F471999
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 643 | 430 | 544 | 357 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2808606375|2808913342 |
| Length | 392 |
| Sequence | DGSGTPYKVAEAVEAPASGTGQWAGARRVRVEAMADSPLDLTLNAAELTARLVDFPSESGSEKPLADAIESALRALPHLTVDRHGNNVVARTDLGRPERVILAGHIDTVPIADNVPSRLDEDGVLWGCGTCDMKSGVAVQLRIAATVPAPNRDLTFVFYDNEEVQAELNGLRHVAEAHPEWLVGDFAVLLEPSDGQVEGGCQGTLRVLLKTKGERAHSARGWMGSNAIHAAAPILAKLAAYEPRHPVIDGLEYREGLNAVGVSGGVAGNVIPDECVVTVNFRYAPDRTEQEAIAHVREVFADCGVEEFVIDDHSPGALPGLSHPAAAAFIEAVGGTPMPKYGWTDVSRFSALGVPAVNYGPGNPHLAHKRDERVETTKILAGEERLRNWLTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 10 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 11 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 12 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 13 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 14 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 15 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 16 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 17 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 18 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 19 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 20 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 21 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 22 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 23 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 24 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 25 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 26 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 27 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 28 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 29 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 30 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 31 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 32 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 33 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 34 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 35 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 36 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 37 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 38 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 39 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 40 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 41 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 42 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 43 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 44 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 45 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 46 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 47 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 48 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 49 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 50 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 51 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 52 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 53 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 54 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 55 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 56 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 57 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 58 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 59 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 60 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 61 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 62 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 63 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 64 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 65 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 66 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 67 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 68 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 69 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 70 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 71 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 72 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 73 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 74 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 75 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 76 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 77 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 78 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 79 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 80 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 81 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 82 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 83 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 84 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 85 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 86 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 87 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 88 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 89 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 90 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 91 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 97 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 106 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 124 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 132 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 133 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 134 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 136 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 137 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 140 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 141 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 142 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 143 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 144 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 145 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 146 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 147 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 148 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 149 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 150 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 151 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 152 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 153 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 155 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 276 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 281 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 282 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 283 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 284 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 285 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 286 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 295 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 296 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 374 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 375 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 384 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 417 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 418 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 419 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 420 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 421 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 422 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 423 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 424 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 425 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 426 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 427 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 428 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 429 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 430 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.83 |
| Metatranscriptomes | 0.78 |
| Isolates | 15.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0.62 |
| Rhizoplane | 2.33 |
| Rhizosphere | 80.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10004178 | 3300003316 | Bacteria | 4794 |
| 2 | rootH1_10013452 | 3300003316 | Bacteria | 3378 |
| 3 | rootL2_10020111 | 3300003322 | Bacteria | 2561 |
| 4 | rootH1_10006175 | 3300003323 | Bacteria | 5674 |
| 5 | rootH1_10008994 | 3300003323 | Bacteria | 3392 |
| 6 | Ga0006562J51391_1076183 | 3300003578 | Bacteria | 6790 |
| 7 | Ga0006562J51391_1076186 | 3300003578 | Bacteria | 1900 |
| 8 | Ga0006562J51391_1131149 | 3300003578 | Bacteria | 2310 |
| 9 | Ga0070658_10004154 | 3300005327 | Bacteria | 11857 |
| 10 | Ga0070658_10309633 | 3300005327 | Bacteria | 1347 |
| 11 | Ga0070676_10045712 | 3300005328 | Bacteria | 2551 |
| 12 | Ga0070676_10090160 | 3300005328 | Bacteria | 1877 |
| 13 | Ga0070683_100105911 | 3300005329 | Bacteria | 2651 |
| 14 | Ga0070666_10029086 | 3300005335 | Bacteria | 3631 |
| 15 | Ga0070680_100069713 | 3300005336 | Bacteria | 2887 |
| 16 | Ga0068868_100036941 | 3300005338 | Bacteria | 3784 |
| 17 | Ga0070660_100042689 | 3300005339 | Bacteria | 3462 |
| 18 | Ga0070660_100053486 | 3300005339 | Bacteria | 3114 |
| 19 | Ga0070660_100247389 | 3300005339 | Bacteria | 1453 |
| 20 | Ga0070689_100112099 | 3300005340 | Bacteria | 2171 |
| 21 | Ga0070691_10012855 | 3300005341 | Bacteria | 3835 |
| 22 | Ga0070691_10024845 | 3300005341 | Bacteria | 2786 |
| 23 | Ga0070661_100070184 | 3300005344 | Bacteria | 2576 |
| 24 | Ga0070661_100191864 | 3300005344 | Bacteria | 1558 |
| 25 | Ga0070692_10023965 | 3300005345 | Bacteria | 2995 |
| 26 | Ga0070671_100003983 | 3300005355 | Bacteria | 11636 |
| 27 | Ga0070671_100027438 | 3300005355 | Bacteria | 4688 |
| 28 | Ga0070674_100392581 | 3300005356 | Bacteria | 1132 |
| 29 | Ga0070673_100054815 | 3300005364 | Bacteria | 3138 |
| 30 | Ga0070688_100064615 | 3300005365 | Bacteria | 2323 |
| 31 | Ga0070659_100070520 | 3300005366 | Bacteria | 2776 |
| 32 | Ga0070659_100115232 | 3300005366 | Bacteria | 2172 |
| 33 | Ga0070667_100293450 | 3300005367 | Bacteria | 1463 |
| 34 | Ga0070709_10003363 | 3300005434 | Bacteria | 8597 |
| 35 | Ga0070709_10052580 | 3300005434 | Bacteria | 2561 |
| 36 | Ga0070714_100014741 | 3300005435 | Bacteria | 6283 |
| 37 | Ga0070714_100017702 | 3300005435 | Bacteria | 5778 |
| 38 | Ga0070714_100026301 | 3300005435 | Bacteria | 4808 |
| 39 | Ga0070714_100036360 | 3300005435 | Bacteria | 4130 |
| 40 | Ga0070714_100116056 | 3300005435 | Bacteria | 2377 |
| 41 | Ga0070713_100033092 | 3300005436 | Bacteria | 4138 |
| 42 | Ga0070713_100040421 | 3300005436 | Bacteria | 3791 |
| 43 | Ga0070713_100359505 | 3300005436 | Bacteria | 1352 |
| 44 | Ga0070710_10002570 | 3300005437 | Bacteria | 8618 |
| 45 | Ga0070701_10027477 | 3300005438 | Bacteria | 2788 |
| 46 | Ga0070711_100064291 | 3300005439 | Bacteria | 2563 |
| 47 | Ga0070694_100323416 | 3300005444 | Bacteria | 1188 |
| 48 | Ga0070708_100038777 | 3300005445 | Bacteria | 4165 |
| 49 | Ga0070708_100094026 | 3300005445 | Bacteria | 2734 |
| 50 | Ga0070663_100231749 | 3300005455 | Bacteria | 1454 |
| 51 | Ga0070662_100059477 | 3300005457 | Bacteria | 2784 |
| 52 | Ga0070662_100325271 | 3300005457 | Bacteria | 1255 |
| 53 | Ga0070681_10104204 | 3300005458 | Bacteria | 2779 |
| 54 | Ga0070681_10110524 | 3300005458 | Bacteria | 2688 |
| 55 | Ga0070706_100034361 | 3300005467 | Bacteria | 4683 |
| 56 | Ga0070707_100000466 | 3300005468 | Bacteria | 39988 |
| 57 | Ga0070707_100056623 | 3300005468 | Bacteria | 3761 |
| 58 | Ga0070698_100021955 | 3300005471 | Bacteria | 6682 |
| 59 | Ga0070698_100038750 | 3300005471 | Bacteria | 4910 |
| 60 | Ga0070679_100104852 | 3300005530 | Bacteria | 2813 |
| 61 | Ga0070679_100128862 | 3300005530 | Bacteria | 2511 |
| 62 | Ga0068853_100012964 | 3300005539 | Bacteria | 6795 |
| 63 | Ga0068853_100047395 | 3300005539 | Bacteria | 3687 |
| 64 | Ga0070672_100031002 | 3300005543 | Bacteria | 4022 |
| 65 | Ga0070686_100034172 | 3300005544 | Bacteria | 3131 |
| 66 | Ga0070695_100008066 | 3300005545 | Bacteria | 6241 |
| 67 | Ga0070693_100058800 | 3300005547 | Bacteria | 2226 |
| 68 | Ga0070665_100001778 | 3300005548 | Bacteria | 24546 |
| 69 | Ga0070665_100312474 | 3300005548 | Bacteria | 1575 |
| 70 | Ga0070665_100330216 | 3300005548 | Bacteria | 1529 |
| 71 | Ga0070704_100117106 | 3300005549 | Bacteria | 2038 |
| 72 | Ga0070664_100045344 | 3300005564 | Bacteria | 3713 |
| 73 | Ga0068857_100023265 | 3300005577 | Bacteria | 5453 |
| 74 | Ga0068854_100175713 | 3300005578 | Bacteria | 1669 |
| 75 | Ga0068854_100322825 | 3300005578 | Bacteria | 1255 |
| 76 | Ga0068856_100024127 | 3300005614 | Bacteria | 5918 |
| 77 | Ga0070702_100001774 | 3300005615 | Bacteria | 8968 |
| 78 | Ga0070702_100016862 | 3300005615 | Bacteria | 3758 |
| 79 | Ga0068859_100117599 | 3300005617 | Bacteria | 2724 |
| 80 | Ga0068859_100122025 | 3300005617 | Bacteria | 2672 |
| 81 | Ga0068851_10010306 | 3300005834 | Bacteria | 4359 |
| 82 | Ga0068870_10003104 | 3300005840 | Bacteria | 7008 |
| 83 | Ga0068863_100057543 | 3300005841 | Bacteria | 3679 |
| 84 | Ga0068860_100078304 | 3300005843 | Bacteria | 3143 |
| 85 | Ga0068860_100275835 | 3300005843 | Bacteria | 1642 |
| 86 | Ga0068860_100372993 | 3300005843 | Bacteria | 1408 |
| 87 | Ga0068862_100051249 | 3300005844 | Bacteria | 3529 |
| 88 | Ga0081455_10000288 | 3300005937 | Bacteria | 66686 |
| 89 | Ga0081455_10105888 | 3300005937 | Bacteria | 2246 |
| 90 | Ga0081540_1000037 | 3300005983 | Bacteria | 139165 |
| 91 | Ga0075363_100002322 | 3300006048 | Bacteria | 7730 |
| 92 | Ga0075364_10262573 | 3300006051 | Bacteria | 1174 |
| 93 | Ga0075432_10031065 | 3300006058 | Bacteria | 1848 |
| 94 | Ga0075367_10000660 | 3300006178 | Bacteria | 13191 |
| 95 | Ga0068871_100021131 | 3300006358 | Bacteria | 4997 |
| 96 | Ga0068871_100073746 | 3300006358 | Bacteria | 2814 |
| 97 | Ga0075428_100052509 | 3300006844 | Bacteria | 4467 |
| 98 | Ga0075431_100357045 | 3300006847 | Bacteria | 1468 |
| 99 | Ga0075434_100023900 | 3300006871 | Bacteria | 5965 |
| 100 | Ga0068865_100318707 | 3300006881 | Bacteria | 1250 |
| 101 | Ga0075436_100042426 | 3300006914 | Bacteria | 3137 |
| 102 | Ga0097620_100117592 | 3300006931 | Bacteria | 2724 |
| 103 | Ga0097620_100122024 | 3300006931 | Bacteria | 2672 |
| 104 | Ga0099826_10020443 | 3300006948 | Bacteria | 4966 |
| 105 | Ga0105245_10171670 | 3300009098 | Bacteria | 2065 |
| 106 | Ga0105247_10132690 | 3300009101 | Bacteria | 1625 |
| 107 | Ga0114129_10116178 | 3300009147 | Bacteria | 3687 |
| 108 | Ga0105243_10215639 | 3300009148 | Bacteria | 1693 |
| 109 | Ga0105241_10066723 | 3300009174 | Bacteria | 2783 |
| 110 | Ga0105241_10188474 | 3300009174 | Bacteria | 1716 |
| 111 | Ga0105242_10017678 | 3300009176 | Bacteria | 5562 |
| 112 | Ga0105238_10099745 | 3300009551 | Bacteria | 2887 |
| 113 | Ga0105238_10124914 | 3300009551 | Bacteria | 2553 |
| 114 | Ga0105238_10432343 | 3300009551 | Bacteria | 1312 |
| 115 | Ga0105249_10048872 | 3300009553 | Bacteria | 3857 |
| 116 | Ga0105246_10001918 | 3300011119 | Bacteria | 12529 |
| 117 | Ga0105246_10008217 | 3300011119 | Bacteria | 6410 |
| 118 | Ga0105246_10014236 | 3300011119 | Bacteria | 4999 |
| 119 | Ga0105246_10254041 | 3300011119 | Bacteria | 1397 |
| 120 | Ga0157373_10065688 | 3300013100 | Bacteria | 2567 |
| 121 | Ga0157371_10136624 | 3300013102 | Bacteria | 1746 |
| 122 | Ga0157374_10032344 | 3300013296 | Bacteria | 4762 |
| 123 | Ga0157374_10108637 | 3300013296 | Bacteria | 2666 |
| 124 | Ga0157378_10289876 | 3300013297 | Bacteria | 1581 |
| 125 | Ga0163162_10579114 | 3300013306 | Bacteria | 1249 |
| 126 | Ga0157375_10125964 | 3300013308 | Bacteria | 2676 |
| 127 | Ga0157375_10202987 | 3300013308 | Bacteria | 2139 |
| 128 | Ga0157380_10063764 | 3300014326 | Bacteria | 2956 |
| 129 | Ga0182008_10002554 | 3300014497 | Bacteria | 11332 |
| 130 | Ga0182008_10073079 | 3300014497 | Bacteria | 1688 |
| 131 | Ga0157379_10121278 | 3300014968 | Bacteria | 2352 |
| 132 | Ga0157376_10215640 | 3300014969 | Bacteria | 1775 |
| 133 | Ga0182007_10000334 | 3300015262 | Bacteria | 29904 |
| 134 | Ga0206356_10503846 | 3300020070 | Bacteria | 3860 |
| 135 | Ga0206354_11360300 | 3300020081 | Bacteria | 1727 |
| 136 | Ga0213874_10023183 | 3300021377 | Bacteria | 1729 |
| 137 | Ga0209758_1003976 | 3300025297 | Bacteria | 12811 |
| 138 | Ga0207426_1002494 | 3300025302 | Bacteria | 11662 |
| 139 | Ga0207426_1004622 | 3300025302 | Bacteria | 6626 |
| 140 | Ga0207656_10013812 | 3300025321 | Bacteria | 3097 |
| 141 | Ga0207653_10003977 | 3300025885 | Bacteria | 4647 |
| 142 | Ga0207692_10103379 | 3300025898 | Bacteria | 1568 |
| 143 | Ga0207688_10001356 | 3300025901 | Bacteria | 12725 |
| 144 | Ga0207688_10022343 | 3300025901 | Bacteria | 3461 |
| 145 | Ga0207647_10030640 | 3300025904 | Bacteria | 3468 |
| 146 | Ga0207647_10043188 | 3300025904 | Bacteria | 2822 |
| 147 | Ga0207645_10119010 | 3300025907 | Bacteria | 1713 |
| 148 | Ga0207643_10000252 | 3300025908 | Bacteria | 37454 |
| 149 | Ga0207643_10017166 | 3300025908 | Bacteria | 3954 |
| 150 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 151 | Ga0207684_10005507 | 3300025910 | Bacteria | 11663 |
| 152 | Ga0207707_10251495 | 3300025912 | Bacteria | 1535 |
| 153 | Ga0207695_10080382 | 3300025913 | Bacteria | 3301 |
| 154 | Ga0207693_10049796 | 3300025915 | Bacteria | 3290 |
| 155 | Ga0207693_10060282 | 3300025915 | Bacteria | 2972 |
| 156 | Ga0207660_10204258 | 3300025917 | Bacteria | 1544 |
| 157 | Ga0207662_10024168 | 3300025918 | Bacteria | 3497 |
| 158 | Ga0207657_10001310 | 3300025919 | Bacteria | 26403 |
| 159 | Ga0207657_10012261 | 3300025919 | Bacteria | 8468 |
| 160 | Ga0207694_10040321 | 3300025924 | Bacteria | 3594 |
| 161 | Ga0207650_10176573 | 3300025925 | Bacteria | 1700 |
| 162 | Ga0207700_10033600 | 3300025928 | Bacteria | 3672 |
| 163 | Ga0207700_10076087 | 3300025928 | Bacteria | 2603 |
| 164 | Ga0207700_10101507 | 3300025928 | Bacteria | 2295 |
| 165 | Ga0207700_10161653 | 3300025928 | Bacteria | 1860 |
| 166 | Ga0207664_10036163 | 3300025929 | Bacteria | 3816 |
| 167 | Ga0207664_10144740 | 3300025929 | Bacteria | 2014 |
| 168 | Ga0207664_10196373 | 3300025929 | Bacteria | 1739 |
| 169 | Ga0207644_10002584 | 3300025931 | Bacteria | 11651 |
| 170 | Ga0207644_10230822 | 3300025931 | Bacteria | 1470 |
| 171 | Ga0207690_10087528 | 3300025932 | Bacteria | 2192 |
| 172 | Ga0207669_10073685 | 3300025937 | Bacteria | 2156 |
| 173 | Ga0207691_10053368 | 3300025940 | Bacteria | 3690 |
| 174 | Ga0207711_10046215 | 3300025941 | Bacteria | 3720 |
| 175 | Ga0207689_10005533 | 3300025942 | Bacteria | 11280 |
| 176 | Ga0207689_10046652 | 3300025942 | Bacteria | 3580 |
| 177 | Ga0207661_10076652 | 3300025944 | Bacteria | 2746 |
| 178 | Ga0207661_10147580 | 3300025944 | Bacteria | 2031 |
| 179 | Ga0207679_10075405 | 3300025945 | Bacteria | 2559 |
| 180 | Ga0207667_10162707 | 3300025949 | Bacteria | 2295 |
| 181 | Ga0207651_10191933 | 3300025960 | Bacteria | 1630 |
| 182 | Ga0207712_10263585 | 3300025961 | Bacteria | 1399 |
| 183 | Ga0207640_10057783 | 3300025981 | Bacteria | 2553 |
| 184 | Ga0207703_10025518 | 3300026035 | Bacteria | 4648 |
| 185 | Ga0207639_10006559 | 3300026041 | Bacteria | 7913 |
| 186 | Ga0207678_10001822 | 3300026067 | Bacteria | 19525 |
| 187 | Ga0207678_10002951 | 3300026067 | Bacteria | 15407 |
| 188 | Ga0207708_10009034 | 3300026075 | Bacteria | 7373 |
| 189 | Ga0207641_10093722 | 3300026088 | Bacteria | 2632 |
| 190 | Ga0207641_10464744 | 3300026088 | Bacteria | 1224 |
| 191 | Ga0207674_10021023 | 3300026116 | Bacteria | 7038 |
| 192 | Ga0207674_10122602 | 3300026116 | Bacteria | 2565 |
| 193 | Ga0207674_10246083 | 3300026116 | Bacteria | 1735 |
| 194 | Ga0207675_100006660 | 3300026118 | Bacteria | 10929 |
| 195 | Ga0207683_10000558 | 3300026121 | Bacteria | 34428 |
| 196 | Ga0207683_10052120 | 3300026121 | Bacteria | 3585 |
| 197 | Ga0209371_1008803 | 3300027312 | Bacteria | 3295 |
| 198 | Ga0268266_10002138 | 3300028379 | Bacteria | 21775 |
| 199 | Ga0268266_10059472 | 3300028379 | Bacteria | 3293 |
| 200 | Ga0268265_10066935 | 3300028380 | Bacteria | 2779 |
| 201 | Ga0268264_10050028 | 3300028381 | Bacteria | 3479 |
| 202 | Ga0268264_10095453 | 3300028381 | Bacteria | 2573 |
| 203 | Ga0307517_10059196 | 3300028786 | Bacteria | 3673 |
| 204 | Ga0307515_10001617 | 3300028794 | Bacteria | 50228 |
| 205 | Ga0307515_10018584 | 3300028794 | Bacteria | 12560 |
| 206 | Ga0307515_10123340 | 3300028794 | Bacteria | 2915 |
| 207 | Ga0307515_10174043 | 3300028794 | Bacteria | 2131 |
| 208 | Ga0265338_10007751 | 3300028800 | Bacteria | 13211 |
| 209 | Ga0265338_10025364 | 3300028800 | Bacteria | 6018 |
| 210 | Ga0307511_10014203 | 3300030521 | Bacteria | 7751 |
| 211 | Ga0307511_10015988 | 3300030521 | Bacteria | 7247 |
| 212 | Ga0307512_10029811 | 3300030522 | Bacteria | 4758 |
| 213 | Ga0307512_10088477 | 3300030522 | Bacteria | 2173 |
| 214 | Ga0307513_10033310 | 3300031456 | Bacteria | 5792 |
| 215 | Ga0307513_10097245 | 3300031456 | Bacteria | 2979 |
| 216 | Ga0307513_10133134 | 3300031456 | Bacteria | 2427 |
| 217 | Ga0307509_10123349 | 3300031507 | Bacteria | 2563 |
| 218 | Ga0307508_10004580 | 3300031616 | Bacteria | 13457 |
| 219 | Ga0307514_10027363 | 3300031649 | Bacteria | 4606 |
| 220 | Ga0307514_10033526 | 3300031649 | Bacteria | 4097 |
| 221 | Ga0307514_10070706 | 3300031649 | Bacteria | 2620 |
| 222 | Ga0307516_10006178 | 3300031730 | Bacteria | 14097 |
| 223 | Ga0307516_10012725 | 3300031730 | Bacteria | 9043 |
| 224 | Ga0307518_10049331 | 3300031838 | Bacteria | 3060 |
| 225 | Ga0307406_10001678 | 3300031901 | Bacteria | 12177 |
| 226 | Ga0307407_10034076 | 3300031903 | Bacteria | 2784 |
| 227 | Ga0307409_100113163 | 3300031995 | Bacteria | 2280 |
| 228 | Ga0307416_100004305 | 3300032002 | Bacteria | 8548 |
| 229 | Ga0307416_100076216 | 3300032002 | Bacteria | 2810 |
| 230 | Ga0307416_100204595 | 3300032002 | Bacteria | 1877 |
| 231 | Ga0307414_10041944 | 3300032004 | Bacteria | 3105 |
| 232 | Ga0307414_10108194 | 3300032004 | Bacteria | 2108 |
| 233 | Ga0307415_100036361 | 3300032126 | Bacteria | 3225 |
| 234 | Ga0307507_10034694 | 3300033179 | Bacteria | 5203 |
| 235 | Ga0307507_10057244 | 3300033179 | Bacteria | 3673 |
| 236 | Ga0307510_10021098 | 3300033180 | Bacteria | 7599 |
| 237 | Ga0307510_10095691 | 3300033180 | Bacteria | 2788 |
| 238 | Ga0307510_10155037 | 3300033180 | Bacteria | 1899 |
| 239 | Ga0307510_10170555 | 3300033180 | Bacteria | 1755 |
| 240 | Ga0307510_10254722 | 3300033180 | Bacteria | 1240 |
| 241 | Ga0316212_1006041 | 3300033547 | Bacteria | 1758 |
| 242 | Ga0373926_0006875 | 3300035083 | Bacteria | 3782 |
| 243 | Ga0373928_0004916 | 3300035084 | Bacteria | 2547 |
| 244 | Ga0373934_0075919 | 3300035086 | Bacteria | 1347 |
| 245 | Ga0373944_0000461 | 3300035089 | Bacteria | 9453 |
| 246 | Ga0373949_0030878 | 3300035090 | Bacteria | 1275 |
| 247 | Ga0373951_0010037 | 3300035091 | Bacteria | 2125 |
| 248 | Ga0373952_0011595 | 3300035092 | Bacteria | 1722 |
| 249 | Ga0373923_0020436 | 3300035111 | Bacteria | 2572 |
| 250 | Ga0373936_0000278 | 3300035113 | Bacteria | 17059 |
| 251 | Ga0373936_0038826 | 3300035113 | Bacteria | 1904 |
| 252 | Ga0373939_0042787 | 3300035114 | Bacteria | 1371 |
| 253 | Ga0373945_0000084 | 3300035116 | Bacteria | 21863 |
| 254 | Ga0373945_0004823 | 3300035116 | Bacteria | 4296 |
| 255 | Ga0373953_0026912 | 3300035117 | Bacteria | 2206 |
| 256 | Ga0373956_0012266 | 3300035119 | Bacteria | 3549 |
| 257 | Ga0373957_0073032 | 3300035120 | Bacteria | 1344 |
| 258 | Ga0373960_0009885 | 3300035121 | Bacteria | 2320 |
| 259 | Ga0373943_0000119 | 3300035170 | Bacteria | 29368 |
| 260 | Ga0373946_0000484 | 3300035171 | Bacteria | 13152 |
| 261 | Ga0373946_0001797 | 3300035171 | Bacteria | 7478 |
| 262 | Ga0373955_0017885 | 3300035172 | Bacteria | 3514 |
| 263 | Ga0373935_0002246 | 3300035692 | Bacteria | 10991 |
| 264 | Ga0373935_0069159 | 3300035692 | Bacteria | 2273 |
| 265 | Ga0373927_0000726 | 3300035695 | Bacteria | 25216 |
| 266 | Ga0373947_0000141 | 3300035725 | Bacteria | 37478 |
| 267 | Ga0373947_0008944 | 3300035725 | Bacteria | 5756 |
| 268 | Ga0373937_0374266 | 3300036401 | Bacteria | 1350 |
| 269 | Ga0373925_0000799 | 3300037068 | Bacteria | 29013 |
| 270 | Ga0373925_0001150 | 3300037068 | Bacteria | 23461 |
| 271 | Ga0395900_0253262 | 3300037418 | Bacteria | 1761 |
| 272 | Ga0395900_0314677 | 3300037418 | Bacteria | 1548 |
| 273 | Ga0395898_0068644 | 3300037466 | Bacteria | 3430 |
| 274 | Ga0395898_0150183 | 3300037466 | Bacteria | 2230 |
| 275 | Ga0436364_0687596 | 3300037853 | Bacteria | 1636 |
| 276 | Ga0395901_0040566 | 3300038443 | Bacteria | 4822 |
| 277 | Ga0436361_0970262 | 3300039447 | Bacteria | 2136 |
| 278 | Ga0439436_0000125 | 3300041404 | Bacteria | 17780 |
| 279 | Ga0439436_0001917 | 3300041404 | Bacteria | 6157 |
| 280 | Ga0439439_0007729 | 3300041406 | Bacteria | 2520 |
| 281 | Ga0439439_0009676 | 3300041406 | Bacteria | 2297 |
| 282 | Ga0451853_1868916 | 3300041512 | Bacteria | 2665 |
| 283 | Ga0451853_2253133 | 3300041512 | Bacteria | 2347 |
| 284 | Ga0451853_2373291 | 3300041512 | Bacteria | 1678 |
| 285 | Ga0439448_0013296 | 3300042005 | Bacteria | 2472 |
| 286 | Ga0439449_0002264 | 3300042007 | Bacteria | 7565 |
| 287 | Ga0439449_0020532 | 3300042007 | Bacteria | 2474 |
| 288 | Ga0439450_004963 | 3300042008 | Bacteria | 2309 |
| 289 | Ga0439455_0000667 | 3300042012 | Bacteria | 5045 |
| 290 | Ga0439455_0004610 | 3300042012 | Bacteria | 2745 |
| 291 | Ga0439457_001349 | 3300042014 | Bacteria | 7373 |
| 292 | Ga0439457_006283 | 3300042014 | Bacteria | 2918 |
| 293 | Ga0439462_0003587 | 3300042015 | Bacteria | 3735 |
| 294 | Ga0450894_000037 | 3300042131 | Bacteria | 19538 |
| 295 | Ga0450896_000889 | 3300042133 | Bacteria | 3436 |
| 296 | Ga0450899_000077 | 3300042135 | Bacteria | 8149 |
| 297 | Ga0450906_000093 | 3300042145 | Bacteria | 14880 |
| 298 | Ga0450908_002524 | 3300042184 | Bacteria | 3588 |
| 299 | Ga0439459_0008827 | 3300042438 | Bacteria | 1732 |
| 300 | Ga0466969_0019127 | 3300044656 | Bacteria | 3563 |
| 301 | Ga0466972_0002655 | 3300044658 | Bacteria | 8854 |
| 302 | Ga0466972_0008487 | 3300044658 | Bacteria | 5153 |
| 303 | Ga0466972_0025634 | 3300044658 | Bacteria | 2920 |
| 304 | Ga0466972_0028025 | 3300044658 | Bacteria | 2783 |
| 305 | Ga0466965_0000976 | 3300044683 | Bacteria | 11072 |
| 306 | Ga0466966_0017463 | 3300044684 | Bacteria | 4740 |
| 307 | Ga0466961_0024027 | 3300044693 | Bacteria | 3921 |
| 308 | Ga0466961_0047153 | 3300044693 | Bacteria | 2755 |
| 309 | Ga0466963_0000616 | 3300044694 | Bacteria | 17068 |
| 310 | Ga0466963_0039416 | 3300044694 | Bacteria | 3093 |
| 311 | Ga0466964_0009239 | 3300044706 | Bacteria | 3708 |
| 312 | Ga0466971_0001392 | 3300044719 | Bacteria | 10146 |
| 313 | Ga0466971_0045785 | 3300044719 | Bacteria | 1965 |
| 314 | Ga0466968_0015675 | 3300044735 | Bacteria | 3008 |
| 315 | Ga0466970_0000087 | 3300044765 | Bacteria | 38510 |
| 316 | Ga0466970_0007752 | 3300044765 | Bacteria | 5386 |
| 317 | Ga0466970_0009370 | 3300044765 | Bacteria | 4947 |
| 318 | Ga0466970_0019253 | 3300044765 | Bacteria | 3538 |
| 319 | Ga0466970_0042026 | 3300044765 | Bacteria | 2430 |
| 320 | Ga0466957_0070608 | 3300044842 | Bacteria | 2158 |
| 321 | Ga0466967_0009681 | 3300045976 | Bacteria | 7170 |
| 322 | Ga0466967_0009957 | 3300045976 | Bacteria | 7095 |
| 323 | Ga0466967_0033816 | 3300045976 | Bacteria | 4332 |
| 324 | Ga0466967_0038140 | 3300045976 | Bacteria | 4118 |
| 325 | Ga0495592_0029277 | 3300046454 | Bacteria | 4170 |
| 326 | Ga0495592_0048009 | 3300046454 | Bacteria | 3177 |
| 327 | Ga0495603_0001577 | 3300046455 | Bacteria | 13336 |
| 328 | Ga0495603_0016731 | 3300046455 | Bacteria | 4435 |
| 329 | Ga0495603_0017955 | 3300046455 | Bacteria | 4281 |
| 330 | Ga0495603_0048845 | 3300046455 | Bacteria | 2519 |
| 331 | Ga0495629_0001919 | 3300046459 | Bacteria | 16205 |
| 332 | Ga0495629_0004087 | 3300046459 | Bacteria | 10948 |
| 333 | Ga0495629_0014235 | 3300046459 | Bacteria | 5728 |
| 334 | Ga0495629_0018577 | 3300046459 | Bacteria | 4972 |
| 335 | Ga0495629_0051936 | 3300046459 | Bacteria | 2868 |
| 336 | Ga0495629_0070291 | 3300046459 | Bacteria | 2442 |
| 337 | Ga0495629_0153632 | 3300046459 | Bacteria | 1599 |
| 338 | Ga0495638_0032314 | 3300046460 | Bacteria | 3356 |
| 339 | Ga0495641_0017048 | 3300046461 | Bacteria | 3799 |
| 340 | Ga0495651_0007284 | 3300046462 | Bacteria | 8456 |
| 341 | Ga0495651_0044734 | 3300046462 | Bacteria | 3431 |
| 342 | Ga0495651_0177975 | 3300046462 | Bacteria | 1508 |
| 343 | Ga0495653_0008878 | 3300046463 | Bacteria | 8223 |
| 344 | Ga0495653_0080297 | 3300046463 | Bacteria | 2413 |
| 345 | Ga0495582_0007628 | 3300046473 | Bacteria | 5981 |
| 346 | Ga0495582_0043033 | 3300046473 | Bacteria | 2487 |
| 347 | Ga0495582_0073963 | 3300046473 | Bacteria | 1886 |
| 348 | Ga0495605_0012782 | 3300046474 | Bacteria | 4646 |
| 349 | Ga0495605_0020240 | 3300046474 | Bacteria | 3538 |
| 350 | Ga0495639_0005702 | 3300046475 | Bacteria | 5355 |
| 351 | Ga0495662_0005123 | 3300046476 | Bacteria | 6565 |
| 352 | Ga0495662_0006659 | 3300046476 | Bacteria | 5763 |
| 353 | Ga0495662_0010595 | 3300046476 | Bacteria | 4508 |
| 354 | Ga0495664_0002082 | 3300046477 | Bacteria | 10703 |
| 355 | Ga0495664_0011486 | 3300046477 | Bacteria | 4995 |
| 356 | Ga0495585_0060008 | 3300046492 | Bacteria | 2095 |
| 357 | Ga0495594_0000151 | 3300046499 | Bacteria | 33013 |
| 358 | Ga0495594_0012685 | 3300046499 | Bacteria | 4395 |
| 359 | Ga0495594_0018104 | 3300046499 | Bacteria | 3730 |
| 360 | Ga0495594_0026491 | 3300046499 | Bacteria | 3119 |
| 361 | Ga0495594_0033733 | 3300046499 | Bacteria | 2784 |
| 362 | Ga0495594_0036254 | 3300046499 | Bacteria | 2689 |
| 363 | Ga0495607_0150956 | 3300046501 | Bacteria | 1189 |
| 364 | Ga0495608_0054715 | 3300046511 | Bacteria | 2638 |
| 365 | Ga0495608_0054723 | 3300046511 | Bacteria | 2638 |
| 366 | Ga0495610_0049794 | 3300046512 | Bacteria | 2049 |
| 367 | Ga0495616_0017012 | 3300046513 | Bacteria | 4014 |
| 368 | Ga0495620_0011340 | 3300046515 | Bacteria | 4649 |
| 369 | Ga0495628_0027887 | 3300046516 | Bacteria | 4591 |
| 370 | Ga0495628_0071089 | 3300046516 | Bacteria | 2713 |
| 371 | Ga0495630_0006432 | 3300046517 | Bacteria | 8357 |
| 372 | Ga0495631_0005294 | 3300046518 | Bacteria | 6775 |
| 373 | Ga0495637_0027447 | 3300046520 | Bacteria | 2547 |
| 374 | Ga0495643_0011246 | 3300046522 | Bacteria | 5463 |
| 375 | Ga0495648_0033113 | 3300046524 | Bacteria | 3380 |
| 376 | Ga0495652_0008484 | 3300046529 | Bacteria | 9375 |
| 377 | Ga0495652_0022853 | 3300046529 | Bacteria | 5548 |
| 378 | Ga0495654_0012180 | 3300046530 | Bacteria | 4627 |
| 379 | Ga0495665_0033551 | 3300046531 | Bacteria | 2745 |
| 380 | Ga0495640_0007645 | 3300046533 | Bacteria | 8499 |
| 381 | Ga0495640_0030845 | 3300046533 | Bacteria | 3833 |
| 382 | Ga0495586_0026471 | 3300046535 | Bacteria | 3103 |
| 383 | Ga0495587_0033380 | 3300046536 | Bacteria | 3107 |
| 384 | Ga0495587_0087460 | 3300046536 | Bacteria | 1803 |
| 385 | Ga0495609_0010839 | 3300046538 | Bacteria | 4356 |
| 386 | Ga0495597_0041673 | 3300046542 | Bacteria | 2049 |
| 387 | Ga0495645_0051369 | 3300046543 | Bacteria | 3000 |
| 388 | Ga0495645_0105425 | 3300046543 | Bacteria | 2000 |
| 389 | Ga0495622_0005199 | 3300046557 | Bacteria | 6031 |
| 390 | Ga0495633_0052813 | 3300046558 | Bacteria | 1913 |
| 391 | Ga0495667_0002180 | 3300046559 | Bacteria | 13083 |
| 392 | Ga0495667_0041508 | 3300046559 | Bacteria | 3051 |
| 393 | Ga0495667_0092538 | 3300046559 | Bacteria | 1958 |
| 394 | Ga0495668_0073248 | 3300046616 | Bacteria | 1881 |
| 395 | Ga0495668_0143195 | 3300046616 | Bacteria | 1308 |
| 396 | Ga0495634_0001776 | 3300046642 | Bacteria | 18660 |
| 397 | Ga0495611_0017431 | 3300046648 | Bacteria | 3072 |
| 398 | Ga0495625_0026795 | 3300046660 | Bacteria | 4348 |
| 399 | Ga0495625_0078233 | 3300046660 | Bacteria | 2309 |
| 400 | Ga0495625_0191563 | 3300046660 | Bacteria | 1354 |
| 401 | Ga0495635_0000701 | 3300046663 | Bacteria | 21595 |
| 402 | Ga0495635_0001270 | 3300046663 | Bacteria | 16868 |
| 403 | Ga0495661_0016076 | 3300046665 | Bacteria | 4972 |
| 404 | Ga0495588_0001826 | 3300046674 | Bacteria | 9071 |
| 405 | Ga0495588_0003754 | 3300046674 | Bacteria | 6642 |
| 406 | Ga0495588_0027033 | 3300046674 | Bacteria | 2866 |
| 407 | Ga0495657_0002809 | 3300046675 | Bacteria | 14470 |
| 408 | Ga0495657_0016267 | 3300046675 | Bacteria | 5421 |
| 409 | Ga0495599_0026447 | 3300046678 | Bacteria | 3636 |
| 410 | Ga0495599_0079018 | 3300046678 | Bacteria | 2054 |
| 411 | Ga0495623_0092392 | 3300046679 | Bacteria | 1855 |
| 412 | Ga0495646_0076248 | 3300046680 | Bacteria | 1964 |
| 413 | Ga0495647_0028764 | 3300046681 | Bacteria | 2051 |
| 414 | Ga0495658_0006519 | 3300046683 | Bacteria | 5734 |
| 415 | Ga0495658_0084553 | 3300046683 | Bacteria | 1868 |
| 416 | Ga0495613_0003082 | 3300046689 | Bacteria | 12452 |
| 417 | Ga0495613_0009204 | 3300046689 | Bacteria | 7324 |
| 418 | Ga0495613_0055352 | 3300046689 | Bacteria | 2914 |
| 419 | Ga0495613_0105546 | 3300046689 | Bacteria | 2033 |
| 420 | Ga0495624_0007672 | 3300046690 | Bacteria | 7573 |
| 421 | Ga0495671_0011019 | 3300046692 | Bacteria | 4991 |
| 422 | Ga0495649_0028152 | 3300046694 | Bacteria | 3115 |
| 423 | Ga0495589_0009062 | 3300046794 | Bacteria | 5173 |
| 424 | Ga0495589_0021920 | 3300046794 | Bacteria | 3263 |
| 425 | Ga0495589_0022462 | 3300046794 | Bacteria | 3219 |
| 426 | Ga0495600_0065896 | 3300046809 | Bacteria | 2368 |
| 427 | Ga0495600_0080921 | 3300046809 | Bacteria | 2120 |
| 428 | Ga0495581_0011020 | 3300047315 | Bacteria | 5225 |
| 429 | Ga0495581_0102568 | 3300047315 | Bacteria | 1662 |
| 430 | Ga0495581_0126521 | 3300047315 | Bacteria | 1488 |
| 431 | Ga0495604_0002054 | 3300047317 | Bacteria | 16246 |
| 432 | Ga0495604_0020250 | 3300047317 | Bacteria | 5316 |
| 433 | Ga0495636_0002978 | 3300047318 | Bacteria | 6550 |
| 434 | Ga0495636_0008299 | 3300047318 | Bacteria | 4100 |
| 435 | Ga0495636_0024186 | 3300047318 | Bacteria | 2462 |
| 436 | Ga0495636_0065785 | 3300047318 | Bacteria | 1540 |
| 437 | Ga0495636_0097607 | 3300047318 | Bacteria | 1281 |
| 438 | Ga0495674_0000739 | 3300047319 | Bacteria | 30884 |
| 439 | Ga0495674_0125374 | 3300047319 | Bacteria | 2167 |
| 440 | Ga0495676_0001188 | 3300047321 | Bacteria | 22211 |
| 441 | Ga0495676_0003601 | 3300047321 | Bacteria | 14057 |
| 442 | Ga0495676_0008085 | 3300047321 | Bacteria | 9651 |
| 443 | Ga0495676_0017612 | 3300047321 | Bacteria | 6312 |
| 444 | Ga0495676_0046759 | 3300047321 | Bacteria | 3508 |
| 445 | Ga0495676_0052646 | 3300047321 | Bacteria | 3247 |
| 446 | Ga0495676_0056053 | 3300047321 | Bacteria | 3119 |
| 447 | Ga0495680_0006565 | 3300047322 | Bacteria | 10794 |
| 448 | Ga0495680_0111234 | 3300047322 | Bacteria | 2029 |
| 449 | Ga0495683_0022666 | 3300047323 | Bacteria | 3229 |
| 450 | Ga0495687_011722 | 3300047443 | Bacteria | 4690 |
| 451 | Ga0495687_016714 | 3300047443 | Bacteria | 3682 |
| 452 | Ga0495687_037713 | 3300047443 | Bacteria | 2150 |
| 453 | Ga0495675_0070627 | 3300047444 | Bacteria | 2204 |
| 454 | Ga0495677_0022038 | 3300047445 | Bacteria | 2309 |
| 455 | Ga0495685_012006 | 3300047447 | Bacteria | 2930 |
| 456 | Ga0495681_0048152 | 3300047470 | Bacteria | 2023 |
| 457 | Ga0495684_0001876 | 3300047471 | Bacteria | 16827 |
| 458 | Ga0495684_0015935 | 3300047471 | Bacteria | 5788 |
| 459 | Ga0495684_0026721 | 3300047471 | Bacteria | 4435 |
| 460 | Ga0495684_0053522 | 3300047471 | Bacteria | 3080 |
| 461 | Ga0495593_0011515 | 3300047673 | Bacteria | 5077 |
| 462 | Ga0495593_0025998 | 3300047673 | Bacteria | 3236 |
| 463 | Ga0495614_0000088 | 3300048089 | Bacteria | 30664 |
| 464 | Ga0495614_0024349 | 3300048089 | Bacteria | 2613 |
| 465 | Ga0495626_0016013 | 3300048091 | Bacteria | 3821 |
| 466 | Ga0496102_0238870 | 3300048905 | Bacteria | 1713 |
| 467 | Ga0496103_0020268 | 3300048906 | Bacteria | 3995 |
| 468 | Ga0496103_0084930 | 3300048906 | Bacteria | 1994 |
| 469 | Ga0496104_0005657 | 3300048907 | Bacteria | 10946 |
| 470 | Ga0496106_0005516 | 3300048909 | Bacteria | 9360 |
| 471 | Ga0496107_0175563 | 3300048910 | Bacteria | 1590 |
| 472 | Ga0496108_0040929 | 3300048911 | Bacteria | 3865 |
| 473 | Ga0496108_0152023 | 3300048911 | Bacteria | 1997 |
| 474 | Ga0496109_0030590 | 3300048912 | Bacteria | 4826 |
| 475 | Ga0496110_0031946 | 3300048913 | Bacteria | 4543 |
| 476 | Ga0496111_0060140 | 3300048914 | Bacteria | 2753 |
| 477 | Ga0496113_0011663 | 3300048916 | Bacteria | 5877 |
| 478 | Ga0496113_0101301 | 3300048916 | Bacteria | 2232 |
| 479 | Ga0496115_0065632 | 3300048918 | Bacteria | 2932 |
| 480 | Ga0496115_0094525 | 3300048918 | Bacteria | 2445 |
| 481 | Ga0496117_0000585 | 3300048920 | Bacteria | 60104 |
| 482 | Ga0496119_0004150 | 3300048922 | Bacteria | 14575 |
| 483 | Ga0496119_0007131 | 3300048922 | Bacteria | 10147 |
| 484 | Ga0496120_0001621 | 3300048923 | Bacteria | 26118 |
| 485 | Ga0496122_0001174 | 3300048925 | Bacteria | 44774 |
| 486 | Ga0496123_0002245 | 3300048926 | Bacteria | 24434 |
| 487 | Ga0496124_0001320 | 3300048927 | Bacteria | 37380 |
| 488 | Ga0496125_0000077 | 3300048928 | Bacteria | 232629 |
| 489 | Ga0496125_0005847 | 3300048928 | Bacteria | 13504 |
| 490 | Ga0496126_0012878 | 3300048929 | Bacteria | 8544 |
| 491 | Ga0496126_0038577 | 3300048929 | Bacteria | 4443 |
| 492 | Ga0496126_0066101 | 3300048929 | Bacteria | 3234 |
| 493 | Ga0501031_0006724 | 3300049568 | Bacteria | 7501 |
| 494 | Ga0501032_0005448 | 3300049569 | Bacteria | 9447 |
| 495 | Ga0501032_0035355 | 3300049569 | Bacteria | 3416 |
| 496 | Ga0501032_0070984 | 3300049569 | Bacteria | 2322 |
| 497 | Ga0501033_0001923 | 3300049570 | Bacteria | 18084 |
| 498 | Ga0501033_0024436 | 3300049570 | Bacteria | 4558 |
| 499 | Ga0501034_0007616 | 3300049571 | Bacteria | 11519 |
| 500 | Ga0501034_0044899 | 3300049571 | Bacteria | 4466 |
| 501 | Ga0501036_0030091 | 3300049572 | Bacteria | 4587 |
| 502 | Ga0501037_0006882 | 3300049573 | Bacteria | 8305 |
| 503 | Ga0501037_0072369 | 3300049573 | Bacteria | 2507 |
| 504 | Ga0501037_0225256 | 3300049573 | Bacteria | 1318 |
| 505 | Ga0501038_0007747 | 3300049574 | Bacteria | 9899 |
| 506 | Ga0501038_0027304 | 3300049574 | Bacteria | 5080 |
| 507 | Ga0501038_0052635 | 3300049574 | Bacteria | 3509 |
| 508 | Ga0501042_0057353 | 3300049578 | Bacteria | 2779 |
| 509 | Ga0501043_0008709 | 3300049579 | Bacteria | 7983 |
| 510 | Ga0501043_0011863 | 3300049579 | Bacteria | 6825 |
| 511 | Ga0501043_0040479 | 3300049579 | Bacteria | 3663 |
| 512 | Ga0501046_0005075 | 3300049580 | Bacteria | 11805 |
| 513 | Ga0501046_0066638 | 3300049580 | Bacteria | 2806 |
| 514 | Ga0501047_0035492 | 3300049581 | Bacteria | 4818 |
| 515 | Ga0501047_0056484 | 3300049581 | Bacteria | 3796 |
| 516 | Ga0501047_0088998 | 3300049581 | Bacteria | 2964 |
| 517 | Ga0501047_0089514 | 3300049581 | Bacteria | 2955 |
| 518 | Ga0501047_0102429 | 3300049581 | Bacteria | 2742 |
| 519 | Ga0501048_0001906 | 3300049582 | Bacteria | 15830 |
| 520 | Ga0501070_0000534 | 3300049586 | Bacteria | 34857 |
| 521 | Ga0501070_0176682 | 3300049586 | Bacteria | 1758 |
| 522 | Ga0501070_0199229 | 3300049586 | Bacteria | 1645 |
| 523 | Ga0501074_0013961 | 3300049590 | Bacteria | 5837 |
| 524 | Ga0501080_0048838 | 3300049742 | Bacteria | 3937 |
| 525 | Ga0501035_0010126 | 3300049822 | Bacteria | 8750 |
| 526 | Ga0501035_0033245 | 3300049822 | Bacteria | 4690 |
| 527 | Ga0501044_0000847 | 3300049823 | Bacteria | 36738 |
| 528 | Ga0501044_0005672 | 3300049823 | Bacteria | 13838 |
| 529 | Ga0501044_0014121 | 3300049823 | Bacteria | 8622 |
| 530 | Ga0501044_0038244 | 3300049823 | Bacteria | 5011 |
| 531 | Ga0501044_0059992 | 3300049823 | Bacteria | 3896 |
| 532 | nmdc:mga00v17_105631_c2 | 3300050491 | Bacteria | 1475 |
| 533 | nmdc:mga06z11_3893_c1 | 3300050494 | Bacteria | 5820 |
| 534 | nmdc:mga05p37_140663_c1 | 3300050507 | Bacteria | 2957 |
| 535 | nmdc:mga09592_198655_c1 | 3300050508 | Bacteria | 1736 |
| 536 | nmdc:mga08y16_5861_c1 | 3300050511 | Bacteria | 12873 |
| 537 | nmdc:mga0n895_19936_c1 | 3300050512 | Bacteria | 6244 |
| 538 | nmdc:mga08x19_228300_c1 | 3300050514 | Bacteria | 1281 |
| 539 | nmdc:mga0a205_9224_c1 | 3300050515 | Bacteria | 9008 |
| 540 | Ga0495601_0171870 | 3300053077 | Bacteria | 1416 |
| 541 | Ga0500644_0052741 | 3300053088 | Bacteria | 1401 |
| 542 | Ga0500641_0032258 | 3300053096 | Bacteria | 2071 |
| 543 | Ga0466962_0000455 | 3300061719 | Bacteria | 17755 |
| 544 | Ga0466962_0003816 | 3300061719 | Bacteria | 7201 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0065632 | Ga0496115_0065632_16_891 | 285 |
| 2 | 3300044693 | Ga0466961_0047153 | Ga0466961_0047153_25_915 | 288 |
| 3 | 3300039447 | Ga0436361_0970262 | Ga0436361_0970262_1015_1932 | 301 |
| 4 | iso_pu_bacteria | 2954682443 | 2954685464 | 317 |
| 5 | 3300003322 | rootL2_10020111 | rootL2_100201111 | 327 |
| 6 | 3300003316 | rootH1_10013452 | rootH1_100134522 | 343 |
| 7 | 3300005355 | Ga0070671_100003983 | Ga0070671_10000398316 | 344 |
| 8 | 3300005548 | Ga0070665_100001778 | Ga0070665_1000017781 | 344 |
| 9 | 3300005843 | Ga0068860_100275835 | Ga0068860_1002758352 | 344 |
| 10 | 3300028379 | Ga0268266_10002138 | Ga0268266_1000213824 | 344 |
| 11 | 3300028381 | Ga0268264_10050028 | Ga0268264_100500281 | 344 |
| 12 | 3300035692 | Ga0373935_0069159 | Ga0373935_0069159_619_1659 | 345 |
| 13 | iso_pu_bacteria | 2866612099 | 2866618752 | 345 |
| 14 | iso_pu_bacteria | 2899359706 | 2899360201 | 345 |
| 15 | iso_pu_bacteria | 2582580736 | 2583152311 | 346 |
| 16 | iso_pu_bacteria | 2795385470 | 2795779802 | 346 |
| 17 | iso_pu_bacteria | 2643221724 | 2644679518 | 347 |
| 18 | iso_pu_bacteria | 2728369380 | 2730229025 | 347 |
| 19 | iso_pu_bacteria | 2870628048 | 2870630721 | 347 |
| 20 | iso_pu_bacteria | 2917736166 | 2917737508 | 347 |
| 21 | iso_pu_bacteria | 2946033335 | 2946034379 | 347 |
| 22 | 3300031838 | Ga0307518_10049331 | Ga0307518_100493313 | 348 |
| 23 | 3300042005 | Ga0439448_0013296 | Ga0439448_0013296_469_1533 | 348 |
| 24 | iso_pu_bacteria | 2643221597 | 2643997623 | 348 |
| 25 | iso_pu_bacteria | 2643221962 | 2645723596 | 348 |
| 26 | iso_pu_bacteria | 2675903058 | 2676477814 | 348 |
| 27 | iso_pu_bacteria | 2827628540 | 2827629138 | 348 |
| 28 | iso_pu_bacteria | 2833709550 | 2833711355 | 348 |
| 29 | iso_pu_bacteria | 2855386786 | 2855389051 | 348 |
| 30 | iso_pu_bacteria | 8016254467 | 8016257195 | 348 |
| 31 | 3300005328 | Ga0070676_10090160 | Ga0070676_100901601 | 349 |
| 32 | 3300005335 | Ga0070666_10029086 | Ga0070666_100290862 | 349 |
| 33 | 3300005336 | Ga0070680_100069713 | Ga0070680_1000697132 | 349 |
| 34 | 3300005339 | Ga0070660_100053486 | Ga0070660_1000534862 | 349 |
| 35 | 3300005340 | Ga0070689_100112099 | Ga0070689_1001120991 | 349 |
| 36 | 3300005341 | Ga0070691_10012855 | Ga0070691_100128553 | 349 |
| 37 | 3300005344 | Ga0070661_100070184 | Ga0070661_1000701842 | 349 |
| 38 | 3300005356 | Ga0070674_100392581 | Ga0070674_1003925811 | 349 |
| 39 | 3300005364 | Ga0070673_100054815 | Ga0070673_1000548152 | 349 |
| 40 | 3300005367 | Ga0070667_100293450 | Ga0070667_1002934502 | 349 |
| 41 | 3300005436 | Ga0070713_100359505 | Ga0070713_1003595052 | 349 |
| 42 | 3300005438 | Ga0070701_10027477 | Ga0070701_100274772 | 349 |
| 43 | 3300005439 | Ga0070711_100064291 | Ga0070711_1000642911 | 349 |
| 44 | 3300005444 | Ga0070694_100323416 | Ga0070694_1003234161 | 349 |
| 45 | 3300005445 | Ga0070708_100038777 | Ga0070708_1000387772 | 349 |
| 46 | 3300005445 | Ga0070708_100094026 | Ga0070708_1000940262 | 349 |
| 47 | 3300005455 | Ga0070663_100231749 | Ga0070663_1002317492 | 349 |
| 48 | 3300005457 | Ga0070662_100325271 | Ga0070662_1003252712 | 349 |
| 49 | 3300005458 | Ga0070681_10104204 | Ga0070681_101042043 | 349 |
| 50 | 3300005467 | Ga0070706_100034361 | Ga0070706_1000343613 | 349 |
| 51 | 3300005468 | Ga0070707_100056623 | Ga0070707_1000566233 | 349 |
| 52 | 3300005471 | Ga0070698_100021955 | Ga0070698_1000219557 | 349 |
| 53 | 3300005471 | Ga0070698_100038750 | Ga0070698_1000387502 | 349 |
| 54 | 3300005530 | Ga0070679_100104852 | Ga0070679_1001048522 | 349 |
| 55 | 3300005539 | Ga0068853_100047395 | Ga0068853_1000473952 | 349 |
| 56 | 3300005543 | Ga0070672_100031002 | Ga0070672_1000310023 | 349 |
| 57 | 3300005544 | Ga0070686_100034172 | Ga0070686_1000341722 | 349 |
| 58 | 3300005545 | Ga0070695_100008066 | Ga0070695_1000080664 | 349 |
| 59 | 3300005547 | Ga0070693_100058800 | Ga0070693_1000588002 | 349 |
| 60 | 3300005548 | Ga0070665_100312474 | Ga0070665_1003124742 | 349 |
| 61 | 3300005549 | Ga0070704_100117106 | Ga0070704_1001171062 | 349 |
| 62 | 3300005564 | Ga0070664_100045344 | Ga0070664_1000453443 | 349 |
| 63 | 3300005577 | Ga0068857_100023265 | Ga0068857_1000232653 | 349 |
| 64 | 3300005578 | Ga0068854_100175713 | Ga0068854_1001757132 | 349 |
| 65 | 3300005615 | Ga0070702_100016862 | Ga0070702_1000168623 | 349 |
| 66 | 3300005617 | Ga0068859_100122025 | Ga0068859_1001220252 | 349 |
| 67 | 3300005841 | Ga0068863_100057543 | Ga0068863_1000575433 | 349 |
| 68 | 3300005843 | Ga0068860_100078304 | Ga0068860_1000783042 | 349 |
| 69 | 3300005844 | Ga0068862_100051249 | Ga0068862_1000512492 | 349 |
| 70 | 3300005983 | Ga0081540_1000037 | Ga0081540_100003711 | 349 |
| 71 | 3300006358 | Ga0068871_100073746 | Ga0068871_1000737462 | 349 |
| 72 | 3300006881 | Ga0068865_100318707 | Ga0068865_1003187072 | 349 |
| 73 | 3300006931 | Ga0097620_100122024 | Ga0097620_1001220242 | 349 |
| 74 | 3300009101 | Ga0105247_10132690 | Ga0105247_101326902 | 349 |
| 75 | 3300009174 | Ga0105241_10066723 | Ga0105241_100667232 | 349 |
| 76 | 3300009176 | Ga0105242_10017678 | Ga0105242_100176784 | 349 |
| 77 | 3300009551 | Ga0105238_10432343 | Ga0105238_104323432 | 349 |
| 78 | 3300009553 | Ga0105249_10048872 | Ga0105249_100488723 | 349 |
| 79 | 3300011119 | Ga0105246_10014236 | Ga0105246_100142363 | 349 |
| 80 | 3300013100 | Ga0157373_10065688 | Ga0157373_100656881 | 349 |
| 81 | 3300013102 | Ga0157371_10136624 | Ga0157371_101366242 | 349 |
| 82 | 3300013296 | Ga0157374_10108637 | Ga0157374_101086373 | 349 |
| 83 | 3300013297 | Ga0157378_10289876 | Ga0157378_102898762 | 349 |
| 84 | 3300013306 | Ga0163162_10579114 | Ga0163162_105791142 | 349 |
| 85 | 3300014326 | Ga0157380_10063764 | Ga0157380_100637644 | 349 |
| 86 | 3300020081 | Ga0206354_11360300 | Ga0206354_113603002 | 349 |
| 87 | 3300021377 | Ga0213874_10023183 | Ga0213874_100231831 | 349 |
| 88 | 3300025885 | Ga0207653_10003977 | Ga0207653_100039772 | 349 |
| 89 | 3300025898 | Ga0207692_10103379 | Ga0207692_101033792 | 349 |
| 90 | 3300025901 | Ga0207688_10022343 | Ga0207688_100223432 | 349 |
| 91 | 3300025907 | Ga0207645_10119010 | Ga0207645_101190102 | 349 |
| 92 | 3300025908 | Ga0207643_10017166 | Ga0207643_100171663 | 349 |
| 93 | 3300025915 | Ga0207693_10060282 | Ga0207693_100602822 | 349 |
| 94 | 3300025917 | Ga0207660_10204258 | Ga0207660_102042582 | 349 |
| 95 | 3300025918 | Ga0207662_10024168 | Ga0207662_100241682 | 349 |
| 96 | 3300025919 | Ga0207657_10001310 | Ga0207657_100013105 | 349 |
| 97 | 3300025928 | Ga0207700_10076087 | Ga0207700_100760872 | 349 |
| 98 | 3300025928 | Ga0207700_10101507 | Ga0207700_101015072 | 349 |
| 99 | 3300025929 | Ga0207664_10036163 | Ga0207664_100361632 | 349 |
| 100 | 3300025929 | Ga0207664_10144740 | Ga0207664_101447402 | 349 |
| 101 | 3300025931 | Ga0207644_10002584 | Ga0207644_100025841 | 349 |
| 102 | 3300025931 | Ga0207644_10230822 | Ga0207644_102308221 | 349 |
| 103 | 3300025937 | Ga0207669_10073685 | Ga0207669_100736852 | 349 |
| 104 | 3300025940 | Ga0207691_10053368 | Ga0207691_100533682 | 349 |
| 105 | 3300025942 | Ga0207689_10046652 | Ga0207689_100466522 | 349 |
| 106 | 3300025945 | Ga0207679_10075405 | Ga0207679_100754052 | 349 |
| 107 | 3300025960 | Ga0207651_10191933 | Ga0207651_101919331 | 349 |
| 108 | 3300025961 | Ga0207712_10263585 | Ga0207712_102635851 | 349 |
| 109 | 3300025981 | Ga0207640_10057783 | Ga0207640_100577832 | 349 |
| 110 | 3300026067 | Ga0207678_10002951 | Ga0207678_100029514 | 349 |
| 111 | 3300026075 | Ga0207708_10009034 | Ga0207708_100090345 | 349 |
| 112 | 3300026088 | Ga0207641_10093722 | Ga0207641_100937223 | 349 |
| 113 | 3300026116 | Ga0207674_10021023 | Ga0207674_100210233 | 349 |
| 114 | 3300026118 | Ga0207675_100006660 | Ga0207675_1000066606 | 349 |
| 115 | 3300026121 | Ga0207683_10052120 | Ga0207683_100521203 | 349 |
| 116 | 3300028380 | Ga0268265_10066935 | Ga0268265_100669352 | 349 |
| 117 | 3300028381 | Ga0268264_10095453 | Ga0268264_100954532 | 349 |
| 118 | 3300035083 | Ga0373926_0006875 | Ga0373926_0006875_190_1242 | 349 |
| 119 | 3300035084 | Ga0373928_0004916 | Ga0373928_0004916_656_1714 | 349 |
| 120 | 3300035086 | Ga0373934_0075919 | Ga0373934_0075919_263_1324 | 349 |
| 121 | 3300035089 | Ga0373944_0000461 | Ga0373944_0000461_6628_7680 | 349 |
| 122 | 3300035090 | Ga0373949_0030878 | Ga0373949_0030878_122_1180 | 349 |
| 123 | 3300035091 | Ga0373951_0010037 | Ga0373951_0010037_518_1576 | 349 |
| 124 | 3300035092 | Ga0373952_0011595 | Ga0373952_0011595_176_1234 | 349 |
| 125 | 3300035111 | Ga0373923_0020436 | Ga0373923_0020436_445_1506 | 349 |
| 126 | 3300035113 | Ga0373936_0000278 | Ga0373936_0000278_4283_5335 | 349 |
| 127 | 3300035113 | Ga0373936_0038826 | Ga0373936_0038826_481_1542 | 349 |
| 128 | 3300035114 | Ga0373939_0042787 | Ga0373939_0042787_132_1190 | 349 |
| 129 | 3300035116 | Ga0373945_0000084 | Ga0373945_0000084_10575_11627 | 349 |
| 130 | 3300035116 | Ga0373945_0004823 | Ga0373945_0004823_154_1215 | 349 |
| 131 | 3300035117 | Ga0373953_0026912 | Ga0373953_0026912_106_1167 | 349 |
| 132 | 3300035119 | Ga0373956_0012266 | Ga0373956_0012266_441_1505 | 349 |
| 133 | 3300035120 | Ga0373957_0073032 | Ga0373957_0073032_154_1212 | 349 |
| 134 | 3300035121 | Ga0373960_0009885 | Ga0373960_0009885_346_1404 | 349 |
| 135 | 3300035170 | Ga0373943_0000119 | Ga0373943_0000119_11328_12380 | 349 |
| 136 | 3300035171 | Ga0373946_0000484 | Ga0373946_0000484_3966_5018 | 349 |
| 137 | 3300035171 | Ga0373946_0001797 | Ga0373946_0001797_23_1084 | 349 |
| 138 | 3300035172 | Ga0373955_0017885 | Ga0373955_0017885_398_1459 | 349 |
| 139 | 3300035692 | Ga0373935_0002246 | Ga0373935_0002246_8753_9805 | 349 |
| 140 | 3300035695 | Ga0373927_0000726 | Ga0373927_0000726_11770_12822 | 349 |
| 141 | 3300035725 | Ga0373947_0000141 | Ga0373947_0000141_19476_20528 | 349 |
| 142 | 3300035725 | Ga0373947_0008944 | Ga0373947_0008944_2801_3862 | 349 |
| 143 | 3300036401 | Ga0373937_0374266 | Ga0373937_0374266_88_1143 | 349 |
| 144 | 3300037068 | Ga0373925_0001150 | Ga0373925_0001150_13648_14700 | 349 |
| 145 | 3300045976 | Ga0466967_0038140 | Ga0466967_0038140_2116_3168 | 349 |
| 146 | 3300046454 | Ga0495592_0048009 | Ga0495592_0048009_162_1223 | 349 |
| 147 | 3300046455 | Ga0495603_0017955 | Ga0495603_0017955_887_1948 | 349 |
| 148 | 3300046461 | Ga0495641_0017048 | Ga0495641_0017048_1166_2218 | 349 |
| 149 | 3300046462 | Ga0495651_0007284 | Ga0495651_0007284_6617_7672 | 349 |
| 150 | 3300046462 | Ga0495651_0044734 | Ga0495651_0044734_212_1264 | 349 |
| 151 | 3300046463 | Ga0495653_0008878 | Ga0495653_0008878_4037_5089 | 349 |
| 152 | 3300046463 | Ga0495653_0080297 | Ga0495653_0080297_862_1917 | 349 |
| 153 | 3300046473 | Ga0495582_0007628 | Ga0495582_0007628_347_1408 | 349 |
| 154 | 3300046475 | Ga0495639_0005702 | Ga0495639_0005702_4081_5142 | 349 |
| 155 | 3300046476 | Ga0495662_0006659 | Ga0495662_0006659_351_1412 | 349 |
| 156 | 3300046477 | Ga0495664_0002082 | Ga0495664_0002082_2813_3865 | 349 |
| 157 | 3300046499 | Ga0495594_0018104 | Ga0495594_0018104_1843_2904 | 349 |
| 158 | 3300046511 | Ga0495608_0054715 | Ga0495608_0054715_396_1448 | 349 |
| 159 | 3300046516 | Ga0495628_0071089 | Ga0495628_0071089_797_1849 | 349 |
| 160 | 3300046517 | Ga0495630_0006432 | Ga0495630_0006432_3704_4756 | 349 |
| 161 | 3300046529 | Ga0495652_0008484 | Ga0495652_0008484_1255_2307 | 349 |
| 162 | 3300046531 | Ga0495665_0033551 | Ga0495665_0033551_1257_2309 | 349 |
| 163 | 3300046533 | Ga0495640_0030845 | Ga0495640_0030845_2597_3649 | 349 |
| 164 | 3300046535 | Ga0495586_0026471 | Ga0495586_0026471_2016_3077 | 349 |
| 165 | 3300046536 | Ga0495587_0033380 | Ga0495587_0033380_1606_2667 | 349 |
| 166 | 3300046536 | Ga0495587_0087460 | Ga0495587_0087460_497_1549 | 349 |
| 167 | 3300046543 | Ga0495645_0105425 | Ga0495645_0105425_911_1966 | 349 |
| 168 | 3300046559 | Ga0495667_0002180 | Ga0495667_0002180_2472_3524 | 349 |
| 169 | 3300046559 | Ga0495667_0041508 | Ga0495667_0041508_1230_2285 | 349 |
| 170 | 3300046663 | Ga0495635_0001270 | Ga0495635_0001270_8290_9342 | 349 |
| 171 | 3300046678 | Ga0495599_0026447 | Ga0495599_0026447_2286_3347 | 349 |
| 172 | 3300046678 | Ga0495599_0079018 | Ga0495599_0079018_256_1311 | 349 |
| 173 | 3300046681 | Ga0495647_0028764 | Ga0495647_0028764_389_1450 | 349 |
| 174 | 3300046683 | Ga0495658_0006519 | Ga0495658_0006519_1604_2665 | 349 |
| 175 | 3300046690 | Ga0495624_0007672 | Ga0495624_0007672_4161_5213 | 349 |
| 176 | 3300046809 | Ga0495600_0080921 | Ga0495600_0080921_894_1946 | 349 |
| 177 | 3300047317 | Ga0495604_0020250 | Ga0495604_0020250_1994_3055 | 349 |
| 178 | 3300047319 | Ga0495674_0000739 | Ga0495674_0000739_351_1403 | 349 |
| 179 | 3300047321 | Ga0495676_0017612 | Ga0495676_0017612_3188_4249 | 349 |
| 180 | 3300047321 | Ga0495676_0056053 | Ga0495676_0056053_984_2036 | 349 |
| 181 | 3300047322 | Ga0495680_0006565 | Ga0495680_0006565_8276_9331 | 349 |
| 182 | 3300047322 | Ga0495680_0111234 | Ga0495680_0111234_225_1280 | 349 |
| 183 | 3300047444 | Ga0495675_0070627 | Ga0495675_0070627_312_1373 | 349 |
| 184 | 3300047471 | Ga0495684_0001876 | Ga0495684_0001876_5865_6917 | 349 |
| 185 | 3300047471 | Ga0495684_0015935 | Ga0495684_0015935_3715_4776 | 349 |
| 186 | 3300047471 | Ga0495684_0026721 | Ga0495684_0026721_776_1831 | 349 |
| 187 | 3300047673 | Ga0495593_0025998 | Ga0495593_0025998_45_1106 | 349 |
| 188 | 3300048905 | Ga0496102_0238870 | Ga0496102_0238870_637_1695 | 349 |
| 189 | 3300048906 | Ga0496103_0084930 | Ga0496103_0084930_744_1802 | 349 |
| 190 | 3300048910 | Ga0496107_0175563 | Ga0496107_0175563_479_1537 | 349 |
| 191 | 3300048911 | Ga0496108_0152023 | Ga0496108_0152023_921_1979 | 349 |
| 192 | 3300048913 | Ga0496110_0031946 | Ga0496110_0031946_1857_2915 | 349 |
| 193 | 3300048914 | Ga0496111_0060140 | Ga0496111_0060140_495_1553 | 349 |
| 194 | 3300048916 | Ga0496113_0101301 | Ga0496113_0101301_744_1802 | 349 |
| 195 | 3300048918 | Ga0496115_0094525 | Ga0496115_0094525_1133_2191 | 349 |
| 196 | 3300053077 | Ga0495601_0171870 | Ga0495601_0171870_85_1146 | 349 |
| 197 | iso_pu_bacteria | 8033684223 | 8033691452 | 349 |
| 198 | 3300005339 | Ga0070660_100042689 | Ga0070660_1000426892 | 350 |
| 199 | 3300005366 | Ga0070659_100115232 | Ga0070659_1001152322 | 350 |
| 200 | 3300025904 | Ga0207647_10043188 | Ga0207647_100431882 | 350 |
| 201 | 3300025932 | Ga0207690_10087528 | Ga0207690_100875282 | 350 |
| 202 | 3300028794 | Ga0307515_10123340 | Ga0307515_101233402 | 350 |
| 203 | 3300033179 | Ga0307507_10034694 | Ga0307507_100346946 | 350 |
| 204 | 3300044658 | Ga0466972_0025634 | Ga0466972_0025634_1466_2536 | 350 |
| 205 | 3300005327 | Ga0070658_10309633 | Ga0070658_103096331 | 351 |
| 206 | 3300005328 | Ga0070676_10045712 | Ga0070676_100457123 | 351 |
| 207 | 3300005338 | Ga0068868_100036941 | Ga0068868_1000369412 | 351 |
| 208 | 3300005339 | Ga0070660_100247389 | Ga0070660_1002473892 | 351 |
| 209 | 3300005341 | Ga0070691_10024845 | Ga0070691_100248453 | 351 |
| 210 | 3300005344 | Ga0070661_100191864 | Ga0070661_1001918641 | 351 |
| 211 | 3300005345 | Ga0070692_10023965 | Ga0070692_100239653 | 351 |
| 212 | 3300005355 | Ga0070671_100027438 | Ga0070671_1000274387 | 351 |
| 213 | 3300005365 | Ga0070688_100064615 | Ga0070688_1000646153 | 351 |
| 214 | 3300005366 | Ga0070659_100070520 | Ga0070659_1000705203 | 351 |
| 215 | 3300005434 | Ga0070709_10003363 | Ga0070709_100033639 | 351 |
| 216 | 3300005435 | Ga0070714_100014741 | Ga0070714_1000147414 | 351 |
| 217 | 3300005435 | Ga0070714_100017702 | Ga0070714_1000177024 | 351 |
| 218 | 3300005435 | Ga0070714_100036360 | Ga0070714_1000363602 | 351 |
| 219 | 3300005435 | Ga0070714_100116056 | Ga0070714_1001160561 | 351 |
| 220 | 3300005436 | Ga0070713_100033092 | Ga0070713_1000330922 | 351 |
| 221 | 3300005436 | Ga0070713_100040421 | Ga0070713_1000404212 | 351 |
| 222 | 3300005437 | Ga0070710_10002570 | Ga0070710_100025707 | 351 |
| 223 | 3300005457 | Ga0070662_100059477 | Ga0070662_1000594773 | 351 |
| 224 | 3300005458 | Ga0070681_10110524 | Ga0070681_101105243 | 351 |
| 225 | 3300005468 | Ga0070707_100000466 | Ga0070707_10000046638 | 351 |
| 226 | 3300005548 | Ga0070665_100330216 | Ga0070665_1003302162 | 351 |
| 227 | 3300005578 | Ga0068854_100322825 | Ga0068854_1003228251 | 351 |
| 228 | 3300005614 | Ga0068856_100024127 | Ga0068856_1000241272 | 351 |
| 229 | 3300005615 | Ga0070702_100001774 | Ga0070702_1000017744 | 351 |
| 230 | 3300005617 | Ga0068859_100117599 | Ga0068859_1001175992 | 351 |
| 231 | 3300005834 | Ga0068851_10010306 | Ga0068851_100103063 | 351 |
| 232 | 3300005840 | Ga0068870_10003104 | Ga0068870_100031049 | 351 |
| 233 | 3300005843 | Ga0068860_100372993 | Ga0068860_1003729932 | 351 |
| 234 | 3300006058 | Ga0075432_10031065 | Ga0075432_100310652 | 351 |
| 235 | 3300006358 | Ga0068871_100021131 | Ga0068871_1000211315 | 351 |
| 236 | 3300006844 | Ga0075428_100052509 | Ga0075428_1000525095 | 351 |
| 237 | 3300006847 | Ga0075431_100357045 | Ga0075431_1003570452 | 351 |
| 238 | 3300006871 | Ga0075434_100023900 | Ga0075434_1000239002 | 351 |
| 239 | 3300006914 | Ga0075436_100042426 | Ga0075436_1000424261 | 351 |
| 240 | 3300006931 | Ga0097620_100117592 | Ga0097620_1001175922 | 351 |
| 241 | 3300009098 | Ga0105245_10171670 | Ga0105245_101716702 | 351 |
| 242 | 3300009147 | Ga0114129_10116178 | Ga0114129_101161783 | 351 |
| 243 | 3300009174 | Ga0105241_10188474 | Ga0105241_101884742 | 351 |
| 244 | 3300009551 | Ga0105238_10124914 | Ga0105238_101249143 | 351 |
| 245 | 3300011119 | Ga0105246_10001918 | Ga0105246_100019185 | 351 |
| 246 | 3300013296 | Ga0157374_10032344 | Ga0157374_100323443 | 351 |
| 247 | 3300013308 | Ga0157375_10125964 | Ga0157375_101259643 | 351 |
| 248 | 3300014497 | Ga0182008_10073079 | Ga0182008_100730792 | 351 |
| 249 | 3300014968 | Ga0157379_10121278 | Ga0157379_101212783 | 351 |
| 250 | 3300014969 | Ga0157376_10215640 | Ga0157376_102156402 | 351 |
| 251 | 3300020070 | Ga0206356_10503846 | Ga0206356_105038463 | 351 |
| 252 | 3300025321 | Ga0207656_10013812 | Ga0207656_100138123 | 351 |
| 253 | 3300025901 | Ga0207688_10001356 | Ga0207688_1000135611 | 351 |
| 254 | 3300025908 | Ga0207643_10000252 | Ga0207643_1000025210 | 351 |
| 255 | 3300025910 | Ga0207684_10005507 | Ga0207684_1000550711 | 351 |
| 256 | 3300025912 | Ga0207707_10251495 | Ga0207707_102514952 | 351 |
| 257 | 3300025913 | Ga0207695_10080382 | Ga0207695_100803823 | 351 |
| 258 | 3300025915 | Ga0207693_10049796 | Ga0207693_100497963 | 351 |
| 259 | 3300025919 | Ga0207657_10012261 | Ga0207657_1001226112 | 351 |
| 260 | 3300025924 | Ga0207694_10040321 | Ga0207694_100403212 | 351 |
| 261 | 3300025925 | Ga0207650_10176573 | Ga0207650_101765732 | 351 |
| 262 | 3300025928 | Ga0207700_10033600 | Ga0207700_100336004 | 351 |
| 263 | 3300025928 | Ga0207700_10161653 | Ga0207700_101616531 | 351 |
| 264 | 3300025929 | Ga0207664_10196373 | Ga0207664_101963732 | 351 |
| 265 | 3300025941 | Ga0207711_10046215 | Ga0207711_100462154 | 351 |
| 266 | 3300025942 | Ga0207689_10005533 | Ga0207689_1000553310 | 351 |
| 267 | 3300025944 | Ga0207661_10076652 | Ga0207661_100766523 | 351 |
| 268 | 3300026035 | Ga0207703_10025518 | Ga0207703_100255182 | 351 |
| 269 | 3300026067 | Ga0207678_10001822 | Ga0207678_100018229 | 351 |
| 270 | 3300026088 | Ga0207641_10464744 | Ga0207641_104647441 | 351 |
| 271 | 3300026116 | Ga0207674_10246083 | Ga0207674_102460831 | 351 |
| 272 | 3300026121 | Ga0207683_10000558 | Ga0207683_1000055810 | 351 |
| 273 | 3300028379 | Ga0268266_10059472 | Ga0268266_100594722 | 351 |
| 274 | 3300031901 | Ga0307406_10001678 | Ga0307406_1000167813 | 351 |
| 275 | 3300032004 | Ga0307414_10108194 | Ga0307414_101081942 | 351 |
| 276 | 3300037068 | Ga0373925_0000799 | Ga0373925_0000799_27792_28862 | 351 |
| 277 | 3300042012 | Ga0439455_0004610 | Ga0439455_0004610_446_1522 | 351 |
| 278 | 3300042438 | Ga0439459_0008827 | Ga0439459_0008827_628_1704 | 351 |
| 279 | 3300044658 | Ga0466972_0028025 | Ga0466972_0028025_191_1264 | 351 |
| 280 | 3300044765 | Ga0466970_0000087 | Ga0466970_0000087_25908_26981 | 351 |
| 281 | 3300044765 | Ga0466970_0019253 | Ga0466970_0019253_1228_2307 | 351 |
| 282 | 3300048906 | Ga0496103_0020268 | Ga0496103_0020268_52_1128 | 351 |
| 283 | 3300048907 | Ga0496104_0005657 | Ga0496104_0005657_3546_4622 | 351 |
| 284 | 3300048909 | Ga0496106_0005516 | Ga0496106_0005516_5490_6566 | 351 |
| 285 | 3300048911 | Ga0496108_0040929 | Ga0496108_0040929_2232_3308 | 351 |
| 286 | 3300048916 | Ga0496113_0011663 | Ga0496113_0011663_4772_5848 | 351 |
| 287 | 3300048929 | Ga0496126_0066101 | Ga0496126_0066101_722_1795 | 351 |
| 288 | 3300049574 | Ga0501038_0052635 | Ga0501038_0052635_1043_2116 | 351 |
| 289 | 3300050507 | nmdc:mga05p37_140663_c1 | nmdc:mga05p37_140663_c1_1183_2259 | 351 |
| 290 | 3300050508 | nmdc:mga09592_198655_c1 | nmdc:mga09592_198655_c1_530_1606 | 351 |
| 291 | 3300050511 | nmdc:mga08y16_5861_c1 | nmdc:mga08y16_5861_c1_7312_8388 | 351 |
| 292 | 3300050512 | nmdc:mga0n895_19936_c1 | nmdc:mga0n895_19936_c1_5126_6202 | 351 |
| 293 | 3300050514 | nmdc:mga08x19_228300_c1 | nmdc:mga08x19_228300_c1_75_1151 | 351 |
| 294 | 3300050515 | nmdc:mga0a205_9224_c1 | nmdc:mga0a205_9224_c1_5563_6639 | 351 |
| 295 | 3300005327 | Ga0070658_10004154 | Ga0070658_100041547 | 352 |
| 296 | 3300005434 | Ga0070709_10052580 | Ga0070709_100525802 | 352 |
| 297 | 3300005539 | Ga0068853_100012964 | Ga0068853_1000129644 | 352 |
| 298 | 3300005937 | Ga0081455_10000288 | Ga0081455_1000028836 | 352 |
| 299 | 3300009551 | Ga0105238_10099745 | Ga0105238_100997452 | 352 |
| 300 | 3300026041 | Ga0207639_10006559 | Ga0207639_100065597 | 352 |
| 301 | 3300037466 | Ga0395898_0150183 | Ga0395898_0150183_473_1549 | 352 |
| 302 | 3300037853 | Ga0436364_0687596 | Ga0436364_0687596_23_1096 | 352 |
| 303 | 3300038443 | Ga0395901_0040566 | Ga0395901_0040566_1119_2195 | 352 |
| 304 | 3300048920 | Ga0496117_0000585 | Ga0496117_0000585_17642_18718 | 352 |
| 305 | 3300048922 | Ga0496119_0004150 | Ga0496119_0004150_2215_3291 | 352 |
| 306 | 3300048922 | Ga0496119_0007131 | Ga0496119_0007131_4804_5880 | 352 |
| 307 | 3300048923 | Ga0496120_0001621 | Ga0496120_0001621_4648_5724 | 352 |
| 308 | 3300048925 | Ga0496122_0001174 | Ga0496122_0001174_10102_11178 | 352 |
| 309 | 3300048926 | Ga0496123_0002245 | Ga0496123_0002245_13245_14321 | 352 |
| 310 | 3300048927 | Ga0496124_0001320 | Ga0496124_0001320_28045_29121 | 352 |
| 311 | 3300048928 | Ga0496125_0000077 | Ga0496125_0000077_207401_208477 | 352 |
| 312 | 3300048928 | Ga0496125_0005847 | Ga0496125_0005847_3454_4530 | 352 |
| 313 | 3300048929 | Ga0496126_0012878 | Ga0496126_0012878_2996_4072 | 352 |
| 314 | 3300050491 | nmdc:mga00v17_105631_c2 | nmdc:mga00v17_105631_c2_267_1343 | 352 |
| 315 | iso_pu_bacteria | 2558860280 | 2559426996 | 352 |
| 316 | iso_pu_bacteria | 2984580707 | 2984581454 | 352 |
| 317 | 3300005435 | Ga0070714_100026301 | Ga0070714_1000263013 | 353 |
| 318 | 3300005530 | Ga0070679_100128862 | Ga0070679_1001288622 | 353 |
| 319 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001117 | 353 |
| 320 | 3300026116 | Ga0207674_10122602 | Ga0207674_101226023 | 353 |
| 321 | 3300028800 | Ga0265338_10025364 | Ga0265338_100253643 | 353 |
| 322 | 3300030521 | Ga0307511_10014203 | Ga0307511_100142036 | 353 |
| 323 | 3300033547 | Ga0316212_1006041 | Ga0316212_10060412 | 353 |
| 324 | 3300048929 | Ga0496126_0038577 | Ga0496126_0038577_184_1254 | 353 |
| 325 | 3300025944 | Ga0207661_10147580 | Ga0207661_101475802 | 354 |
| 326 | 3300031903 | Ga0307407_10034076 | Ga0307407_100340762 | 354 |
| 327 | 3300031995 | Ga0307409_100113163 | Ga0307409_1001131632 | 354 |
| 328 | 3300032002 | Ga0307416_100004305 | Ga0307416_1000043057 | 354 |
| 329 | 3300032002 | Ga0307416_100076216 | Ga0307416_1000762162 | 354 |
| 330 | 3300032004 | Ga0307414_10041944 | Ga0307414_100419442 | 354 |
| 331 | 3300032126 | Ga0307415_100036361 | Ga0307415_1000363611 | 354 |
| 332 | 3300041512 | Ga0451853_2373291 | Ga0451853_2373291_86_1171 | 354 |
| 333 | 3300044656 | Ga0466969_0019127 | Ga0466969_0019127_145_1242 | 354 |
| 334 | 3300044765 | Ga0466970_0007752 | Ga0466970_0007752_3798_4895 | 354 |
| 335 | iso_pu_bacteria | 2547132111 | 2547408618 | 354 |
| 336 | iso_pu_bacteria | 2582581312 | 2585296360 | 354 |
| 337 | iso_pu_bacteria | 2582581313 | 2585307044 | 354 |
| 338 | iso_pu_bacteria | 2616644814 | 2616697061 | 354 |
| 339 | iso_pu_bacteria | 2616644941 | 2616900150 | 354 |
| 340 | iso_pu_bacteria | 2643221578 | 2643902505 | 354 |
| 341 | iso_pu_bacteria | 2643221647 | 2644263671 | 354 |
| 342 | iso_pu_bacteria | 2643221673 | 2644404076 | 354 |
| 343 | iso_pu_bacteria | 2643221678 | 2644439791 | 354 |
| 344 | iso_pu_bacteria | 2784746763 | 2785341437 | 354 |
| 345 | iso_pu_bacteria | 2786546132 | 2786672419 | 354 |
| 346 | iso_pu_bacteria | 2802429296 | 2804847674 | 354 |
| 347 | iso_pu_bacteria | 2808606359 | 2808843798 | 354 |
| 348 | iso_pu_bacteria | 2808606368 | 2808885972 | 354 |
| 349 | iso_pu_bacteria | 2808606982 | 2811844683 | 354 |
| 350 | iso_pu_bacteria | 2811994917 | 2812478992 | 354 |
| 351 | iso_pu_bacteria | 2818991463 | 2819694850 | 354 |
| 352 | iso_pu_bacteria | 2852635781 | 2852642031 | 354 |
| 353 | iso_pu_bacteria | 2862178590 | 2862179214 | 354 |
| 354 | iso_pu_bacteria | 2862281513 | 2862285005 | 354 |
| 355 | iso_pu_bacteria | 2862382967 | 2862385463 | 354 |
| 356 | iso_pu_bacteria | 2862507626 | 2862513251 | 354 |
| 357 | iso_pu_bacteria | 2862574272 | 2862577764 | 354 |
| 358 | iso_pu_bacteria | 2863404153 | 2863408370 | 354 |
| 359 | iso_pu_bacteria | 2873151551 | 2873154286 | 354 |
| 360 | iso_pu_bacteria | 2875391855 | 2875396450 | 354 |
| 361 | iso_pu_bacteria | 2877676314 | 2877679365 | 354 |
| 362 | iso_pu_bacteria | 2912715099 | 2912717959 | 354 |
| 363 | iso_pu_bacteria | 2912723979 | 2912730386 | 354 |
| 364 | iso_pu_bacteria | 2919468124 | 2919474305 | 354 |
| 365 | iso_pu_bacteria | 2935390628 | 2935391586 | 354 |
| 366 | iso_pu_bacteria | 2946045630 | 2946048107 | 354 |
| 367 | iso_pu_bacteria | 2947224130 | 2947227200 | 354 |
| 368 | iso_pu_bacteria | 2954380949 | 2954384254 | 354 |
| 369 | iso_pu_bacteria | 2954673503 | 2954678692 | 354 |
| 370 | iso_pu_bacteria | 2954691527 | 2954695076 | 354 |
| 371 | iso_pu_bacteria | 2954711539 | 2954714567 | 354 |
| 372 | iso_pu_bacteria | 2954721474 | 2954724512 | 354 |
| 373 | iso_pu_bacteria | 2954731030 | 2954737307 | 354 |
| 374 | iso_pu_bacteria | 2954740390 | 2954743433 | 354 |
| 375 | iso_pu_bacteria | 2954749733 | 2954756157 | 354 |
| 376 | iso_pu_bacteria | 2954759201 | 2954762390 | 354 |
| 377 | iso_pu_bacteria | 2966598605 | 2966601086 | 354 |
| 378 | iso_pu_bacteria | 2990059506 | 2990065310 | 354 |
| 379 | iso_pu_bacteria | 2990088156 | 2990089453 | 354 |
| 380 | iso_pu_bacteria | 3006393351 | 3006398176 | 354 |
| 381 | iso_pu_bacteria | 3006425503 | 3006430107 | 354 |
| 382 | iso_pu_bacteria | 3006486233 | 3006487760 | 354 |
| 383 | iso_pu_bacteria | 3006493962 | 3006494828 | 354 |
| 384 | iso_pu_bacteria | 8008558824 | 8008562542 | 354 |
| 385 | iso_pu_bacteria | 8008574985 | 8008577401 | 354 |
| 386 | iso_pu_bacteria | 8023623736 | 8023624816 | 354 |
| 387 | iso_pu_bacteria | 8025413630 | 8025416482 | 354 |
| 388 | iso_pu_bacteria | 8025478263 | 8025481594 | 354 |
| 389 | iso_pu_bacteria | 8048406513 | 8048406695 | 354 |
| 390 | iso_pu_bacteria | 8056667051 | 8056668966 | 354 |
| 391 | iso_pu_bacteria | 8056829672 | 8056831905 | 354 |
| 392 | 3300005329 | Ga0070683_100105911 | Ga0070683_1001059112 | 355 |
| 393 | 3300006051 | Ga0075364_10262573 | Ga0075364_102625731 | 355 |
| 394 | 3300013308 | Ga0157375_10202987 | Ga0157375_102029873 | 355 |
| 395 | 3300027312 | Ga0209371_1008803 | Ga0209371_10088035 | 355 |
| 396 | 3300028800 | Ga0265338_10007751 | Ga0265338_1000775111 | 355 |
| 397 | iso_pu_bacteria | 8056447290 | 8056449848 | 355 |
| 398 | iso_pu_bacteria | 2643221587 | 2643941566 | 356 |
| 399 | iso_pu_bacteria | 2643221670 | 2644386665 | 356 |
| 400 | iso_pu_bacteria | 2643221677 | 2644428650 | 356 |
| 401 | iso_pu_bacteria | 2867475112 | 2867478351 | 356 |
| 402 | iso_pu_bacteria | 2918501144 | 2918506246 | 356 |
| 403 | iso_pu_bacteria | 2997451912 | 2997453300 | 356 |
| 404 | iso_pu_bacteria | 8054160619 | 8054161236 | 356 |
| 405 | 3300046455 | Ga0495603_0001577 | Ga0495603_0001577_6563_7642 | 357 |
| 406 | 3300046459 | Ga0495629_0001919 | Ga0495629_0001919_7835_8914 | 357 |
| 407 | 3300046459 | Ga0495629_0004087 | Ga0495629_0004087_4398_5477 | 357 |
| 408 | 3300046492 | Ga0495585_0060008 | Ga0495585_0060008_852_1931 | 357 |
| 409 | 3300046499 | Ga0495594_0000151 | Ga0495594_0000151_21722_22801 | 357 |
| 410 | 3300046557 | Ga0495622_0005199 | Ga0495622_0005199_4350_5429 | 357 |
| 411 | 3300046674 | Ga0495588_0001826 | Ga0495588_0001826_5422_6501 | 357 |
| 412 | 3300046689 | Ga0495613_0055352 | Ga0495613_0055352_176_1255 | 357 |
| 413 | 3300047318 | Ga0495636_0024186 | Ga0495636_0024186_491_1570 | 357 |
| 414 | 3300047321 | Ga0495676_0003601 | Ga0495676_0003601_8853_9932 | 357 |
| 415 | 3300047321 | Ga0495676_0008085 | Ga0495676_0008085_5504_6583 | 357 |
| 416 | 3300048089 | Ga0495614_0000088 | Ga0495614_0000088_1678_2757 | 357 |
| 417 | iso_pu_bacteria | 2912757875 | 2912762520 | 357 |
| 418 | iso_pu_bacteria | 8025530807 | 8025537509 | 357 |
| 419 | 3300003316 | rootH1_10004178 | rootH1_100041782 | 358 |
| 420 | 3300003323 | rootH1_10006175 | rootH1_100061759 | 358 |
| 421 | 3300003323 | rootH1_10008994 | rootH1_100089943 | 358 |
| 422 | 3300003578 | Ga0006562J51391_1076183 | Ga0006562J51391_10761836 | 358 |
| 423 | 3300003578 | Ga0006562J51391_1076186 | Ga0006562J51391_10761861 | 358 |
| 424 | 3300003578 | Ga0006562J51391_1131149 | Ga0006562J51391_11311492 | 358 |
| 425 | 3300005937 | Ga0081455_10105888 | Ga0081455_101058882 | 358 |
| 426 | 3300006048 | Ga0075363_100002322 | Ga0075363_1000023226 | 358 |
| 427 | 3300006178 | Ga0075367_10000660 | Ga0075367_1000066011 | 358 |
| 428 | 3300006948 | Ga0099826_10020443 | Ga0099826_100204436 | 358 |
| 429 | 3300009148 | Ga0105243_10215639 | Ga0105243_102156392 | 358 |
| 430 | 3300011119 | Ga0105246_10008217 | Ga0105246_100082175 | 358 |
| 431 | 3300011119 | Ga0105246_10254041 | Ga0105246_102540412 | 358 |
| 432 | 3300014497 | Ga0182008_10002554 | Ga0182008_100025542 | 358 |
| 433 | 3300015262 | Ga0182007_10000334 | Ga0182007_1000033412 | 358 |
| 434 | 3300025297 | Ga0209758_1003976 | Ga0209758_10039762 | 358 |
| 435 | 3300025302 | Ga0207426_1002494 | Ga0207426_10024947 | 358 |
| 436 | 3300025302 | Ga0207426_1004622 | Ga0207426_10046226 | 358 |
| 437 | 3300025904 | Ga0207647_10030640 | Ga0207647_100306403 | 358 |
| 438 | 3300025949 | Ga0207667_10162707 | Ga0207667_101627072 | 358 |
| 439 | 3300028786 | Ga0307517_10059196 | Ga0307517_100591963 | 358 |
| 440 | 3300028794 | Ga0307515_10001617 | Ga0307515_1000161741 | 358 |
| 441 | 3300028794 | Ga0307515_10018584 | Ga0307515_100185845 | 358 |
| 442 | 3300028794 | Ga0307515_10174043 | Ga0307515_101740431 | 358 |
| 443 | 3300030521 | Ga0307511_10015988 | Ga0307511_100159885 | 358 |
| 444 | 3300030522 | Ga0307512_10029811 | Ga0307512_100298112 | 358 |
| 445 | 3300030522 | Ga0307512_10088477 | Ga0307512_100884772 | 358 |
| 446 | 3300031456 | Ga0307513_10033310 | Ga0307513_100333102 | 358 |
| 447 | 3300031456 | Ga0307513_10097245 | Ga0307513_100972452 | 358 |
| 448 | 3300031456 | Ga0307513_10133134 | Ga0307513_101331342 | 358 |
| 449 | 3300031507 | Ga0307509_10123349 | Ga0307509_101233493 | 358 |
| 450 | 3300031616 | Ga0307508_10004580 | Ga0307508_100045807 | 358 |
| 451 | 3300031649 | Ga0307514_10027363 | Ga0307514_100273634 | 358 |
| 452 | 3300031649 | Ga0307514_10033526 | Ga0307514_100335263 | 358 |
| 453 | 3300031649 | Ga0307514_10070706 | Ga0307514_100707062 | 358 |
| 454 | 3300031730 | Ga0307516_10006178 | Ga0307516_100061782 | 358 |
| 455 | 3300031730 | Ga0307516_10012725 | Ga0307516_100127259 | 358 |
| 456 | 3300032002 | Ga0307416_100204595 | Ga0307416_1002045952 | 358 |
| 457 | 3300033179 | Ga0307507_10057244 | Ga0307507_100572443 | 358 |
| 458 | 3300033180 | Ga0307510_10021098 | Ga0307510_100210984 | 358 |
| 459 | 3300033180 | Ga0307510_10095691 | Ga0307510_100956912 | 358 |
| 460 | 3300033180 | Ga0307510_10155037 | Ga0307510_101550372 | 358 |
| 461 | 3300033180 | Ga0307510_10170555 | Ga0307510_101705552 | 358 |
| 462 | 3300033180 | Ga0307510_10254722 | Ga0307510_102547221 | 358 |
| 463 | 3300037418 | Ga0395900_0253262 | Ga0395900_0253262_195_1274 | 358 |
| 464 | 3300037418 | Ga0395900_0314677 | Ga0395900_0314677_144_1223 | 358 |
| 465 | 3300037466 | Ga0395898_0068644 | Ga0395898_0068644_1302_2381 | 358 |
| 466 | 3300041404 | Ga0439436_0000125 | Ga0439436_0000125_8917_9996 | 358 |
| 467 | 3300041404 | Ga0439436_0001917 | Ga0439436_0001917_3300_4379 | 358 |
| 468 | 3300041406 | Ga0439439_0007729 | Ga0439439_0007729_745_1824 | 358 |
| 469 | 3300041406 | Ga0439439_0009676 | Ga0439439_0009676_901_1980 | 358 |
| 470 | 3300041512 | Ga0451853_1868916 | Ga0451853_1868916_1468_2547 | 358 |
| 471 | 3300041512 | Ga0451853_2253133 | Ga0451853_2253133_832_1911 | 358 |
| 472 | 3300042007 | Ga0439449_0002264 | Ga0439449_0002264_1960_3039 | 358 |
| 473 | 3300042007 | Ga0439449_0020532 | Ga0439449_0020532_48_1127 | 358 |
| 474 | 3300042008 | Ga0439450_004963 | Ga0439450_004963_1054_2133 | 358 |
| 475 | 3300042012 | Ga0439455_0000667 | Ga0439455_0000667_1105_2184 | 358 |
| 476 | 3300042014 | Ga0439457_001349 | Ga0439457_001349_3668_4747 | 358 |
| 477 | 3300042014 | Ga0439457_006283 | Ga0439457_006283_1071_2150 | 358 |
| 478 | 3300042015 | Ga0439462_0003587 | Ga0439462_0003587_1724_2803 | 358 |
| 479 | 3300042131 | Ga0450894_000037 | Ga0450894_000037_12388_13467 | 358 |
| 480 | 3300042133 | Ga0450896_000889 | Ga0450896_000889_277_1356 | 358 |
| 481 | 3300042135 | Ga0450899_000077 | Ga0450899_000077_4638_5717 | 358 |
| 482 | 3300042145 | Ga0450906_000093 | Ga0450906_000093_4307_5386 | 358 |
| 483 | 3300042184 | Ga0450908_002524 | Ga0450908_002524_616_1695 | 358 |
| 484 | 3300044658 | Ga0466972_0002655 | Ga0466972_0002655_4515_5594 | 358 |
| 485 | 3300044658 | Ga0466972_0008487 | Ga0466972_0008487_59_1138 | 358 |
| 486 | 3300044683 | Ga0466965_0000976 | Ga0466965_0000976_6577_7656 | 358 |
| 487 | 3300044684 | Ga0466966_0017463 | Ga0466966_0017463_2184_3263 | 358 |
| 488 | 3300044693 | Ga0466961_0024027 | Ga0466961_0024027_831_1910 | 358 |
| 489 | 3300044694 | Ga0466963_0000616 | Ga0466963_0000616_4442_5521 | 358 |
| 490 | 3300044694 | Ga0466963_0039416 | Ga0466963_0039416_1090_2169 | 358 |
| 491 | 3300044706 | Ga0466964_0009239 | Ga0466964_0009239_2568_3647 | 358 |
| 492 | 3300044719 | Ga0466971_0001392 | Ga0466971_0001392_6372_7451 | 358 |
| 493 | 3300044719 | Ga0466971_0045785 | Ga0466971_0045785_57_1136 | 358 |
| 494 | 3300044735 | Ga0466968_0015675 | Ga0466968_0015675_866_1945 | 358 |
| 495 | 3300044765 | Ga0466970_0009370 | Ga0466970_0009370_2807_3886 | 358 |
| 496 | 3300044765 | Ga0466970_0042026 | Ga0466970_0042026_599_1711 | 358 |
| 497 | 3300044842 | Ga0466957_0070608 | Ga0466957_0070608_917_1996 | 358 |
| 498 | 3300045976 | Ga0466967_0009681 | Ga0466967_0009681_861_1940 | 358 |
| 499 | 3300045976 | Ga0466967_0009957 | Ga0466967_0009957_3886_4965 | 358 |
| 500 | 3300045976 | Ga0466967_0033816 | Ga0466967_0033816_3013_4092 | 358 |
| 501 | 3300046454 | Ga0495592_0029277 | Ga0495592_0029277_571_1650 | 358 |
| 502 | 3300046455 | Ga0495603_0016731 | Ga0495603_0016731_2061_3149 | 358 |
| 503 | 3300046455 | Ga0495603_0048845 | Ga0495603_0048845_1365_2444 | 358 |
| 504 | 3300046459 | Ga0495629_0014235 | Ga0495629_0014235_3202_4281 | 358 |
| 505 | 3300046459 | Ga0495629_0018577 | Ga0495629_0018577_2030_3109 | 358 |
| 506 | 3300046459 | Ga0495629_0051936 | Ga0495629_0051936_1704_2783 | 358 |
| 507 | 3300046459 | Ga0495629_0070291 | Ga0495629_0070291_588_1667 | 358 |
| 508 | 3300046459 | Ga0495629_0153632 | Ga0495629_0153632_83_1162 | 358 |
| 509 | 3300046460 | Ga0495638_0032314 | Ga0495638_0032314_708_1787 | 358 |
| 510 | 3300046462 | Ga0495651_0177975 | Ga0495651_0177975_77_1156 | 358 |
| 511 | 3300046473 | Ga0495582_0043033 | Ga0495582_0043033_696_1775 | 358 |
| 512 | 3300046473 | Ga0495582_0073963 | Ga0495582_0073963_110_1189 | 358 |
| 513 | 3300046474 | Ga0495605_0012782 | Ga0495605_0012782_2947_4026 | 358 |
| 514 | 3300046474 | Ga0495605_0020240 | Ga0495605_0020240_666_1745 | 358 |
| 515 | 3300046476 | Ga0495662_0005123 | Ga0495662_0005123_1942_3021 | 358 |
| 516 | 3300046476 | Ga0495662_0010595 | Ga0495662_0010595_2530_3609 | 358 |
| 517 | 3300046477 | Ga0495664_0011486 | Ga0495664_0011486_2571_3650 | 358 |
| 518 | 3300046499 | Ga0495594_0012685 | Ga0495594_0012685_2250_3338 | 358 |
| 519 | 3300046499 | Ga0495594_0026491 | Ga0495594_0026491_972_2051 | 358 |
| 520 | 3300046499 | Ga0495594_0033733 | Ga0495594_0033733_126_1205 | 358 |
| 521 | 3300046499 | Ga0495594_0036254 | Ga0495594_0036254_1565_2644 | 358 |
| 522 | 3300046501 | Ga0495607_0150956 | Ga0495607_0150956_72_1151 | 358 |
| 523 | 3300046511 | Ga0495608_0054723 | Ga0495608_0054723_805_1884 | 358 |
| 524 | 3300046512 | Ga0495610_0049794 | Ga0495610_0049794_470_1549 | 358 |
| 525 | 3300046513 | Ga0495616_0017012 | Ga0495616_0017012_808_1887 | 358 |
| 526 | 3300046515 | Ga0495620_0011340 | Ga0495620_0011340_596_1675 | 358 |
| 527 | 3300046516 | Ga0495628_0027887 | Ga0495628_0027887_1571_2650 | 358 |
| 528 | 3300046518 | Ga0495631_0005294 | Ga0495631_0005294_3262_4341 | 358 |
| 529 | 3300046520 | Ga0495637_0027447 | Ga0495637_0027447_1052_2131 | 358 |
| 530 | 3300046522 | Ga0495643_0011246 | Ga0495643_0011246_3563_4642 | 358 |
| 531 | 3300046524 | Ga0495648_0033113 | Ga0495648_0033113_1979_3058 | 358 |
| 532 | 3300046529 | Ga0495652_0022853 | Ga0495652_0022853_1188_2267 | 358 |
| 533 | 3300046530 | Ga0495654_0012180 | Ga0495654_0012180_2497_3576 | 358 |
| 534 | 3300046533 | Ga0495640_0007645 | Ga0495640_0007645_6228_7307 | 358 |
| 535 | 3300046538 | Ga0495609_0010839 | Ga0495609_0010839_1911_2990 | 358 |
| 536 | 3300046542 | Ga0495597_0041673 | Ga0495597_0041673_835_1914 | 358 |
| 537 | 3300046543 | Ga0495645_0051369 | Ga0495645_0051369_1111_2190 | 358 |
| 538 | 3300046558 | Ga0495633_0052813 | Ga0495633_0052813_20_1099 | 358 |
| 539 | 3300046559 | Ga0495667_0092538 | Ga0495667_0092538_818_1897 | 358 |
| 540 | 3300046616 | Ga0495668_0073248 | Ga0495668_0073248_636_1715 | 358 |
| 541 | 3300046616 | Ga0495668_0143195 | Ga0495668_0143195_198_1286 | 358 |
| 542 | 3300046642 | Ga0495634_0001776 | Ga0495634_0001776_13944_15023 | 358 |
| 543 | 3300046648 | Ga0495611_0017431 | Ga0495611_0017431_1328_2407 | 358 |
| 544 | 3300046660 | Ga0495625_0026795 | Ga0495625_0026795_446_1525 | 358 |
| 545 | 3300046660 | Ga0495625_0078233 | Ga0495625_0078233_27_1106 | 358 |
| 546 | 3300046660 | Ga0495625_0191563 | Ga0495625_0191563_158_1237 | 358 |
| 547 | 3300046663 | Ga0495635_0000701 | Ga0495635_0000701_7725_8804 | 358 |
| 548 | 3300046665 | Ga0495661_0016076 | Ga0495661_0016076_825_1904 | 358 |
| 549 | 3300046674 | Ga0495588_0003754 | Ga0495588_0003754_448_1527 | 358 |
| 550 | 3300046674 | Ga0495588_0027033 | Ga0495588_0027033_675_1754 | 358 |
| 551 | 3300046675 | Ga0495657_0002809 | Ga0495657_0002809_5610_6689 | 358 |
| 552 | 3300046675 | Ga0495657_0016267 | Ga0495657_0016267_3394_4473 | 358 |
| 553 | 3300046679 | Ga0495623_0092392 | Ga0495623_0092392_236_1315 | 358 |
| 554 | 3300046680 | Ga0495646_0076248 | Ga0495646_0076248_16_1095 | 358 |
| 555 | 3300046683 | Ga0495658_0084553 | Ga0495658_0084553_45_1124 | 358 |
| 556 | 3300046689 | Ga0495613_0003082 | Ga0495613_0003082_3541_4620 | 358 |
| 557 | 3300046689 | Ga0495613_0009204 | Ga0495613_0009204_2070_3149 | 358 |
| 558 | 3300046689 | Ga0495613_0105546 | Ga0495613_0105546_610_1689 | 358 |
| 559 | 3300046692 | Ga0495671_0011019 | Ga0495671_0011019_3173_4252 | 358 |
| 560 | 3300046694 | Ga0495649_0028152 | Ga0495649_0028152_1155_2234 | 358 |
| 561 | 3300046794 | Ga0495589_0009062 | Ga0495589_0009062_1504_2583 | 358 |
| 562 | 3300046794 | Ga0495589_0021920 | Ga0495589_0021920_383_1471 | 358 |
| 563 | 3300046794 | Ga0495589_0022462 | Ga0495589_0022462_809_1888 | 358 |
| 564 | 3300046809 | Ga0495600_0065896 | Ga0495600_0065896_1167_2246 | 358 |
| 565 | 3300047315 | Ga0495581_0011020 | Ga0495581_0011020_3501_4580 | 358 |
| 566 | 3300047315 | Ga0495581_0102568 | Ga0495581_0102568_244_1323 | 358 |
| 567 | 3300047315 | Ga0495581_0126521 | Ga0495581_0126521_394_1473 | 358 |
| 568 | 3300047317 | Ga0495604_0002054 | Ga0495604_0002054_6267_7346 | 358 |
| 569 | 3300047318 | Ga0495636_0002978 | Ga0495636_0002978_4282_5361 | 358 |
| 570 | 3300047318 | Ga0495636_0008299 | Ga0495636_0008299_982_2061 | 358 |
| 571 | 3300047318 | Ga0495636_0065785 | Ga0495636_0065785_205_1284 | 358 |
| 572 | 3300047318 | Ga0495636_0097607 | Ga0495636_0097607_190_1269 | 358 |
| 573 | 3300047319 | Ga0495674_0125374 | Ga0495674_0125374_236_1315 | 358 |
| 574 | 3300047321 | Ga0495676_0001188 | Ga0495676_0001188_10593_11672 | 358 |
| 575 | 3300047321 | Ga0495676_0046759 | Ga0495676_0046759_16_1095 | 358 |
| 576 | 3300047321 | Ga0495676_0052646 | Ga0495676_0052646_665_1744 | 358 |
| 577 | 3300047323 | Ga0495683_0022666 | Ga0495683_0022666_2129_3208 | 358 |
| 578 | 3300047443 | Ga0495687_011722 | Ga0495687_011722_3015_4094 | 358 |
| 579 | 3300047443 | Ga0495687_016714 | Ga0495687_016714_740_1819 | 358 |
| 580 | 3300047443 | Ga0495687_037713 | Ga0495687_037713_148_1227 | 358 |
| 581 | 3300047445 | Ga0495677_0022038 | Ga0495677_0022038_846_1925 | 358 |
| 582 | 3300047447 | Ga0495685_012006 | Ga0495685_012006_1277_2356 | 358 |
| 583 | 3300047470 | Ga0495681_0048152 | Ga0495681_0048152_595_1674 | 358 |
| 584 | 3300047471 | Ga0495684_0053522 | Ga0495684_0053522_485_1564 | 358 |
| 585 | 3300047673 | Ga0495593_0011515 | Ga0495593_0011515_3913_4992 | 358 |
| 586 | 3300048089 | Ga0495614_0024349 | Ga0495614_0024349_295_1374 | 358 |
| 587 | 3300048091 | Ga0495626_0016013 | Ga0495626_0016013_497_1576 | 358 |
| 588 | 3300048912 | Ga0496109_0030590 | Ga0496109_0030590_2311_3474 | 358 |
| 589 | 3300049568 | Ga0501031_0006724 | Ga0501031_0006724_2776_3855 | 358 |
| 590 | 3300049569 | Ga0501032_0005448 | Ga0501032_0005448_1391_2470 | 358 |
| 591 | 3300049569 | Ga0501032_0035355 | Ga0501032_0035355_1379_2458 | 358 |
| 592 | 3300049569 | Ga0501032_0070984 | Ga0501032_0070984_352_1431 | 358 |
| 593 | 3300049570 | Ga0501033_0001923 | Ga0501033_0001923_14194_15273 | 358 |
| 594 | 3300049570 | Ga0501033_0024436 | Ga0501033_0024436_912_1991 | 358 |
| 595 | 3300049571 | Ga0501034_0007616 | Ga0501034_0007616_5118_6197 | 358 |
| 596 | 3300049571 | Ga0501034_0044899 | Ga0501034_0044899_2760_3839 | 358 |
| 597 | 3300049572 | Ga0501036_0030091 | Ga0501036_0030091_936_2015 | 358 |
| 598 | 3300049573 | Ga0501037_0006882 | Ga0501037_0006882_1461_2540 | 358 |
| 599 | 3300049573 | Ga0501037_0072369 | Ga0501037_0072369_960_2039 | 358 |
| 600 | 3300049573 | Ga0501037_0225256 | Ga0501037_0225256_70_1149 | 358 |
| 601 | 3300049574 | Ga0501038_0007747 | Ga0501038_0007747_5118_6197 | 358 |
| 602 | 3300049574 | Ga0501038_0027304 | Ga0501038_0027304_3475_4554 | 358 |
| 603 | 3300049578 | Ga0501042_0057353 | Ga0501042_0057353_132_1211 | 358 |
| 604 | 3300049579 | Ga0501043_0008709 | Ga0501043_0008709_4470_5549 | 358 |
| 605 | 3300049579 | Ga0501043_0011863 | Ga0501043_0011863_1337_2416 | 358 |
| 606 | 3300049579 | Ga0501043_0040479 | Ga0501043_0040479_1206_2285 | 358 |
| 607 | 3300049580 | Ga0501046_0005075 | Ga0501046_0005075_7504_8583 | 358 |
| 608 | 3300049580 | Ga0501046_0066638 | Ga0501046_0066638_1525_2604 | 358 |
| 609 | 3300049581 | Ga0501047_0035492 | Ga0501047_0035492_3152_4231 | 358 |
| 610 | 3300049581 | Ga0501047_0056484 | Ga0501047_0056484_445_1524 | 358 |
| 611 | 3300049581 | Ga0501047_0088998 | Ga0501047_0088998_29_1108 | 358 |
| 612 | 3300049581 | Ga0501047_0089514 | Ga0501047_0089514_1847_2926 | 358 |
| 613 | 3300049581 | Ga0501047_0102429 | Ga0501047_0102429_74_1153 | 358 |
| 614 | 3300049582 | Ga0501048_0001906 | Ga0501048_0001906_7131_8210 | 358 |
| 615 | 3300049586 | Ga0501070_0000534 | Ga0501070_0000534_10923_12002 | 358 |
| 616 | 3300049586 | Ga0501070_0176682 | Ga0501070_0176682_609_1688 | 358 |
| 617 | 3300049586 | Ga0501070_0199229 | Ga0501070_0199229_483_1562 | 358 |
| 618 | 3300049590 | Ga0501074_0013961 | Ga0501074_0013961_333_1412 | 358 |
| 619 | 3300049742 | Ga0501080_0048838 | Ga0501080_0048838_2059_3138 | 358 |
| 620 | 3300049822 | Ga0501035_0010126 | Ga0501035_0010126_4426_5505 | 358 |
| 621 | 3300049822 | Ga0501035_0033245 | Ga0501035_0033245_2056_3135 | 358 |
| 622 | 3300049823 | Ga0501044_0000847 | Ga0501044_0000847_34662_35741 | 358 |
| 623 | 3300049823 | Ga0501044_0005672 | Ga0501044_0005672_3275_4354 | 358 |
| 624 | 3300049823 | Ga0501044_0014121 | Ga0501044_0014121_3680_4759 | 358 |
| 625 | 3300049823 | Ga0501044_0038244 | Ga0501044_0038244_825_1904 | 358 |
| 626 | 3300049823 | Ga0501044_0059992 | Ga0501044_0059992_1222_2301 | 358 |
| 627 | 3300050494 | nmdc:mga06z11_3893_c1 | nmdc:mga06z11_3893_c1_3395_4474 | 358 |
| 628 | 3300053088 | Ga0500644_0052741 | Ga0500644_0052741_114_1193 | 358 |
| 629 | 3300053096 | Ga0500641_0032258 | Ga0500641_0032258_584_1663 | 358 |
| 630 | 3300061719 | Ga0466962_0000455 | Ga0466962_0000455_5236_6315 | 358 |
| 631 | 3300061719 | Ga0466962_0003816 | Ga0466962_0003816_1836_2915 | 358 |
| 632 | iso_pu_bacteria | 2554235005 | 2554256443 | 358 |
| 633 | iso_pu_bacteria | 2582581314 | 2585320525 | 358 |
| 634 | iso_pu_bacteria | 2643221714 | 2644632881 | 358 |
| 635 | iso_pu_bacteria | 2784132148 | 2784590181 | 358 |
| 636 | iso_pu_bacteria | 2784746768 | 2785371234 | 358 |
| 637 | iso_pu_bacteria | 2808606375 | 2808913342 | 358 |
| 638 | iso_pu_bacteria | 2808606448 | 2809233853 | 358 |
| 639 | iso_pu_bacteria | 2811994879 | 2812356244 | 358 |
| 640 | iso_pu_bacteria | 2862290372 | 2862293899 | 358 |
| 641 | iso_pu_bacteria | 2946064051 | 2946069612 | 358 |
| 642 | iso_pu_bacteria | 2946072368 | 2946077510 | 358 |
| 643 | iso_pu_bacteria | 2954002825 | 2954005213 | 358 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vo3-assembly1.cif.gz_A-2 | crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) | 0.8499 | 8 | 355 |
| 4q7a-assembly1.cif.gz_D-2 | crystal structure of n-acetyl-ornithine/n-acetyl-lysine deacetylase from sphaerobacter thermophilus | 0.8417 | 10 | 358 |
| 4q7a-assembly1.cif.gz_D-2 | crystal structure of n-acetyl-ornithine/n-acetyl-lysine deacetylase from sphaerobacter thermophilus | 0.8371 | 10 | 358 |
| 1q7l-assembly1.cif.gz_A | zn-binding domain of the t347g mutant of human aminoacylase-i | 0.8358 | 12 | 161 |
| 5xoy-assembly1.cif.gz_A-2 | crystal structure of lysk from thermus thermophilus in complex with lysine | 0.8327 | 10 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS9_166_276_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9871 | 171 | 280 | 3.40.630.10 |
| af_P9WHS9_166_276_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9696 | 171 | 280 | 3.40.630.10 |
| 3tx8A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9289 | 7 | 358 | 3.40.630.10 |
| 3tx8A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9252 | 7 | 358 | 3.40.630.10 |
| 3ct9A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8614 | 12 | 358 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353ZV57-F1-model_v4 | Succinyl-diaminopimelate desuccinylase | 0.9809 | 154 | 333 |
GO:0006526
GO:0008777 |
| AF-A0A353ZV57-F1-model_v4 | Succinyl-diaminopimelate desuccinylase | 0.9755 | 154 | 333 |
GO:0006526
GO:0008777 |
| AF-A0A0S7CQ99-F1-model_v4 | Putative succinyl-diaminopimelate desuccinylase DapE | 0.9627 | 3 | 168 |
GO:0006526
GO:0008777 |
| AF-A0A538TL39-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9477 | 12 | 356 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0046872 |
| AF-A0A3C2BQ81-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9446 | 4 | 160 |
GO:0006526
GO:0008777 GO:0009014 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar