F472049

General Info

Members Datasets Scaffolds Average Seq Length
644 274 1288 68

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10214007|Ga0207693_102140072
Length 83
Sequence MPRCSHRTTRAASGIRVKFFEINLFGVYVAPISVMMVAAWIVTVASRRVADRFDLLRHVWHPALFVFSVYIIVLSSMVLVIAH

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
98 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 0
Rhizoplane 4.66
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 21.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10214007 3300025915 Bacteria 1514
2 LJQas_1001938 3300000549 Bacteria 2988
3 Ga0065704_10252793 3300005289 Bacteria 979
4 Ga0065712_10394877 3300005290 Bacteria 737
5 Ga0065715_10783504 3300005293 Bacteria 617
6 Ga0065707_10014879 3300005295 Bacteria 1955
7 Ga0070683_100170516 3300005329 Bacteria 2066
8 Ga0070683_102403333 3300005329 Unclassified 505
9 Ga0070677_10515472 3300005333 Bacteria 650
10 Ga0068869_100040232 3300005334 Bacteria 3342
11 Ga0068869_101866158 3300005334 Bacteria 538
12 Ga0070689_100406318 3300005340 Unclassified 1152
13 Ga0070687_100222447 3300005343 Bacteria 1157
14 Ga0070687_100407324 3300005343 Unclassified 893
15 Ga0070668_100020199 3300005347 Bacteria 5023
16 Ga0070668_100047154 3300005347 Bacteria 3312
17 Ga0070668_100192858 3300005347 Bacteria 1669
18 Ga0070668_100390428 3300005347 Bacteria 1186
19 Ga0070668_100432048 3300005347 Bacteria 1129
20 Ga0070668_100495146 3300005347 Bacteria 1057
21 Ga0070668_102224893 3300005347 Unclassified 507
22 Ga0070669_100067381 3300005353 Bacteria 2641
23 Ga0070669_100129714 3300005353 Bacteria 1933
24 Ga0070675_100489461 3300005354 Bacteria 1107
25 Ga0070675_100558094 3300005354 Bacteria 1036
26 Ga0070674_101789757 3300005356 Unclassified 557
27 Ga0070674_101864994 3300005356 Bacteria 546
28 Ga0070659_100797178 3300005366 Archaea 821
29 Ga0070667_100132273 3300005367 Bacteria 2179
30 Ga0070709_10023975 3300005434 Bacteria 3589
31 Ga0070709_10142763 3300005434 Bacteria 1647
32 Ga0070709_10678148 3300005434 Bacteria 800
33 Ga0070709_10894670 3300005434 Unclassified 702
34 Ga0070709_11378723 3300005434 Unclassified 570
35 Ga0070714_100056053 3300005435 Bacteria 3370
36 Ga0070714_101362267 3300005435 Bacteria 693
37 Ga0070713_100037793 3300005436 Bacteria 3905
38 Ga0070713_100113103 3300005436 Bacteria 2369
39 Ga0070713_100232909 3300005436 Bacteria 1675
40 Ga0070713_100462547 3300005436 Bacteria 1193
41 Ga0070713_100737714 3300005436 Bacteria 942
42 Ga0070713_100892997 3300005436 Unclassified 854
43 Ga0070713_101450412 3300005436 Bacteria 666
44 Ga0070710_10022702 3300005437 Bacteria 3286
45 Ga0070710_10210722 3300005437 Bacteria 1232
46 Ga0070710_10600866 3300005437 Bacteria 766
47 Ga0070710_10629852 3300005437 Bacteria 750
48 Ga0070710_10876388 3300005437 Bacteria 646
49 Ga0070710_11154509 3300005437 Bacteria 571
50 Ga0070701_10462978 3300005438 Bacteria 816
51 Ga0070711_100068841 3300005439 Bacteria 2488
52 Ga0070711_100214672 3300005439 Bacteria 1492
53 Ga0070711_100292943 3300005439 Unclassified 1291
54 Ga0070711_100937605 3300005439 Bacteria 740
55 Ga0070711_101752070 3300005439 Bacteria 545
56 Ga0070711_101855549 3300005439 Bacteria 529
57 Ga0070705_101703921 3300005440 Bacteria 533
58 Ga0070700_100274608 3300005441 Bacteria 1219
59 Ga0070700_101677374 3300005441 Unclassified 545
60 Ga0070700_101816499 3300005441 Bacteria 525
61 Ga0070694_101934472 3300005444 Bacteria 504
62 Ga0070708_100027962 3300005445 Bacteria 4846
63 Ga0070708_100095336 3300005445 Bacteria 2716
64 Ga0070708_100181281 3300005445 Bacteria 1968
65 Ga0070663_101230288 3300005455 Bacteria 659
66 Ga0070678_100641214 3300005456 Unclassified 952
67 Ga0070678_101024073 3300005456 Bacteria 760
68 Ga0070662_101075887 3300005457 Bacteria 690
69 Ga0070662_101983397 3300005457 Bacteria 503
70 Ga0070681_10059386 3300005458 Bacteria 3804
71 Ga0068867_101816932 3300005459 Bacteria 573
72 Ga0068867_102226215 3300005459 Bacteria 520
73 Ga0070706_100065620 3300005467 Bacteria 3357
74 Ga0070706_100067265 3300005467 Bacteria 3314
75 Ga0070706_100089927 3300005467 Bacteria 2847
76 Ga0070706_100119540 3300005467 Bacteria 2456
77 Ga0070706_100643275 3300005467 Bacteria 985
78 Ga0070707_100102088 3300005468 Bacteria 2779
79 Ga0070707_100153728 3300005468 Bacteria 2241
80 Ga0070707_100205945 3300005468 Unclassified 1917
81 Ga0070707_100498057 3300005468 Bacteria 1180
82 Ga0070707_102120527 3300005468 Bacteria 530
83 Ga0070698_100010056 3300005471 Bacteria 10102
84 Ga0070698_100053185 3300005471 Bacteria 4116
85 Ga0070698_100070655 3300005471 Bacteria 3503
86 Ga0070698_100076166 3300005471 Bacteria 3357
87 Ga0070698_100315595 3300005471 Bacteria 1494
88 Ga0070698_100488528 3300005471 Bacteria 1169
89 Ga0070698_100983228 3300005471 Bacteria 791
90 Ga0070698_101586166 3300005471 Unclassified 606
91 Ga0070699_100337731 3300005518 Unclassified 1355
92 Ga0070699_100503138 3300005518 Bacteria 1101
93 Ga0070699_100516596 3300005518 Bacteria 1085
94 Ga0070699_100956939 3300005518 Bacteria 785
95 Ga0070679_101678026 3300005530 Unclassified 583
96 Ga0070684_100190488 3300005535 Bacteria 1866
97 Ga0070697_100116712 3300005536 Bacteria 2229
98 Ga0070697_100218468 3300005536 Bacteria 1624
99 Ga0070697_100692717 3300005536 Bacteria 899
100 Ga0070697_101145558 3300005536 Bacteria 693
101 Ga0070697_101203297 3300005536 Bacteria 675
102 Ga0070697_101811382 3300005536 Unclassified 546
103 Ga0070697_102023787 3300005536 Unclassified 515
104 Ga0070695_100000376 3300005545 Bacteria 22956
105 Ga0070695_100159473 3300005545 Unclassified 1582
106 Ga0070696_100079321 3300005546 Bacteria 2323
107 Ga0070696_101234299 3300005546 Bacteria 633
108 Ga0070665_100099398 3300005548 Bacteria 2914
109 Ga0070704_100067125 3300005549 Bacteria 2589
110 Ga0070704_100316176 3300005549 Bacteria 1306
111 Ga0070704_100738439 3300005549 Bacteria 876
112 Ga0070704_101008264 3300005549 Bacteria 753
113 Ga0070664_100434945 3300005564 Bacteria 1203
114 Ga0070664_102064725 3300005564 Unclassified 541
115 Ga0068856_102157827 3300005614 Unclassified 566
116 Ga0068859_100089986 3300005617 Bacteria 3120
117 Ga0068864_100132501 3300005618 Unclassified 2241
118 Ga0068864_100470896 3300005618 Bacteria 1204
119 Ga0068864_101238761 3300005618 Bacteria 745
120 Ga0068866_10190002 3300005718 Unclassified 1219
121 Ga0068866_11024816 3300005718 Bacteria 587
122 Ga0068866_11312380 3300005718 Unclassified 526
123 Ga0068861_100040156 3300005719 Bacteria 3497
124 Ga0068861_101056329 3300005719 Bacteria 778
125 Ga0068861_101714180 3300005719 Bacteria 622
126 Ga0068870_11084265 3300005840 Unclassified 575
127 Ga0068863_100052171 3300005841 Bacteria 3876
128 Ga0068858_100261575 3300005842 Bacteria 1645
129 Ga0068860_100040800 3300005843 Bacteria 4434
130 Ga0068860_100063119 3300005843 Bacteria 3519
131 Ga0068860_101768881 3300005843 Bacteria 640
132 Ga0068860_101999056 3300005843 Unclassified 601
133 Ga0068862_100002908 3300005844 Bacteria 14974
134 Ga0068862_100023607 3300005844 Bacteria 5154
135 Ga0068862_100398174 3300005844 Bacteria 1287
136 Ga0068862_100677270 3300005844 Unclassified 997
137 Ga0068862_100877724 3300005844 Bacteria 880
138 Ga0081455_10041727 3300005937 Bacteria 4032
139 Ga0081455_10207538 3300005937 Unclassified 1462
140 Ga0081455_10372235 3300005937 Unclassified 1001
141 Ga0081538_10030887 3300005981 Bacteria 3627
142 Ga0081540_1000205 3300005983 Bacteria 61689
143 Ga0081540_1012926 3300005983 Bacteria 5455
144 Ga0081540_1045680 3300005983 Bacteria 2221
145 Ga0081539_10376875 3300005985 Bacteria 592
146 Ga0070717_10060296 3300006028 Bacteria 3142
147 Ga0070717_10165231 3300006028 Bacteria 1922
148 Ga0070717_10187820 3300006028 Unclassified 1804
149 Ga0070717_10250662 3300006028 Bacteria 1564
150 Ga0070717_10780772 3300006028 Bacteria 869
151 Ga0070717_11798606 3300006028 Bacteria 554
152 Ga0075365_10124411 3300006038 Bacteria 1781
153 Ga0075368_10430757 3300006042 Unclassified 582
154 Ga0075364_10995346 3300006051 Bacteria 570
155 Ga0070715_10039896 3300006163 Unclassified 1959
156 Ga0070715_10059714 3300006163 Bacteria 1669
157 Ga0070715_10084397 3300006163 Unclassified 1448
158 Ga0070715_10291999 3300006163 Bacteria 869
159 Ga0070715_10565627 3300006163 Bacteria 661
160 Ga0070715_11063663 3300006163 Bacteria 508
161 Ga0070716_100241931 3300006173 Bacteria 1224
162 Ga0070716_100484988 3300006173 Unclassified 908
163 Ga0070716_100649390 3300006173 Unclassified 800
164 Ga0070716_100783594 3300006173 Bacteria 737
165 Ga0070716_100891015 3300006173 Unclassified 696
166 Ga0070716_101603320 3300006173 Unclassified 534
167 Ga0070712_100090687 3300006175 Unclassified 2238
168 Ga0070712_100122172 3300006175 Unclassified 1961
169 Ga0070712_100130702 3300006175 Bacteria 1902
170 Ga0070712_100180994 3300006175 Bacteria 1642
171 Ga0070712_100202034 3300006175 Unclassified 1562
172 Ga0070712_100213325 3300006175 Bacteria 1524
173 Ga0070712_100351747 3300006175 Bacteria 1206
174 Ga0070712_100541759 3300006175 Unclassified 980
175 Ga0070712_101193984 3300006175 Unclassified 662
176 Ga0070712_101354358 3300006175 Bacteria 621
177 Ga0075362_10018853 3300006177 Bacteria 2861
178 Ga0075362_10223320 3300006177 Bacteria 921
179 Ga0075367_10065667 3300006178 Bacteria 2173
180 Ga0075367_10365470 3300006178 Bacteria 911
181 Ga0075367_10604034 3300006178 Bacteria 697
182 Ga0075369_10011214 3300006186 Bacteria 3521
183 Ga0075366_10996225 3300006195 Bacteria 523
184 Ga0097621_100296497 3300006237 Bacteria 1427
185 Ga0068871_100955266 3300006358 Bacteria 796
186 Ga0075428_100006487 3300006844 Bacteria 13012
187 Ga0075428_100817889 3300006844 Bacteria 990
188 Ga0075428_101024003 3300006844 Bacteria 874
189 Ga0075428_101204935 3300006844 Unclassified 798
190 Ga0075431_100411465 3300006847 Bacteria 1352
191 Ga0075431_100717160 3300006847 Bacteria 977
192 Ga0075431_100767021 3300006847 Bacteria 939
193 Ga0075433_10803575 3300006852 Archaea 822
194 Ga0075434_100041876 3300006871 Bacteria 4539
195 Ga0075434_100202007 3300006871 Unclassified 2008
196 Ga0075434_100417074 3300006871 Unclassified 1363
197 Ga0075434_101099496 3300006871 Bacteria 808
198 Ga0075434_101939883 3300006871 Unclassified 594
199 Ga0075429_101220840 3300006880 Bacteria 656
200 Ga0068865_100433361 3300006881 Unclassified 1083
201 Ga0075436_100354079 3300006914 Bacteria 1058
202 Ga0097620_100089985 3300006931 Bacteria 3120
203 Ga0075435_100058271 3300007076 Bacteria 3127
204 Ga0075435_100081290 3300007076 Bacteria 2661
205 Ga0075435_100184191 3300007076 Unclassified 1766
206 Ga0075435_100332218 3300007076 Bacteria 1302
207 Ga0075435_101374094 3300007076 Bacteria 619
208 Ga0075435_101765113 3300007076 Unclassified 543
209 Ga0075435_101919179 3300007076 Bacteria 520
210 Ga0099794_10008698 3300007265 Bacteria 4229
211 Ga0099794_10108594 3300007265 Bacteria 1389
212 Ga0099794_10395441 3300007265 Unclassified 722
213 Ga0099795_10050148 3300007788 Bacteria 1517
214 Ga0099795_10060874 3300007788 Unclassified 1400
215 Ga0099795_10094886 3300007788 Bacteria 1162
216 Ga0099795_10143143 3300007788 Unclassified 974
217 Ga0099795_10157307 3300007788 Bacteria 935
218 Ga0099795_10415902 3300007788 Bacteria 613
219 Ga0099795_10439007 3300007788 Bacteria 599
220 Ga0105250_10011368 3300009092 Bacteria 3693
221 Ga0105240_10993078 3300009093 Bacteria 898
222 Ga0111539_10739025 3300009094 Unclassified 1145
223 Ga0111539_10832802 3300009094 Bacteria 1074
224 Ga0111539_10842557 3300009094 Unclassified 1067
225 Ga0111539_10923870 3300009094 Unclassified 1015
226 Ga0111539_11427517 3300009094 Unclassified 803
227 Ga0111539_11906424 3300009094 Unclassified 689
228 Ga0111539_12162176 3300009094 Unclassified 646
229 Ga0111539_13291762 3300009094 Unclassified 520
230 Ga0105247_10242467 3300009101 Bacteria 1229
231 Ga0105247_10538796 3300009101 Bacteria 856
232 Ga0105247_10553676 3300009101 Bacteria 846
233 Ga0114129_10512505 3300009147 Bacteria 1565
234 Ga0114129_11488188 3300009147 Unclassified 832
235 Ga0105243_10380667 3300009148 Bacteria 1305
236 Ga0105243_10458021 3300009148 Bacteria 1198
237 Ga0105243_12564151 3300009148 Bacteria 549
238 Ga0105241_10229483 3300009174 Bacteria 1564
239 Ga0105241_11176903 3300009174 Bacteria 725
240 Ga0105242_10198536 3300009176 Bacteria 1780
241 Ga0105242_10270834 3300009176 Bacteria 1538
242 Ga0105248_11799704 3300009177 Bacteria 695
243 Ga0105248_12094629 3300009177 Unclassified 643
244 Ga0105238_10019318 3300009551 Bacteria 6941
245 Ga0105238_12789123 3300009551 Unclassified 525
246 Ga0105249_10112394 3300009553 Bacteria 2576
247 Ga0105249_10212334 3300009553 Bacteria 1900
248 Ga0105249_10220558 3300009553 Unclassified 1866
249 Ga0105249_10552059 3300009553 Unclassified 1203
250 Ga0105249_10923720 3300009553 Bacteria 940
251 Ga0105249_11891077 3300009553 Unclassified 669
252 Ga0105249_11963435 3300009553 Bacteria 658
253 Ga0099796_10188683 3300010159 Bacteria 831
254 Ga0099796_10234893 3300010159 Bacteria 756
255 Ga0099796_10334037 3300010159 Bacteria 650
256 Ga0099796_10417196 3300010159 Bacteria 591
257 Ga0099796_10570181 3300010159 Unclassified 509
258 Ga0105239_10930622 3300010375 Bacteria 998
259 Ga0105239_11629869 3300010375 Bacteria 746
260 Ga0105239_12395488 3300010375 Unclassified 615
261 Ga0105239_13047428 3300010375 Unclassified 546
262 Ga0105246_10637400 3300011119 Unclassified 926
263 Ga0105246_12079797 3300011119 Bacteria 550
264 Ga0157341_1040294 3300012494 Bacteria 539
265 Ga0157342_1011799 3300012507 Bacteria 912
266 Ga0157370_11564638 3300013104 Unclassified 592
267 Ga0157378_10252074 3300013297 Bacteria 1690
268 Ga0157378_10792063 3300013297 Unclassified 973
269 Ga0157378_11602771 3300013297 Bacteria 697
270 Ga0163162_10248405 3300013306 Unclassified 1911
271 Ga0163162_10267917 3300013306 Bacteria 1839
272 Ga0163162_10622229 3300013306 Bacteria 1205
273 Ga0163162_11099416 3300013306 Unclassified 901
274 Ga0163162_11354274 3300013306 Unclassified 809
275 Ga0163162_11457925 3300013306 Bacteria 779
276 Ga0163162_11607785 3300013306 Bacteria 741
277 Ga0163162_12711522 3300013306 Bacteria 570
278 Ga0163162_13168838 3300013306 Unclassified 528
279 Ga0157375_11452554 3300013308 Bacteria 809
280 Ga0157375_11476976 3300013308 Bacteria 802
281 Ga0157375_12754674 3300013308 Bacteria 588
282 Ga0163163_12678046 3300014325 Unclassified 556
283 Ga0157380_13174601 3300014326 Unclassified 525
284 Ga0157379_10299944 3300014968 Bacteria 1464
285 Ga0157379_10426582 3300014968 Bacteria 1222
286 Ga0157379_11797763 3300014968 Unclassified 602
287 Ga0157376_11660263 3300014969 Unclassified 674
288 Ga0163161_10535645 3300017792 Bacteria 958
289 Ga0163161_10558460 3300017792 Bacteria 939
290 Ga0163161_10955561 3300017792 Unclassified 729
291 Ga0163161_11471983 3300017792 Bacteria 597
292 Ga0163161_11715060 3300017792 Unclassified 557
293 Ga0213873_10144586 3300021358 Bacteria 712
294 Ga0213873_10238999 3300021358 Bacteria 573
295 Ga0213872_10030107 3300021361 Bacteria 2489
296 Ga0213872_10033419 3300021361 Unclassified 2357
297 Ga0213872_10176979 3300021361 Bacteria 923
298 Ga0213872_10230374 3300021361 Bacteria 786
299 Ga0213874_10020427 3300021377 Bacteria 1816
300 Ga0213874_10062556 3300021377 Bacteria 1169
301 Ga0213874_10082650 3300021377 Bacteria 1043
302 Ga0213876_10366225 3300021384 Bacteria 767
303 Ga0213871_10002412 3300021441 Bacteria 3431
304 Ga0213871_10045133 3300021441 Unclassified 1193
305 Ga0213871_10078594 3300021441 Bacteria 942
306 Ga0213871_10084866 3300021441 Unclassified 911
307 Ga0224572_1013830 3300024225 Bacteria 1540
308 Ga0228598_1015402 3300024227 Bacteria 1510
309 Ga0207426_1039940 3300025302 Bacteria 1466
310 Ga0207696_1181157 3300025711 Bacteria 557
311 Ga0207653_10023969 3300025885 Bacteria 1946
312 Ga0207692_10042872 3300025898 Bacteria 2248
313 Ga0207692_10089997 3300025898 Unclassified 1662
314 Ga0207692_10129442 3300025898 Bacteria 1423
315 Ga0207692_10134321 3300025898 Bacteria 1401
316 Ga0207692_10699370 3300025898 Bacteria 658
317 Ga0207642_10873630 3300025899 Unclassified 575
318 Ga0207647_10260588 3300025904 Bacteria 993
319 Ga0207685_10002786 3300025905 Bacteria 4092
320 Ga0207685_10296088 3300025905 Bacteria 799
321 Ga0207685_10298068 3300025905 Bacteria 797
322 Ga0207685_10389904 3300025905 Bacteria 711
323 Ga0207699_10210793 3300025906 Archaea 1321
324 Ga0207699_10217078 3300025906 Bacteria 1304
325 Ga0207699_10357584 3300025906 Bacteria 1032
326 Ga0207645_11104054 3300025907 Bacteria 535
327 Ga0207684_10021345 3300025910 Bacteria 5528
328 Ga0207684_10026581 3300025910 Bacteria 4934
329 Ga0207684_10096343 3300025910 Bacteria 2525
330 Ga0207684_10209441 3300025910 Bacteria 1682
331 Ga0207684_10556945 3300025910 Bacteria 981
332 Ga0207684_11185856 3300025910 Bacteria 633
333 Ga0207654_11004116 3300025911 Unclassified 607
334 Ga0207707_10156343 3300025912 Bacteria 1994
335 Ga0207671_11354390 3300025914 Bacteria 553
336 Ga0207693_10013328 3300025915 Bacteria 6629
337 Ga0207693_10015107 3300025915 Bacteria 6197
338 Ga0207693_10030807 3300025915 Bacteria 4237
339 Ga0207693_10091475 3300025915 Unclassified 2385
340 Ga0207693_10201325 3300025915 Unclassified 1566
341 Ga0207693_10251937 3300025915 Bacteria 1385
342 Ga0207693_10305102 3300025915 Bacteria 1247
343 Ga0207693_10556013 3300025915 Unclassified 895
344 Ga0207693_10626739 3300025915 Unclassified 836
345 Ga0207693_10638577 3300025915 Unclassified 827
346 Ga0207663_10020174 3300025916 Bacteria 3771
347 Ga0207663_10028558 3300025916 Bacteria 3266
348 Ga0207663_10978080 3300025916 Bacteria 678
349 Ga0207663_11191681 3300025916 Unclassified 613
350 Ga0207663_11523469 3300025916 Unclassified 538
351 Ga0207646_10024006 3300025922 Bacteria 5592
352 Ga0207646_10278614 3300025922 Unclassified 1511
353 Ga0207646_10370938 3300025922 Bacteria 1293
354 Ga0207646_10429525 3300025922 Bacteria 1192
355 Ga0207681_10160272 3300025923 Bacteria 1695
356 Ga0207694_10007721 3300025924 Bacteria 8150
357 Ga0207687_11674031 3300025927 Bacteria 545
358 Ga0207700_10053692 3300025928 Bacteria 3021
359 Ga0207700_10082891 3300025928 Bacteria 2509
360 Ga0207700_10527086 3300025928 Unclassified 1047
361 Ga0207664_10350714 3300025929 Unclassified 1306
362 Ga0207664_10387245 3300025929 Bacteria 1242
363 Ga0207664_10723356 3300025929 Bacteria 895
364 Ga0207644_10819723 3300025931 Bacteria 779
365 Ga0207706_10048727 3300025933 Bacteria 3747
366 Ga0207706_11173804 3300025933 Bacteria 639
367 Ga0207686_10123882 3300025934 Bacteria 1763
368 Ga0207686_10548386 3300025934 Bacteria 903
369 Ga0207709_10431309 3300025935 Bacteria 1015
370 Ga0207709_11321993 3300025935 Bacteria 596
371 Ga0207669_11250704 3300025937 Bacteria 630
372 Ga0207704_10529549 3300025938 Bacteria 954
373 Ga0207665_10007221 3300025939 Bacteria 7352
374 Ga0207665_10062580 3300025939 Bacteria 2525
375 Ga0207665_10106726 3300025939 Bacteria 1963
376 Ga0207665_10146559 3300025939 Bacteria 1687
377 Ga0207665_10459679 3300025939 Bacteria 978
378 Ga0207665_10846481 3300025939 Unclassified 724
379 Ga0207665_11168318 3300025939 Bacteria 614
380 Ga0207711_10742891 3300025941 Bacteria 915
381 Ga0207689_10011121 3300025942 Bacteria 7727
382 Ga0207679_10301446 3300025945 Bacteria 1381
383 Ga0207712_10210711 3300025961 Bacteria 1547
384 Ga0207712_10868930 3300025961 Unclassified 796
385 Ga0207668_10016600 3300025972 Bacteria 4597
386 Ga0207668_10047200 3300025972 Bacteria 2947
387 Ga0207668_10109007 3300025972 Bacteria 2073
388 Ga0207668_10311192 3300025972 Bacteria 1304
389 Ga0207668_10368933 3300025972 Bacteria 1205
390 Ga0207668_11681240 3300025972 Bacteria 573
391 Ga0207640_11911415 3300025981 Bacteria 537
392 Ga0207658_10089464 3300025986 Bacteria 2384
393 Ga0207677_11011511 3300026023 Bacteria 754
394 Ga0207677_11232314 3300026023 Bacteria 685
395 Ga0207703_10318537 3300026035 Bacteria 1423
396 Ga0207678_10342949 3300026067 Bacteria 1287
397 Ga0207678_10506175 3300026067 Bacteria 1053
398 Ga0207708_10343826 3300026075 Bacteria 1222
399 Ga0207641_10014342 3300026088 Bacteria 6495
400 Ga0207648_11229543 3300026089 Unclassified 704
401 Ga0207648_11866511 3300026089 Unclassified 562
402 Ga0207676_10570122 3300026095 Bacteria 1084
403 Ga0207676_11275493 3300026095 Bacteria 729
404 Ga0207675_100029894 3300026118 Bacteria 5072
405 Ga0207675_100493707 3300026118 Bacteria 1218
406 Ga0207683_10908521 3300026121 Bacteria 818
407 Ga0207683_11120435 3300026121 Unclassified 730
408 Ga0209179_1003659 3300027512 Bacteria 2240
409 Ga0209179_1075074 3300027512 Bacteria 743
410 Ga0209179_1131269 3300027512 Unclassified 560
411 Ga0209588_1015049 3300027671 Bacteria 2376
412 Ga0207428_10419509 3300027907 Unclassified 978
413 Ga0268266_10011169 3300028379 Bacteria 7817
414 Ga0268266_10055026 3300028379 Bacteria 3420
415 Ga0268265_10004700 3300028380 Bacteria 9424
416 Ga0268265_10156850 3300028380 Bacteria 1927
417 Ga0268265_10727855 3300028380 Bacteria 961
418 Ga0268265_11321166 3300028380 Bacteria 721
419 Ga0268264_10048621 3300028381 Bacteria 3528
420 Ga0268264_10181734 3300028381 Bacteria 1911
421 Ga0265763_1020114 3300030763 Bacteria 696
422 Ga0265763_1027745 3300030763 Unclassified 629
423 Ga0265760_10116007 3300031090 Bacteria 856
424 Ga0265328_10004882 3300031239 Bacteria 5775
425 Ga0265328_10027623 3300031239 Bacteria 2126
426 Ga0265331_10004681 3300031250 Bacteria 8470
427 Ga0265327_10014669 3300031251 Bacteria 5113
428 Ga0265327_10157465 3300031251 Bacteria 1051
429 Ga0265316_10082178 3300031344 Bacteria 2468
430 Ga0265316_10246600 3300031344 Bacteria 1312
431 Ga0307513_10489174 3300031456 Bacteria 949
432 Ga0373944_0101388 3300035089 Bacteria 973
433 Ga0373923_0348685 3300035111 Unclassified 707
434 Ga0373932_0038020 3300035112 Bacteria 1375
435 Ga0373945_0167935 3300035116 Bacteria 898
436 Ga0373945_0255757 3300035116 Unclassified 741
437 Ga0373945_0373210 3300035116 Bacteria 622
438 Ga0373943_0241919 3300035170 Bacteria 1011
439 Ga0373935_0259425 3300035692 Bacteria 1219
440 Ga0373927_0279926 3300035695 Bacteria 1097
441 Ga0373927_0341243 3300035695 Bacteria 987
442 Ga0373927_0365883 3300035695 Bacteria 951
443 Ga0373947_0523978 3300035725 Bacteria 806
444 Ga0373937_0126367 3300036401 Bacteria 2386
445 Ga0373937_0175285 3300036401 Bacteria 2013
446 Ga0373925_0452561 3300037068 Bacteria 1051
447 Ga0373925_0887982 3300037068 Bacteria 735
448 Ga0395900_0748916 3300037418 Bacteria 907
449 Ga0436364_0114715 3300037853 Bacteria 3833
450 Ga0436364_0407950 3300037853 Bacteria 1225
451 Ga0436364_1119997 3300037853 Bacteria 2562
452 Ga0436364_1254522 3300037853 Bacteria 639
453 Ga0395901_0107464 3300038443 Bacteria 2929
454 Ga0436365_0243053 3300039437 Bacteria 1507
455 Ga0436365_0806122 3300039437 Unclassified 709
456 Ga0436365_0917584 3300039437 Bacteria 796
457 Ga0436365_1117481 3300039437 Bacteria 2044
458 Ga0436365_1473210 3300039437 Bacteria 662
459 Ga0436360_0161873 3300039438 Bacteria 785
460 Ga0436360_0237958 3300039438 Bacteria 3127
461 Ga0436360_0241802 3300039438 Unclassified 1325
462 Ga0436360_0376123 3300039438 Bacteria 3982
463 Ga0436360_0409204 3300039438 Bacteria 706
464 Ga0436360_0547960 3300039438 Unclassified 3257
465 Ga0436360_0589119 3300039438 Bacteria 725
466 Ga0436360_0864071 3300039438 Bacteria 1136
467 Ga0436360_1148594 3300039438 Bacteria 711
468 Ga0436360_1236976 3300039438 Bacteria 13114
469 Ga0436361_0045776 3300039447 Bacteria 765
470 Ga0436361_0176175 3300039447 Bacteria 758
471 Ga0436361_0320073 3300039447 Bacteria 5785
472 Ga0436361_0404649 3300039447 Bacteria 3707
473 Ga0436361_0573507 3300039447 Bacteria 1853
474 Ga0436361_0689834 3300039447 Bacteria 1249
475 Ga0436361_0761437 3300039447 Bacteria 767
476 Ga0436361_0761935 3300039447 Unclassified 1536
477 Ga0436361_0869014 3300039447 Bacteria 1114
478 Ga0436361_0884319 3300039447 Bacteria 698
479 Ga0436361_0967278 3300039447 Bacteria 8431
480 Ga0436361_1104869 3300039447 Bacteria 3104
481 Ga0436361_1159587 3300039447 Bacteria 2365
482 Ga0436363_0364153 3300039450 Bacteria 1797
483 Ga0436363_0567928 3300039450 Bacteria 1562
484 Ga0436363_1045538 3300039450 Bacteria 559
485 Ga0436363_1071586 3300039450 Bacteria 1123
486 Ga0436363_1131095 3300039450 Bacteria 940
487 Ga0436363_1596085 3300039450 Bacteria 1955
488 Ga0436363_1649643 3300039450 Bacteria 682
489 Ga0436362_0367418 3300039453 Bacteria 1408
490 Ga0436362_0445514 3300039453 Bacteria 754
491 Ga0436362_0496446 3300039453 Bacteria 1550
492 Ga0436362_0680561 3300039453 Bacteria 1110
493 Ga0436362_0854004 3300039453 Bacteria 738
494 Ga0436362_0866759 3300039453 Bacteria 2716
495 Ga0436362_0871152 3300039453 Bacteria 2235
496 Ga0436362_0928415 3300039453 Bacteria 2754
497 Ga0436362_0937957 3300039453 Bacteria 557
498 Ga0436362_0965275 3300039453 Bacteria 656
499 Ga0436362_0998418 3300039453 Unclassified 554
500 Ga0436362_1035238 3300039453 Bacteria 1426
501 Ga0436362_1060822 3300039453 Unclassified 550
502 Ga0436362_1145280 3300039453 Bacteria 1266
503 Ga0436362_1231292 3300039453 Bacteria 632
504 Ga0451839_0184509 3300041496 Bacteria 599
505 Ga0451853_2601351 3300041512 Bacteria 532
506 Ga0451577_1653682 3300042876 Bacteria 564
507 Ga0451576_0632692 3300045051 Bacteria 1124
508 Ga0495627_151678 3300046453 Bacteria 647
509 Ga0495603_0329699 3300046455 Bacteria 876
510 Ga0495638_0340677 3300046460 Bacteria 795
511 Ga0495638_0518127 3300046460 Unclassified 598
512 Ga0495638_0625381 3300046460 Unclassified 526
513 Ga0495580_0683726 3300046472 Bacteria 673
514 Ga0495580_0767613 3300046472 Unclassified 627
515 Ga0495605_0075675 3300046474 Bacteria 1583
516 Ga0495639_0079322 3300046475 Bacteria 1527
517 Ga0495584_0047448 3300046491 Bacteria 2166
518 Ga0495583_0259309 3300046506 Bacteria 696
519 Ga0495632_0030865 3300046519 Bacteria 2777
520 Ga0495644_0088046 3300046523 Bacteria 1171
521 Ga0495648_0474601 3300046524 Bacteria 542
522 Ga0495663_0361514 3300046525 Bacteria 530
523 Ga0495642_0052124 3300046528 Bacteria 1685
524 Ga0495665_0152039 3300046531 Bacteria 1208
525 Ga0495640_0170475 3300046533 Unclassified 1391
526 Ga0495598_0026274 3300046537 Bacteria 1595
527 Ga0495609_0100138 3300046538 Bacteria 1256
528 Ga0495621_0023510 3300046539 Bacteria 2051
529 Ga0495667_0477402 3300046559 Bacteria 782
530 Ga0495656_0024074 3300046615 Bacteria 2401
531 Ga0495656_0826408 3300046615 Unclassified 501
532 Ga0495659_0033192 3300046664 Bacteria 1811
533 Ga0495659_0257647 3300046664 Bacteria 728
534 Ga0495661_0310940 3300046665 Bacteria 786
535 Ga0495669_0201571 3300046684 Bacteria 951
536 Ga0495669_0261376 3300046684 Bacteria 832
537 Ga0495624_0379855 3300046690 Bacteria 849
538 Ga0495670_0322600 3300046691 Bacteria 829
539 Ga0495589_0086980 3300046794 Bacteria 1518
540 Ga0495581_0082182 3300047315 Bacteria 1866
541 Ga0495636_0032320 3300047318 Bacteria 2147
542 Ga0495672_0067284 3300047320 Bacteria 2041
543 Ga0495672_0095218 3300047320 Unclassified 1626
544 Ga0495672_0118523 3300047320 Bacteria 1411
545 Ga0495672_0180092 3300047320 Unclassified 1071
546 Ga0495672_0354504 3300047320 Bacteria 681
547 Ga0495676_0462676 3300047321 Bacteria 836
548 Ga0495677_0314221 3300047445 Bacteria 617
549 Ga0495681_0371306 3300047470 Bacteria 540
550 Ga0495684_0942586 3300047471 Unclassified 553
551 Ga0495686_0207068 3300047472 Bacteria 1122
552 Ga0496100_0592460 3300048903 Unclassified 860
553 Ga0496100_0624436 3300048903 Bacteria 838
554 Ga0496100_0916187 3300048903 Bacteria 689
555 Ga0496101_0425434 3300048904 Bacteria 1047
556 Ga0496101_0617216 3300048904 Bacteria 857
557 Ga0496101_0684245 3300048904 Bacteria 810
558 Ga0496102_0020647 3300048905 Bacteria 5821
559 Ga0496102_0457651 3300048905 Bacteria 1197
560 Ga0496103_0425819 3300048906 Bacteria 852
561 Ga0496104_0846434 3300048907 Bacteria 820
562 Ga0496105_1357394 3300048908 Unclassified 517
563 Ga0496106_0234192 3300048909 Bacteria 1467
564 Ga0496106_0653503 3300048909 Bacteria 840
565 Ga0496107_0652868 3300048910 Unclassified 775
566 Ga0496108_0315737 3300048911 Bacteria 1362
567 Ga0496108_1504573 3300048911 Bacteria 560
568 Ga0496108_1727223 3300048911 Bacteria 514
569 Ga0496109_0129306 3300048912 Bacteria 2357
570 Ga0496109_0190368 3300048912 Bacteria 1928
571 Ga0496110_0085964 3300048913 Bacteria 2807
572 Ga0496110_0345032 3300048913 Unclassified 1356
573 Ga0496110_0642246 3300048913 Unclassified 961
574 Ga0496111_0148926 3300048914 Unclassified 1735
575 Ga0496111_0414825 3300048914 Unclassified 995
576 Ga0496112_0441909 3300048915 Bacteria 1239
577 Ga0496112_0613481 3300048915 Unclassified 1019
578 Ga0496112_0690362 3300048915 Archaea 949
579 Ga0496115_0029298 3300048918 Bacteria 4323
580 Ga0496115_0408615 3300048918 Unclassified 1101
581 Ga0496115_0495189 3300048918 Bacteria 983
582 Ga0496121_0000178 3300048924 Bacteria 141429
583 Ga0496121_0000578 3300048924 Bacteria 68826
584 Ga0496121_0589668 3300048924 Bacteria 688
585 Ga0496124_0711321 3300048927 Bacteria 635
586 Ga0496126_0000602 3300048929 Bacteria 67975
587 Ga0496126_0019740 3300048929 Bacteria 6632
588 Ga0496126_0020303 3300048929 Bacteria 6519
589 Ga0496126_0286608 3300048929 Bacteria 1363
590 Ga0501047_0070431 3300049581 Unclassified 3368
591 Ga0501048_0000976 3300049582 Bacteria 21182
592 Ga0501044_0163655 3300049823 Unclassified 2200
593 nmdc:mga03n38_208084_c1 3300050490 Bacteria 1015
594 nmdc:mga0yw44_47843_c1 3300050492 Bacteria 2576
595 nmdc:mga0yw44_700896_c1 3300050492 Unclassified 688
596 nmdc:mga06z11_3412_c1 3300050494 Bacteria 6137
597 nmdc:mga06z11_430197_c1 3300050494 Bacteria 796
598 nmdc:mga05p37_288976_c1 3300050507 Bacteria 1952
599 nmdc:mga05p37_306947_c1 3300050507 Bacteria 1882
600 nmdc:mga05p37_418705_c1 3300050507 Unclassified 1559
601 nmdc:mga05p37_427068_c1 3300050507 Bacteria 1540
602 nmdc:mga09592_28579_c1 3300050508 Bacteria 4633
603 nmdc:mga0qj67_5830_c1 3300050509 Bacteria 9016
604 nmdc:mga06r32_21788_c1 3300050510 Bacteria 5916
605 nmdc:mga08y16_1720536_c1 3300050511 Unclassified 582
606 nmdc:mga08y16_24911_c1 3300050511 Bacteria 6311
607 nmdc:mga08y16_638442_c1 3300050511 Unclassified 1070
608 nmdc:mga08y16_657669_c1 3300050511 Unclassified 1051
609 nmdc:mga08y16_718499_c1 3300050511 Bacteria 997
610 nmdc:mga0n895_199400_c1 3300050512 Bacteria 2033
611 nmdc:mga0n895_2173847_c1 3300050512 Bacteria 510
612 nmdc:mga0n895_40125_c1 3300050512 Bacteria 4546
613 nmdc:mga0n895_562763_c1 3300050512 Archaea 1145
614 nmdc:mga0n895_669068_c1 3300050512 Unclassified 1036
615 nmdc:mga0n895_880129_c1 3300050512 Bacteria 882
616 nmdc:mga0n895_99908_c1 3300050512 Bacteria 2910
617 nmdc:mga0rr50_160029_c1 3300050513 Bacteria 1827
618 nmdc:mga0rr50_40836_c1 3300050513 Bacteria 3375
619 nmdc:mga0rr50_48504_c1 3300050513 Bacteria 3139
620 nmdc:mga08x19_314979_c1 3300050514 Bacteria 1088
621 nmdc:mga08x19_507939_c1 3300050514 Bacteria 851
622 nmdc:mga0a205_983117_c1 3300050515 Archaea 691
623 nmdc:mga0sz30_361329_c1 3300050516 Bacteria 649
624 Ga0500610_0283408 3300053079 Unclassified 742
625 Ga0495655_0044082 3300053083 Bacteria 1153
626 Ga0495655_0239548 3300053083 Bacteria 607
627 Ga0500643_000068 3300053087 Bacteria 117369
628 Ga0500644_0108757 3300053088 Bacteria 1065
629 Ga0500651_0372857 3300053093 Bacteria 806
630 Ga0500641_0015300 3300053096 Bacteria 2845
631 Ga0500555_020084 3300053103 Bacteria 1925
632 Ga0500555_099607 3300053103 Bacteria 739
633 Ga0500556_0127600 3300053104 Bacteria 995
634 Ga0500595_001432 3300053119 Bacteria 12792
635 Ga0500642_0222562 3300053130 Unclassified 874
636 Ga0500642_0291352 3300053130 Bacteria 739
637 Ga0500652_195937 3300053131 Unclassified 821
638 Ga0500658_0091346 3300053134 Bacteria 1317
639 Ga0500568_0008293 3300053139 Bacteria 5021
640 Ga0500568_0200381 3300053139 Bacteria 731
641 Ga0500577_0047667 3300053142 Bacteria 1594
642 Ga0500645_004081 3300053730 Bacteria 5718
643 Ga0500645_034013 3300053730 Bacteria 1523
644 Ga0500645_155902 3300053730 Bacteria 627
645 Ga0207693_10214007
646 LJQas_1001938
647 Ga0065704_10252793
648 Ga0065712_10394877
649 Ga0065715_10783504
650 Ga0065707_10014879
651 Ga0070683_100170516
652 Ga0070683_102403333
653 Ga0070677_10515472
654 Ga0068869_100040232
655 Ga0068869_101866158
656 Ga0070689_100406318
657 Ga0070687_100222447
658 Ga0070687_100407324
659 Ga0070668_100020199
660 Ga0070668_100047154
661 Ga0070668_100192858
662 Ga0070668_100390428
663 Ga0070668_100432048
664 Ga0070668_100495146
665 Ga0070668_102224893
666 Ga0070669_100067381
667 Ga0070669_100129714
668 Ga0070675_100489461
669 Ga0070675_100558094
670 Ga0070674_101789757
671 Ga0070674_101864994
672 Ga0070659_100797178
673 Ga0070667_100132273
674 Ga0070709_10023975
675 Ga0070709_10142763
676 Ga0070709_10678148
677 Ga0070709_10894670
678 Ga0070709_11378723
679 Ga0070714_100056053
680 Ga0070714_101362267
681 Ga0070713_100037793
682 Ga0070713_100113103
683 Ga0070713_100232909
684 Ga0070713_100462547
685 Ga0070713_100737714
686 Ga0070713_100892997
687 Ga0070713_101450412
688 Ga0070710_10022702
689 Ga0070710_10210722
690 Ga0070710_10600866
691 Ga0070710_10629852
692 Ga0070710_10876388
693 Ga0070710_11154509
694 Ga0070701_10462978
695 Ga0070711_100068841
696 Ga0070711_100214672
697 Ga0070711_100292943
698 Ga0070711_100937605
699 Ga0070711_101752070
700 Ga0070711_101855549
701 Ga0070705_101703921
702 Ga0070700_100274608
703 Ga0070700_101677374
704 Ga0070700_101816499
705 Ga0070694_101934472
706 Ga0070708_100027962
707 Ga0070708_100095336
708 Ga0070708_100181281
709 Ga0070663_101230288
710 Ga0070678_100641214
711 Ga0070678_101024073
712 Ga0070662_101075887
713 Ga0070662_101983397
714 Ga0070681_10059386
715 Ga0068867_101816932
716 Ga0068867_102226215
717 Ga0070706_100065620
718 Ga0070706_100067265
719 Ga0070706_100089927
720 Ga0070706_100119540
721 Ga0070706_100643275
722 Ga0070707_100102088
723 Ga0070707_100153728
724 Ga0070707_100205945
725 Ga0070707_100498057
726 Ga0070707_102120527
727 Ga0070698_100010056
728 Ga0070698_100053185
729 Ga0070698_100070655
730 Ga0070698_100076166
731 Ga0070698_100315595
732 Ga0070698_100488528
733 Ga0070698_100983228
734 Ga0070698_101586166
735 Ga0070699_100337731
736 Ga0070699_100503138
737 Ga0070699_100516596
738 Ga0070699_100956939
739 Ga0070679_101678026
740 Ga0070684_100190488
741 Ga0070697_100116712
742 Ga0070697_100218468
743 Ga0070697_100692717
744 Ga0070697_101145558
745 Ga0070697_101203297
746 Ga0070697_101811382
747 Ga0070697_102023787
748 Ga0070695_100000376
749 Ga0070695_100159473
750 Ga0070696_100079321
751 Ga0070696_101234299
752 Ga0070665_100099398
753 Ga0070704_100067125
754 Ga0070704_100316176
755 Ga0070704_100738439
756 Ga0070704_101008264
757 Ga0070664_100434945
758 Ga0070664_102064725
759 Ga0068856_102157827
760 Ga0068859_100089986
761 Ga0068864_100132501
762 Ga0068864_100470896
763 Ga0068864_101238761
764 Ga0068866_10190002
765 Ga0068866_11024816
766 Ga0068866_11312380
767 Ga0068861_100040156
768 Ga0068861_101056329
769 Ga0068861_101714180
770 Ga0068870_11084265
771 Ga0068863_100052171
772 Ga0068858_100261575
773 Ga0068860_100040800
774 Ga0068860_100063119
775 Ga0068860_101768881
776 Ga0068860_101999056
777 Ga0068862_100002908
778 Ga0068862_100023607
779 Ga0068862_100398174
780 Ga0068862_100677270
781 Ga0068862_100877724
782 Ga0081455_10041727
783 Ga0081455_10207538
784 Ga0081455_10372235
785 Ga0081538_10030887
786 Ga0081540_1000205
787 Ga0081540_1012926
788 Ga0081540_1045680
789 Ga0081539_10376875
790 Ga0070717_10060296
791 Ga0070717_10165231
792 Ga0070717_10187820
793 Ga0070717_10250662
794 Ga0070717_10780772
795 Ga0070717_11798606
796 Ga0075365_10124411
797 Ga0075368_10430757
798 Ga0075364_10995346
799 Ga0070715_10039896
800 Ga0070715_10059714
801 Ga0070715_10084397
802 Ga0070715_10291999
803 Ga0070715_10565627
804 Ga0070715_11063663
805 Ga0070716_100241931
806 Ga0070716_100484988
807 Ga0070716_100649390
808 Ga0070716_100783594
809 Ga0070716_100891015
810 Ga0070716_101603320
811 Ga0070712_100090687
812 Ga0070712_100122172
813 Ga0070712_100130702
814 Ga0070712_100180994
815 Ga0070712_100202034
816 Ga0070712_100213325
817 Ga0070712_100351747
818 Ga0070712_100541759
819 Ga0070712_101193984
820 Ga0070712_101354358
821 Ga0075362_10018853
822 Ga0075362_10223320
823 Ga0075367_10065667
824 Ga0075367_10365470
825 Ga0075367_10604034
826 Ga0075369_10011214
827 Ga0075366_10996225
828 Ga0097621_100296497
829 Ga0068871_100955266
830 Ga0075428_100006487
831 Ga0075428_100817889
832 Ga0075428_101024003
833 Ga0075428_101204935
834 Ga0075431_100411465
835 Ga0075431_100717160
836 Ga0075431_100767021
837 Ga0075433_10803575
838 Ga0075434_100041876
839 Ga0075434_100202007
840 Ga0075434_100417074
841 Ga0075434_101099496
842 Ga0075434_101939883
843 Ga0075429_101220840
844 Ga0068865_100433361
845 Ga0075436_100354079
846 Ga0097620_100089985
847 Ga0075435_100058271
848 Ga0075435_100081290
849 Ga0075435_100184191
850 Ga0075435_100332218
851 Ga0075435_101374094
852 Ga0075435_101765113
853 Ga0075435_101919179
854 Ga0099794_10008698
855 Ga0099794_10108594
856 Ga0099794_10395441
857 Ga0099795_10050148
858 Ga0099795_10060874
859 Ga0099795_10094886
860 Ga0099795_10143143
861 Ga0099795_10157307
862 Ga0099795_10415902
863 Ga0099795_10439007
864 Ga0105250_10011368
865 Ga0105240_10993078
866 Ga0111539_10739025
867 Ga0111539_10832802
868 Ga0111539_10842557
869 Ga0111539_10923870
870 Ga0111539_11427517
871 Ga0111539_11906424
872 Ga0111539_12162176
873 Ga0111539_13291762
874 Ga0105247_10242467
875 Ga0105247_10538796
876 Ga0105247_10553676
877 Ga0114129_10512505
878 Ga0114129_11488188
879 Ga0105243_10380667
880 Ga0105243_10458021
881 Ga0105243_12564151
882 Ga0105241_10229483
883 Ga0105241_11176903
884 Ga0105242_10198536
885 Ga0105242_10270834
886 Ga0105248_11799704
887 Ga0105248_12094629
888 Ga0105238_10019318
889 Ga0105238_12789123
890 Ga0105249_10112394
891 Ga0105249_10212334
892 Ga0105249_10220558
893 Ga0105249_10552059
894 Ga0105249_10923720
895 Ga0105249_11891077
896 Ga0105249_11963435
897 Ga0099796_10188683
898 Ga0099796_10234893
899 Ga0099796_10334037
900 Ga0099796_10417196
901 Ga0099796_10570181
902 Ga0105239_10930622
903 Ga0105239_11629869
904 Ga0105239_12395488
905 Ga0105239_13047428
906 Ga0105246_10637400
907 Ga0105246_12079797
908 Ga0157341_1040294
909 Ga0157342_1011799
910 Ga0157370_11564638
911 Ga0157378_10252074
912 Ga0157378_10792063
913 Ga0157378_11602771
914 Ga0163162_10248405
915 Ga0163162_10267917
916 Ga0163162_10622229
917 Ga0163162_11099416
918 Ga0163162_11354274
919 Ga0163162_11457925
920 Ga0163162_11607785
921 Ga0163162_12711522
922 Ga0163162_13168838
923 Ga0157375_11452554
924 Ga0157375_11476976
925 Ga0157375_12754674
926 Ga0163163_12678046
927 Ga0157380_13174601
928 Ga0157379_10299944
929 Ga0157379_10426582
930 Ga0157379_11797763
931 Ga0157376_11660263
932 Ga0163161_10535645
933 Ga0163161_10558460
934 Ga0163161_10955561
935 Ga0163161_11471983
936 Ga0163161_11715060
937 Ga0213873_10144586
938 Ga0213873_10238999
939 Ga0213872_10030107
940 Ga0213872_10033419
941 Ga0213872_10176979
942 Ga0213872_10230374
943 Ga0213874_10020427
944 Ga0213874_10062556
945 Ga0213874_10082650
946 Ga0213876_10366225
947 Ga0213871_10002412
948 Ga0213871_10045133
949 Ga0213871_10078594
950 Ga0213871_10084866
951 Ga0224572_1013830
952 Ga0228598_1015402
953 Ga0207426_1039940
954 Ga0207696_1181157
955 Ga0207653_10023969
956 Ga0207692_10042872
957 Ga0207692_10089997
958 Ga0207692_10129442
959 Ga0207692_10134321
960 Ga0207692_10699370
961 Ga0207642_10873630
962 Ga0207647_10260588
963 Ga0207685_10002786
964 Ga0207685_10296088
965 Ga0207685_10298068
966 Ga0207685_10389904
967 Ga0207699_10210793
968 Ga0207699_10217078
969 Ga0207699_10357584
970 Ga0207645_11104054
971 Ga0207684_10021345
972 Ga0207684_10026581
973 Ga0207684_10096343
974 Ga0207684_10209441
975 Ga0207684_10556945
976 Ga0207684_11185856
977 Ga0207654_11004116
978 Ga0207707_10156343
979 Ga0207671_11354390
980 Ga0207693_10013328
981 Ga0207693_10015107
982 Ga0207693_10030807
983 Ga0207693_10091475
984 Ga0207693_10201325
985 Ga0207693_10251937
986 Ga0207693_10305102
987 Ga0207693_10556013
988 Ga0207693_10626739
989 Ga0207693_10638577
990 Ga0207663_10020174
991 Ga0207663_10028558
992 Ga0207663_10978080
993 Ga0207663_11191681
994 Ga0207663_11523469
995 Ga0207646_10024006
996 Ga0207646_10278614
997 Ga0207646_10370938
998 Ga0207646_10429525
999 Ga0207681_10160272
1000 Ga0207694_10007721
1001 Ga0207687_11674031
1002 Ga0207700_10053692
1003 Ga0207700_10082891
1004 Ga0207700_10527086
1005 Ga0207664_10350714
1006 Ga0207664_10387245
1007 Ga0207664_10723356
1008 Ga0207644_10819723
1009 Ga0207706_10048727
1010 Ga0207706_11173804
1011 Ga0207686_10123882
1012 Ga0207686_10548386
1013 Ga0207709_10431309
1014 Ga0207709_11321993
1015 Ga0207669_11250704
1016 Ga0207704_10529549
1017 Ga0207665_10007221
1018 Ga0207665_10062580
1019 Ga0207665_10106726
1020 Ga0207665_10146559
1021 Ga0207665_10459679
1022 Ga0207665_10846481
1023 Ga0207665_11168318
1024 Ga0207711_10742891
1025 Ga0207689_10011121
1026 Ga0207679_10301446
1027 Ga0207712_10210711
1028 Ga0207712_10868930
1029 Ga0207668_10016600
1030 Ga0207668_10047200
1031 Ga0207668_10109007
1032 Ga0207668_10311192
1033 Ga0207668_10368933
1034 Ga0207668_11681240
1035 Ga0207640_11911415
1036 Ga0207658_10089464
1037 Ga0207677_11011511
1038 Ga0207677_11232314
1039 Ga0207703_10318537
1040 Ga0207678_10342949
1041 Ga0207678_10506175
1042 Ga0207708_10343826
1043 Ga0207641_10014342
1044 Ga0207648_11229543
1045 Ga0207648_11866511
1046 Ga0207676_10570122
1047 Ga0207676_11275493
1048 Ga0207675_100029894
1049 Ga0207675_100493707
1050 Ga0207683_10908521
1051 Ga0207683_11120435
1052 Ga0209179_1003659
1053 Ga0209179_1075074
1054 Ga0209179_1131269
1055 Ga0209588_1015049
1056 Ga0207428_10419509
1057 Ga0268266_10011169
1058 Ga0268266_10055026
1059 Ga0268265_10004700
1060 Ga0268265_10156850
1061 Ga0268265_10727855
1062 Ga0268265_11321166
1063 Ga0268264_10048621
1064 Ga0268264_10181734
1065 Ga0265763_1020114
1066 Ga0265763_1027745
1067 Ga0265760_10116007
1068 Ga0265328_10004882
1069 Ga0265328_10027623
1070 Ga0265331_10004681
1071 Ga0265327_10014669
1072 Ga0265327_10157465
1073 Ga0265316_10082178
1074 Ga0265316_10246600
1075 Ga0307513_10489174
1076 Ga0373944_0101388
1077 Ga0373923_0348685
1078 Ga0373932_0038020
1079 Ga0373945_0167935
1080 Ga0373945_0255757
1081 Ga0373945_0373210
1082 Ga0373943_0241919
1083 Ga0373935_0259425
1084 Ga0373927_0279926
1085 Ga0373927_0341243
1086 Ga0373927_0365883
1087 Ga0373947_0523978
1088 Ga0373937_0126367
1089 Ga0373937_0175285
1090 Ga0373925_0452561
1091 Ga0373925_0887982
1092 Ga0395900_0748916
1093 Ga0436364_0114715
1094 Ga0436364_0407950
1095 Ga0436364_1119997
1096 Ga0436364_1254522
1097 Ga0395901_0107464
1098 Ga0436365_0243053
1099 Ga0436365_0806122
1100 Ga0436365_0917584
1101 Ga0436365_1117481
1102 Ga0436365_1473210
1103 Ga0436360_0161873
1104 Ga0436360_0237958
1105 Ga0436360_0241802
1106 Ga0436360_0376123
1107 Ga0436360_0409204
1108 Ga0436360_0547960
1109 Ga0436360_0589119
1110 Ga0436360_0864071
1111 Ga0436360_1148594
1112 Ga0436360_1236976
1113 Ga0436361_0045776
1114 Ga0436361_0176175
1115 Ga0436361_0320073
1116 Ga0436361_0404649
1117 Ga0436361_0573507
1118 Ga0436361_0689834
1119 Ga0436361_0761437
1120 Ga0436361_0761935
1121 Ga0436361_0869014
1122 Ga0436361_0884319
1123 Ga0436361_0967278
1124 Ga0436361_1104869
1125 Ga0436361_1159587
1126 Ga0436363_0364153
1127 Ga0436363_0567928
1128 Ga0436363_1045538
1129 Ga0436363_1071586
1130 Ga0436363_1131095
1131 Ga0436363_1596085
1132 Ga0436363_1649643
1133 Ga0436362_0367418
1134 Ga0436362_0445514
1135 Ga0436362_0496446
1136 Ga0436362_0680561
1137 Ga0436362_0854004
1138 Ga0436362_0866759
1139 Ga0436362_0871152
1140 Ga0436362_0928415
1141 Ga0436362_0937957
1142 Ga0436362_0965275
1143 Ga0436362_0998418
1144 Ga0436362_1035238
1145 Ga0436362_1060822
1146 Ga0436362_1145280
1147 Ga0436362_1231292
1148 Ga0451839_0184509
1149 Ga0451853_2601351
1150 Ga0451577_1653682
1151 Ga0451576_0632692
1152 Ga0495627_151678
1153 Ga0495603_0329699
1154 Ga0495638_0340677
1155 Ga0495638_0518127
1156 Ga0495638_0625381
1157 Ga0495580_0683726
1158 Ga0495580_0767613
1159 Ga0495605_0075675
1160 Ga0495639_0079322
1161 Ga0495584_0047448
1162 Ga0495583_0259309
1163 Ga0495632_0030865
1164 Ga0495644_0088046
1165 Ga0495648_0474601
1166 Ga0495663_0361514
1167 Ga0495642_0052124
1168 Ga0495665_0152039
1169 Ga0495640_0170475
1170 Ga0495598_0026274
1171 Ga0495609_0100138
1172 Ga0495621_0023510
1173 Ga0495667_0477402
1174 Ga0495656_0024074
1175 Ga0495656_0826408
1176 Ga0495659_0033192
1177 Ga0495659_0257647
1178 Ga0495661_0310940
1179 Ga0495669_0201571
1180 Ga0495669_0261376
1181 Ga0495624_0379855
1182 Ga0495670_0322600
1183 Ga0495589_0086980
1184 Ga0495581_0082182
1185 Ga0495636_0032320
1186 Ga0495672_0067284
1187 Ga0495672_0095218
1188 Ga0495672_0118523
1189 Ga0495672_0180092
1190 Ga0495672_0354504
1191 Ga0495676_0462676
1192 Ga0495677_0314221
1193 Ga0495681_0371306
1194 Ga0495684_0942586
1195 Ga0495686_0207068
1196 Ga0496100_0592460
1197 Ga0496100_0624436
1198 Ga0496100_0916187
1199 Ga0496101_0425434
1200 Ga0496101_0617216
1201 Ga0496101_0684245
1202 Ga0496102_0020647
1203 Ga0496102_0457651
1204 Ga0496103_0425819
1205 Ga0496104_0846434
1206 Ga0496105_1357394
1207 Ga0496106_0234192
1208 Ga0496106_0653503
1209 Ga0496107_0652868
1210 Ga0496108_0315737
1211 Ga0496108_1504573
1212 Ga0496108_1727223
1213 Ga0496109_0129306
1214 Ga0496109_0190368
1215 Ga0496110_0085964
1216 Ga0496110_0345032
1217 Ga0496110_0642246
1218 Ga0496111_0148926
1219 Ga0496111_0414825
1220 Ga0496112_0441909
1221 Ga0496112_0613481
1222 Ga0496112_0690362
1223 Ga0496115_0029298
1224 Ga0496115_0408615
1225 Ga0496115_0495189
1226 Ga0496121_0000178
1227 Ga0496121_0000578
1228 Ga0496121_0589668
1229 Ga0496124_0711321
1230 Ga0496126_0000602
1231 Ga0496126_0019740
1232 Ga0496126_0020303
1233 Ga0496126_0286608
1234 Ga0501047_0070431
1235 Ga0501048_0000976
1236 Ga0501044_0163655
1237 nmdc:mga03n38_208084_c1
1238 nmdc:mga0yw44_47843_c1
1239 nmdc:mga0yw44_700896_c1
1240 nmdc:mga06z11_3412_c1
1241 nmdc:mga06z11_430197_c1
1242 nmdc:mga05p37_288976_c1
1243 nmdc:mga05p37_306947_c1
1244 nmdc:mga05p37_418705_c1
1245 nmdc:mga05p37_427068_c1
1246 nmdc:mga09592_28579_c1
1247 nmdc:mga0qj67_5830_c1
1248 nmdc:mga06r32_21788_c1
1249 nmdc:mga08y16_1720536_c1
1250 nmdc:mga08y16_24911_c1
1251 nmdc:mga08y16_638442_c1
1252 nmdc:mga08y16_657669_c1
1253 nmdc:mga08y16_718499_c1
1254 nmdc:mga0n895_199400_c1
1255 nmdc:mga0n895_2173847_c1
1256 nmdc:mga0n895_40125_c1
1257 nmdc:mga0n895_562763_c1
1258 nmdc:mga0n895_669068_c1
1259 nmdc:mga0n895_880129_c1
1260 nmdc:mga0n895_99908_c1
1261 nmdc:mga0rr50_160029_c1
1262 nmdc:mga0rr50_40836_c1
1263 nmdc:mga0rr50_48504_c1
1264 nmdc:mga08x19_314979_c1
1265 nmdc:mga08x19_507939_c1
1266 nmdc:mga0a205_983117_c1
1267 nmdc:mga0sz30_361329_c1
1268 Ga0500610_0283408
1269 Ga0495655_0044082
1270 Ga0495655_0239548
1271 Ga0500643_000068
1272 Ga0500644_0108757
1273 Ga0500651_0372857
1274 Ga0500641_0015300
1275 Ga0500555_020084
1276 Ga0500555_099607
1277 Ga0500556_0127600
1278 Ga0500595_001432
1279 Ga0500642_0222562
1280 Ga0500642_0291352
1281 Ga0500652_195937
1282 Ga0500658_0091346
1283 Ga0500568_0008293
1284 Ga0500568_0200381
1285 Ga0500577_0047667
1286 Ga0500645_004081
1287 Ga0500645_034013
1288 Ga0500645_155902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07869

DUF1656

Protein of unknown function (DUF1656)

21

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s7o-assembly1.cif.gz_F cryo-em structure of human oligosaccharyltransferase complex ost-a 0.4172 4 66
6s7t-assembly1.cif.gz_F cryo-em structure of human oligosaccharyltransferase complex ost-b 0.4127 4 66
8b6l-assembly1.cif.gz_P subtomogram average of the human sec61-trap-osta-translocon 0.4064 4 66
6s7o-assembly1.cif.gz_F cryo-em structure of human oligosaccharyltransferase complex ost-a 0.3927 4 66
6s7t-assembly1.cif.gz_F cryo-em structure of human oligosaccharyltransferase complex ost-b 0.3886 4 66
ID Description Score Start End Superfamily
af_A5A630_30_91_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9306 6 63 1.10.287.70
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8511 16 67 1.10.10.1740
af_A5A630_30_91_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8338 6 63 1.10.287.70
af_Q9ZQN7_22_92_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7215 12 60 1.10.10.60
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6341 16 67 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A246JMC7-F1-model_v4 DUF1656 domain-containing protein 0.9664 6 60 GO:0016020
AF-A0A1H0NVN1-F1-model_v4 DUF1656 domain-containing protein 0.9608 5 67 GO:0016020
AF-A0A376FHR8-F1-model_v4 Protein AaeX 0.9496 6 65 GO:0005886
AF-A0A4R1BLV4-F1-model_v4 DUF1656 domain-containing protein 0.9494 6 60 GO:0016020
AF-A0A401WTL9-F1-model_v4 Uncharacterized protein YtcA 0.9449 6 61 GO:0005886

Map