 | 3300005841 | Ga0068863_100005412 | Ga0068863_1000054121 | 386 |
| 505 | 3300005842 | Ga0068858_100092421 | Ga0068858_1000924212 | 386 |
| 506 | 3300005843 | Ga0068860_100006347 | Ga0068860_10000634711 | 386 |
| 507 | 3300006931 | Ga0097620_100000100 | Ga0097620_1000001001 | 386 |
| 508 | 3300009093 | Ga0105240_10488768 | Ga0105240_104887682 | 386 |
| 509 | 3300009101 | Ga0105247_10109234 | Ga0105247_101092342 | 386 |
| 510 | 3300009148 | Ga0105243_10000025 | Ga0105243_10000025161 | 386 |
| 511 | 3300009174 | Ga0105241_10000674 | Ga0105241_100006747 | 386 |
| 512 | 3300009545 | Ga0105237_10018995 | Ga0105237_100189957 | 386 |
| 513 | 3300013100 | Ga0157373_10013229 | Ga0157373_100132293 | 386 |
| 514 | 3300013306 | Ga0163162_10005078 | Ga0163162_1000507811 | 386 |
| 515 | 3300013307 | Ga0157372_10040582 | Ga0157372_100405822 | 386 |
| 516 | 3300015265 | Ga0182005_1000450 | Ga0182005_100045012 | 386 |
| 517 | 3300021384 | Ga0213876_10004814 | Ga0213876_100048142 | 386 |
| 518 | 3300025208 | Ga0209436_104925 | Ga0209436_1049252 | 386 |
| 519 | 3300025900 | Ga0207710_10055960 | Ga0207710_100559602 | 386 |
| 520 | 3300025903 | Ga0207680_10000648 | Ga0207680_1000064811 | 386 |
| 521 | 3300025911 | Ga0207654_10001858 | Ga0207654_1000185810 | 386 |
| 522 | 3300025914 | Ga0207671_10011494 | Ga0207671_100114941 | 386 |
| 523 | 3300025935 | Ga0207709_10000003 | Ga0207709_10000003763 | 386 |
| 524 | 3300025942 | Ga0207689_10004619 | Ga0207689_100046191 | 386 |
| 525 | 3300026023 | Ga0207677_10214345 | Ga0207677_102143451 | 386 |
| 526 | 3300026035 | Ga0207703_10006506 | Ga0207703_100065067 | 386 |
| 527 | 3300026088 | Ga0207641_10001151 | Ga0207641_1000115115 | 386 |
| 528 | 3300026095 | Ga0207676_10005000 | Ga0207676_100050001 | 386 |
| 529 | 3300026142 | Ga0207698_10056506 | Ga0207698_100565061 | 386 |
| 530 | 3300028381 | Ga0268264_10003175 | Ga0268264_100031755 | 386 |
| 531 | 3300031344 | Ga0265316_10131527 | Ga0265316_101315272 | 386 |
| 532 | 3300031507 | Ga0307509_10311188 | Ga0307509_103111881 | 386 |
| 533 | 3300031616 | Ga0307508_10000923 | Ga0307508_100009237 | 386 |
| 534 | 3300031838 | Ga0307518_10150604 | Ga0307518_101506042 | 386 |
| 535 | 3300031852 | Ga0307410_10141454 | Ga0307410_101414542 | 386 |
| 536 | 3300032004 | Ga0307414_10131792 | Ga0307414_101317922 | 386 |
| 537 | 3300037471 | Ga0395905_0002545 | Ga0395905_0002545_7307_8479 | 386 |
| 538 | 3300037471 | Ga0395905_0086853 | Ga0395905_0086853_1385_2557 | 386 |
| 539 | 3300039437 | Ga0436365_0145209 | Ga0436365_0145209_647_1813 | 386 |
| 540 | 3300039450 | Ga0436363_1490087 | Ga0436363_1490087_21_1190 | 386 |
| 541 | 3300044658 | Ga0466972_0000003 | Ga0466972_0000003_172344_173531 | 386 |
| 542 | 3300044673 | Ga0453683_0179870 | Ga0453683_0179870_151_1311 | 386 |
| 543 | 3300044765 | Ga0466970_0000561 | Ga0466970_0000561_9800_10987 | 386 |
| 544 | 3300045051 | Ga0451576_0034344 | Ga0451576_0034344_132_1292 | 386 |
| 545 | 3300047320 | Ga0495672_0021888 | Ga0495672_0021888_1923_3131 | 386 |
| 546 | 3300048920 | Ga0496117_0024737 | Ga0496117_0024737_806_1966 | 386 |
| 547 | 3300048921 | Ga0496118_0077022 | Ga0496118_0077022_298_1458 | 386 |
| 548 | 3300048924 | Ga0496121_0000020 | Ga0496121_0000020_366502_367662 | 386 |
| 549 | 3300048925 | Ga0496122_0009224 | Ga0496122_0009224_9197_10357 | 386 |
| 550 | 3300048926 | Ga0496123_0015993 | Ga0496123_0015993_4177_5337 | 386 |
| 551 | 3300048928 | Ga0496125_0142252 | Ga0496125_0142252_378_1538 | 386 |
| 552 | 3300048929 | Ga0496126_0097477 | Ga0496126_0097477_51_1211 | 386 |
| 553 | 3300049568 | Ga0501031_0003126 | Ga0501031_0003126_5846_7027 | 386 |
| 554 | 3300049569 | Ga0501032_0069981 | Ga0501032_0069981_607_1788 | 386 |
| 555 | 3300049571 | Ga0501034_0076100 | Ga0501034_0076100_760_1929 | 386 |
| 556 | 3300049571 | Ga0501034_0153208 | Ga0501034_0153208_30_1199 | 386 |
| 557 | 3300049572 | Ga0501036_0012338 | Ga0501036_0012338_154_1335 | 386 |
| 558 | 3300049574 | Ga0501038_0006153 | Ga0501038_0006153_58_1239 | 386 |
| 559 | 3300049575 | Ga0501039_0071405 | Ga0501039_0071405_307_1488 | 386 |
| 560 | 3300049579 | Ga0501043_0020032 | Ga0501043_0020032_1301_2482 | 386 |
| 561 | 3300049652 | Ga0501202_000044 | Ga0501202_000044_7680_8843 | 386 |
| 562 | 3300049662 | Ga0501222_000252 | Ga0501222_000252_3549_4712 | 386 |
| 563 | 3300049663 | Ga0501223_000493 | Ga0501223_000493_5675_6838 | 386 |
| 564 | 3300049664 | Ga0501224_000255 | Ga0501224_000255_2062_3225 | 386 |
| 565 | 3300049668 | Ga0501233_002221 | Ga0501233_002221_205_1368 | 386 |
| 566 | 3300049669 | Ga0501235_000488 | Ga0501235_000488_2864_4027 | 386 |
| 567 | 3300049674 | Ga0501242_000805 | Ga0501242_000805_108_1271 | 386 |
| 568 | 3300049688 | Ga0501259_000401 | Ga0501259_000401_5350_6513 | 386 |
| 569 | 3300049704 | Ga0501221_000844 | Ga0501221_000844_3459_4622 | 386 |
| 570 | 3300049705 | Ga0501225_0000846 | Ga0501225_0000846_7435_8598 | 386 |
| 571 | 3300049705 | Ga0501225_0016895 | Ga0501225_0016895_100_1323 | 386 |
| 572 | 3300049708 | Ga0501245_000641 | Ga0501245_000641_2605_3768 | 386 |
| 573 | 3300049768 | Ga0501271_000609 | Ga0501271_000609_1776_2939 | 386 |
| 574 | 3300049822 | Ga0501035_0024149 | Ga0501035_0024149_2163_3344 | 386 |
| 575 | 3300049823 | Ga0501044_0008339 | Ga0501044_0008339_2909_4090 | 386 |
| 576 | 3300003323 | rootH1_10005690 | rootH1_1000569010 | 387 |
| 577 | 3300005334 | Ga0068869_100043465 | Ga0068869_1000434653 | 387 |
| 578 | 3300005577 | Ga0068857_100005164 | Ga0068857_10000516412 | 387 |
| 579 | 3300013102 | Ga0157371_10038253 | Ga0157371_100382533 | 387 |
| 580 | 3300014326 | Ga0157380_10265741 | Ga0157380_102657411 | 387 |
| 581 | 3300025284 | Ga0209130_1003135 | Ga0209130_10031353 | 387 |
| 582 | 3300025302 | Ga0207426_1000051 | Ga0207426_1000051223 | 387 |
| 583 | 3300025942 | Ga0207689_10010064 | Ga0207689_100100642 | 387 |
| 584 | 3300025972 | Ga0207668_10012966 | Ga0207668_100129663 | 387 |
| 585 | 3300044656 | Ga0466969_0052312 | Ga0466969_0052312_127_1290 | 387 |
| 586 | 3300044673 | Ga0453683_0049421 | Ga0453683_0049421_520_1683 | 387 |
| 587 | 3300044712 | Ga0453684_0103123 | Ga0453684_0103123_298_1461 | 387 |
| 588 | 3300044712 | Ga0453684_0291321 | Ga0453684_0291321_467_1630 | 387 |
| 589 | 3300045051 | Ga0451576_0000375 | Ga0451576_0000375_102823_103986 | 387 |
| 590 | 3300045051 | Ga0451576_0058216 | Ga0451576_0058216_1715_2878 | 387 |
| 591 | 3300049758 | Ga0501241_014825 | Ga0501241_014825_37_1200 | 387 |
| 592 | 3300001979 | JGI24740J21852_10011458 | JGI24740J21852_100114583 | 388 |
| 593 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_100000730 | 388 |
| 594 | 3300003320 | rootH2_10030196 | rootH2_100301962 | 388 |
| 595 | 3300003354 | JGI25160J50197_1001556 | JGI25160J50197_100155610 | 388 |
| 596 | 3300003354 | JGI25160J50197_1010899 | JGI25160J50197_10108993 | 388 |
| 597 | 3300003761 | Ga0055535_1005833 | Ga0055535_10058333 | 388 |
| 598 | 3300003790 | Ga0055528_1001519 | Ga0055528_10015193 | 388 |
| 599 | 3300003794 | Ga0055531_10000020 | Ga0055531_1000002054 | 388 |
| 600 | 3300005262 | Ga0065165_1000010 | Ga0065165_1000010263 | 388 |
| 601 | 3300005289 | Ga0065704_10096912 | Ga0065704_100969122 | 388 |
| 602 | 3300005347 | Ga0070668_100060261 | Ga0070668_1000602612 | 388 |
| 603 | 3300005354 | Ga0070675_100017829 | Ga0070675_1000178292 | 388 |
| 604 | 3300005364 | Ga0070673_100049558 | Ga0070673_1000495583 | 388 |
| 605 | 3300005719 | Ga0068861_100153289 | Ga0068861_1001532892 | 388 |
| 606 | 3300006195 | Ga0075366_10015955 | Ga0075366_100159552 | 388 |
| 607 | 3300014326 | Ga0157380_10137805 | Ga0157380_101378052 | 388 |
| 608 | 3300025242 | Ga0209258_100293 | Ga0209258_10029354 | 388 |
| 609 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002636 | 388 |
| 610 | 3300025250 | Ga0209026_1000524 | Ga0209026_100052414 | 388 |
| 611 | 3300025254 | Ga0209148_1000278 | Ga0209148_100027822 | 388 |
| 612 | 3300025273 | Ga0209673_1000530 | Ga0209673_100053044 | 388 |
| 613 | 3300025295 | Ga0209564_1038777 | Ga0209564_10387771 | 388 |
| 614 | 3300025297 | Ga0209758_1007117 | Ga0209758_10071176 | 388 |
| 615 | 3300025297 | Ga0209758_1044976 | Ga0209758_10449761 | 388 |
| 616 | 3300025297 | Ga0209758_1059768 | Ga0209758_10597681 | 388 |
| 617 | 3300025298 | Ga0209050_1000134 | Ga0209050_100013415 | 388 |
| 618 | 3300025302 | Ga0207426_1000841 | Ga0207426_100084119 | 388 |
| 619 | 3300025302 | Ga0207426_1001206 | Ga0207426_10012061 | 388 |
| 620 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011330 | 388 |
| 621 | 3300025304 | Ga0209257_1001323 | Ga0209257_10013235 | 388 |
| 622 | 3300025893 | Ga0207682_10050505 | Ga0207682_100505051 | 388 |
| 623 | 3300025940 | Ga0207691_10037596 | Ga0207691_100375962 | 388 |
| 624 | 3300025960 | Ga0207651_10130679 | Ga0207651_101306792 | 388 |
| 625 | 3300031251 | Ga0265327_10005050 | Ga0265327_100050502 | 388 |
| 626 | 3300031712 | Ga0265342_10027866 | Ga0265342_100278663 | 388 |
| 627 | 3300031727 | Ga0316576_10118081 | Ga0316576_101180812 | 388 |
| 628 | 3300041997 | Ga0439431_0000679 | Ga0439431_0000679_4639_5823 | 388 |
| 629 | 3300041997 | Ga0439431_0004552 | Ga0439431_0004552_347_1513 | 388 |
| 630 | 3300044712 | Ga0453684_0066495 | Ga0453684_0066495_3152_4327 | 388 |
| 631 | 3300045051 | Ga0451576_0064794 | Ga0451576_0064794_1915_3081 | 388 |
| 632 | 3300046453 | Ga0495627_015663 | Ga0495627_015663_984_2150 | 388 |
| 633 | 3300046558 | Ga0495633_0000090 | Ga0495633_0000090_96585_97751 | 388 |
| 634 | 3300049571 | Ga0501034_0047612 | Ga0501034_0047612_2233_3417 | 388 |
| 635 | 3300049823 | Ga0501044_0042041 | Ga0501044_0042041_370_1542 | 388 |
| 636 | 3300049823 | Ga0501044_0059938 | Ga0501044_0059938_1154_2335 | 388 |
| 637 | 3300053088 | Ga0500644_0000119 | Ga0500644_0000119_7595_8761 | 388 |
| 638 | 3300053093 | Ga0500651_0015723 | Ga0500651_0015723_220_1386 | 388 |
| 639 | 3300053109 | Ga0500569_000066 | Ga0500569_000066_12420_13586 | 388 |
| 640 | 3300053134 | Ga0500658_0004173 | Ga0500658_0004173_270_1436 | 388 |
| 641 | 3300053136 | Ga0500559_0061405 | Ga0500559_0061405_418_1584 | 388 |
| 642 | 3300053153 | Ga0500616_0014645 | Ga0500616_0014645_1326_2492 | 388 |
| 643 | 3300053156 | Ga0500622_0000929 | Ga0500622_0000929_5429_6595 | 388 |
| 644 | 3300053161 | Ga0500634_0040806 | Ga0500634_0040806_1256_2422 | 388 |
| 645 | 3300055283 | Ga0500661_001909 | Ga0500661_001909_76_1242 | 388 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6l1n-assembly1.cif.gz_A | substrate bound bacf structure from bacillus subtillis | 0.9573 | 1 | 384 |
| 6l1l-assembly1.cif.gz_A | apo-bacf structure from bacillus subtillis | 0.956 | 1 | 384 |
| 6l1o-assembly1.cif.gz_B | product bound bacf structure from bacillus subtillis | 0.9503 | 1 | 384 |
| 6l1n-assembly1.cif.gz_B | substrate bound bacf structure from bacillus subtillis | 0.9485 | 1 | 384 |
| 6l1n-assembly1.cif.gz_A | substrate bound bacf structure from bacillus subtillis | 0.9453 | 1 | 384 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58786_71_297_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.959 | 59 | 284 | 3.40.640.10 |
| af_Q58786_71_297_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9508 | 59 | 284 | 3.40.640.10 |
| 2o1bA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9502 | 65 | 285 | 3.40.640.10 |
| af_A0A0R0HS10_77_301_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9484 | 64 | 285 | 3.40.640.10 |
| 2o1bA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.946 | 65 | 285 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6ADX2-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.9857 | 41 | 386 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A348Y621-F1-model_v4 | deleted | 0.9824 | 2 | 331 |
|
| AF-A0A348Y621-F1-model_v4 | deleted | 0.9794 | 2 | 331 |
|
| AF-A0A4Q3NYQ4-F1-model_v4 | deleted | 0.9747 | 104 | 383 |
|
| AF-A0A3D1E6C4-F1-model_v4 | Aminotransferase | 0.9729 | 270 | 383 |
GO:0008483
GO:0009058 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar