F471999

General Info

Members Datasets Scaffolds Average Seq Length
643 430 544 357

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606375|2808913342
Length 392
Sequence DGSGTPYKVAEAVEAPASGTGQWAGARRVRVEAMADSPLDLTLNAAELTARLVDFPSESGSEKPLADAIESALRALPHLTVDRHGNNVVARTDLGRPERVILAGHIDTVPIADNVPSRLDEDGVLWGCGTCDMKSGVAVQLRIAATVPAPNRDLTFVFYDNEEVQAELNGLRHVAEAHPEWLVGDFAVLLEPSDGQVEGGCQGTLRVLLKTKGERAHSARGWMGSNAIHAAAPILAKLAAYEPRHPVIDGLEYREGLNAVGVSGGVAGNVIPDECVVTVNFRYAPDRTEQEAIAHVREVFADCGVEEFVIDDHSPGALPGLSHPAAAAFIEAVGGTPMPKYGWTDVSRFSALGVPAVNYGPGNPHLAHKRDERVETTKILAGEERLRNWLTR

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2582580736 Prauserella sp. Am3 Isolate Unclassified
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
10 2643221578 Streptomyces sp. Root63 Isolate Unclassified
11 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
12 2643221597 Microbacterium sp. Root180 Isolate Unclassified
13 2643221647 Streptomyces sp. Root369 Isolate Unclassified
14 2643221670 Streptomyces sp. Root431 Isolate Unclassified
15 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
16 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
17 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
20 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
21 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
22 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
23 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
24 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
25 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
26 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
27 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
28 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
29 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
30 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
31 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
32 2808606448 Streptomyces sp. 193411 Isolate Unclassified
33 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
34 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
35 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
36 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
37 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
38 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
39 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
40 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
41 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
42 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
43 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
44 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
45 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
46 2862574272 Streptomyces sp. AcE210 Isolate Nodule
47 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
48 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
49 2867475112 Streptomyces sp. TM32 Isolate Unclassified
50 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
51 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
52 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
53 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
54 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
55 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
56 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
57 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
58 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
59 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
60 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
61 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
62 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
63 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
64 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
65 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
66 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
67 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
68 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
69 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
70 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
71 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
72 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
73 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
74 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
75 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
76 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
77 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
78 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
79 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
80 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
81 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
82 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
83 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
84 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
85 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
86 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
87 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
88 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
89 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
90 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
99 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
100 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
101 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
104 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
105 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
108 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
109 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
110 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
111 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
112 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
113 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
114 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
115 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
117 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
118 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
119 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
120 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
121 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
122 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
123 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
124 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
125 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
126 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
127 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
130 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
135 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
136 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
137 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
140 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
141 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
142 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
143 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
144 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
145 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
146 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
149 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
150 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
157 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
160 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
276 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
281 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
282 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
283 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
284 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
285 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
286 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
293 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
294 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
295 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
296 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
335 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
336 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
337 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
345 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
346 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
364 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
365 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
369 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
374 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
375 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
376 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
416 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
419 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
420 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
421 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
422 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
423 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
424 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
425 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
426 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
427 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
428 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
429 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
430 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.83
Metatranscriptomes 0.78
Isolates 15.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 1.56
Nodule 0.62
Rhizoplane 2.33
Rhizosphere 80.87
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10004178 3300003316 Bacteria 4794
2 rootH1_10013452 3300003316 Bacteria 3378
3 rootL2_10020111 3300003322 Bacteria 2561
4 rootH1_10006175 3300003323 Bacteria 5674
5 rootH1_10008994 3300003323 Bacteria 3392
6 Ga0006562J51391_1076183 3300003578 Bacteria 6790
7 Ga0006562J51391_1076186 3300003578 Bacteria 1900
8 Ga0006562J51391_1131149 3300003578 Bacteria 2310
9 Ga0070658_10004154 3300005327 Bacteria 11857
10 Ga0070658_10309633 3300005327 Bacteria 1347
11 Ga0070676_10045712 3300005328 Bacteria 2551
12 Ga0070676_10090160 3300005328 Bacteria 1877
13 Ga0070683_100105911 3300005329 Bacteria 2651
14 Ga0070666_10029086 3300005335 Bacteria 3631
15 Ga0070680_100069713 3300005336 Bacteria 2887
16 Ga0068868_100036941 3300005338 Bacteria 3784
17 Ga0070660_100042689 3300005339 Bacteria 3462
18 Ga0070660_100053486 3300005339 Bacteria 3114
19 Ga0070660_100247389 3300005339 Bacteria 1453
20 Ga0070689_100112099 3300005340 Bacteria 2171
21 Ga0070691_10012855 3300005341 Bacteria 3835
22 Ga0070691_10024845 3300005341 Bacteria 2786
23 Ga0070661_100070184 3300005344 Bacteria 2576
24 Ga0070661_100191864 3300005344 Bacteria 1558
25 Ga0070692_10023965 3300005345 Bacteria 2995
26 Ga0070671_100003983 3300005355 Bacteria 11636
27 Ga0070671_100027438 3300005355 Bacteria 4688
28 Ga0070674_100392581 3300005356 Bacteria 1132
29 Ga0070673_100054815 3300005364 Bacteria 3138
30 Ga0070688_100064615 3300005365 Bacteria 2323
31 Ga0070659_100070520 3300005366 Bacteria 2776
32 Ga0070659_100115232 3300005366 Bacteria 2172
33 Ga0070667_100293450 3300005367 Bacteria 1463
34 Ga0070709_10003363 3300005434 Bacteria 8597
35 Ga0070709_10052580 3300005434 Bacteria 2561
36 Ga0070714_100014741 3300005435 Bacteria 6283
37 Ga0070714_100017702 3300005435 Bacteria 5778
38 Ga0070714_100026301 3300005435 Bacteria 4808
39 Ga0070714_100036360 3300005435 Bacteria 4130
40 Ga0070714_100116056 3300005435 Bacteria 2377
41 Ga0070713_100033092 3300005436 Bacteria 4138
42 Ga0070713_100040421 3300005436 Bacteria 3791
43 Ga0070713_100359505 3300005436 Bacteria 1352
44 Ga0070710_10002570 3300005437 Bacteria 8618
45 Ga0070701_10027477 3300005438 Bacteria 2788
46 Ga0070711_100064291 3300005439 Bacteria 2563
47 Ga0070694_100323416 3300005444 Bacteria 1188
48 Ga0070708_100038777 3300005445 Bacteria 4165
49 Ga0070708_100094026 3300005445 Bacteria 2734
50 Ga0070663_100231749 3300005455 Bacteria 1454
51 Ga0070662_100059477 3300005457 Bacteria 2784
52 Ga0070662_100325271 3300005457 Bacteria 1255
53 Ga0070681_10104204 3300005458 Bacteria 2779
54 Ga0070681_10110524 3300005458 Bacteria 2688
55 Ga0070706_100034361 3300005467 Bacteria 4683
56 Ga0070707_100000466 3300005468 Bacteria 39988
57 Ga0070707_100056623 3300005468 Bacteria 3761
58 Ga0070698_100021955 3300005471 Bacteria 6682
59 Ga0070698_100038750 3300005471 Bacteria 4910
60 Ga0070679_100104852 3300005530 Bacteria 2813
61 Ga0070679_100128862 3300005530 Bacteria 2511
62 Ga0068853_100012964 3300005539 Bacteria 6795
63 Ga0068853_100047395 3300005539 Bacteria 3687
64 Ga0070672_100031002 3300005543 Bacteria 4022
65 Ga0070686_100034172 3300005544 Bacteria 3131
66 Ga0070695_100008066 3300005545 Bacteria 6241
67 Ga0070693_100058800 3300005547 Bacteria 2226
68 Ga0070665_100001778 3300005548 Bacteria 24546
69 Ga0070665_100312474 3300005548 Bacteria 1575
70 Ga0070665_100330216 3300005548 Bacteria 1529
71 Ga0070704_100117106 3300005549 Bacteria 2038
72 Ga0070664_100045344 3300005564 Bacteria 3713
73 Ga0068857_100023265 3300005577 Bacteria 5453
74 Ga0068854_100175713 3300005578 Bacteria 1669
75 Ga0068854_100322825 3300005578 Bacteria 1255
76 Ga0068856_100024127 3300005614 Bacteria 5918
77 Ga0070702_100001774 3300005615 Bacteria 8968
78 Ga0070702_100016862 3300005615 Bacteria 3758
79 Ga0068859_100117599 3300005617 Bacteria 2724
80 Ga0068859_100122025 3300005617 Bacteria 2672
81 Ga0068851_10010306 3300005834 Bacteria 4359
82 Ga0068870_10003104 3300005840 Bacteria 7008
83 Ga0068863_100057543 3300005841 Bacteria 3679
84 Ga0068860_100078304 3300005843 Bacteria 3143
85 Ga0068860_100275835 3300005843 Bacteria 1642
86 Ga0068860_100372993 3300005843 Bacteria 1408
87 Ga0068862_100051249 3300005844 Bacteria 3529
88 Ga0081455_10000288 3300005937 Bacteria 66686
89 Ga0081455_10105888 3300005937 Bacteria 2246
90 Ga0081540_1000037 3300005983 Bacteria 139165
91 Ga0075363_100002322 3300006048 Bacteria 7730
92 Ga0075364_10262573 3300006051 Bacteria 1174
93 Ga0075432_10031065 3300006058 Bacteria 1848
94 Ga0075367_10000660 3300006178 Bacteria 13191
95 Ga0068871_100021131 3300006358 Bacteria 4997
96 Ga0068871_100073746 3300006358 Bacteria 2814
97 Ga0075428_100052509 3300006844 Bacteria 4467
98 Ga0075431_100357045 3300006847 Bacteria 1468
99 Ga0075434_100023900 3300006871 Bacteria 5965
100 Ga0068865_100318707 3300006881 Bacteria 1250
101 Ga0075436_100042426 3300006914 Bacteria 3137
102 Ga0097620_100117592 3300006931 Bacteria 2724
103 Ga0097620_100122024 3300006931 Bacteria 2672
104 Ga0099826_10020443 3300006948 Bacteria 4966
105 Ga0105245_10171670 3300009098 Bacteria 2065
106 Ga0105247_10132690 3300009101 Bacteria 1625
107 Ga0114129_10116178 3300009147 Bacteria 3687
108 Ga0105243_10215639 3300009148 Bacteria 1693
109 Ga0105241_10066723 3300009174 Bacteria 2783
110 Ga0105241_10188474 3300009174 Bacteria 1716
111 Ga0105242_10017678 3300009176 Bacteria 5562
112 Ga0105238_10099745 3300009551 Bacteria 2887
113 Ga0105238_10124914 3300009551 Bacteria 2553
114 Ga0105238_10432343 3300009551 Bacteria 1312
115 Ga0105249_10048872 3300009553 Bacteria 3857
116 Ga0105246_10001918 3300011119 Bacteria 12529
117 Ga0105246_10008217 3300011119 Bacteria 6410
118 Ga0105246_10014236 3300011119 Bacteria 4999
119 Ga0105246_10254041 3300011119 Bacteria 1397
120 Ga0157373_10065688 3300013100 Bacteria 2567
121 Ga0157371_10136624 3300013102 Bacteria 1746
122 Ga0157374_10032344 3300013296 Bacteria 4762
123 Ga0157374_10108637 3300013296 Bacteria 2666
124 Ga0157378_10289876 3300013297 Bacteria 1581
125 Ga0163162_10579114 3300013306 Bacteria 1249
126 Ga0157375_10125964 3300013308 Bacteria 2676
127 Ga0157375_10202987 3300013308 Bacteria 2139
128 Ga0157380_10063764 3300014326 Bacteria 2956
129 Ga0182008_10002554 3300014497 Bacteria 11332
130 Ga0182008_10073079 3300014497 Bacteria 1688
131 Ga0157379_10121278 3300014968 Bacteria 2352
132 Ga0157376_10215640 3300014969 Bacteria 1775
133 Ga0182007_10000334 3300015262 Bacteria 29904
134 Ga0206356_10503846 3300020070 Bacteria 3860
135 Ga0206354_11360300 3300020081 Bacteria 1727
136 Ga0213874_10023183 3300021377 Bacteria 1729
137 Ga0209758_1003976 3300025297 Bacteria 12811
138 Ga0207426_1002494 3300025302 Bacteria 11662
139 Ga0207426_1004622 3300025302 Bacteria 6626
140 Ga0207656_10013812 3300025321 Bacteria 3097
141 Ga0207653_10003977 3300025885 Bacteria 4647
142 Ga0207692_10103379 3300025898 Bacteria 1568
143 Ga0207688_10001356 3300025901 Bacteria 12725
144 Ga0207688_10022343 3300025901 Bacteria 3461
145 Ga0207647_10030640 3300025904 Bacteria 3468
146 Ga0207647_10043188 3300025904 Bacteria 2822
147 Ga0207645_10119010 3300025907 Bacteria 1713
148 Ga0207643_10000252 3300025908 Bacteria 37454
149 Ga0207643_10017166 3300025908 Bacteria 3954
150 Ga0207705_10000001 3300025909 Bacteria 2061880
151 Ga0207684_10005507 3300025910 Bacteria 11663
152 Ga0207707_10251495 3300025912 Bacteria 1535
153 Ga0207695_10080382 3300025913 Bacteria 3301
154 Ga0207693_10049796 3300025915 Bacteria 3290
155 Ga0207693_10060282 3300025915 Bacteria 2972
156 Ga0207660_10204258 3300025917 Bacteria 1544
157 Ga0207662_10024168 3300025918 Bacteria 3497
158 Ga0207657_10001310 3300025919 Bacteria 26403
159 Ga0207657_10012261 3300025919 Bacteria 8468
160 Ga0207694_10040321 3300025924 Bacteria 3594
161 Ga0207650_10176573 3300025925 Bacteria 1700
162 Ga0207700_10033600 3300025928 Bacteria 3672
163 Ga0207700_10076087 3300025928 Bacteria 2603
164 Ga0207700_10101507 3300025928 Bacteria 2295
165 Ga0207700_10161653 3300025928 Bacteria 1860
166 Ga0207664_10036163 3300025929 Bacteria 3816
167 Ga0207664_10144740 3300025929 Bacteria 2014
168 Ga0207664_10196373 3300025929 Bacteria 1739
169 Ga0207644_10002584 3300025931 Bacteria 11651
170 Ga0207644_10230822 3300025931 Bacteria 1470
171 Ga0207690_10087528 3300025932 Bacteria 2192
172 Ga0207669_10073685 3300025937 Bacteria 2156
173 Ga0207691_10053368 3300025940 Bacteria 3690
174 Ga0207711_10046215 3300025941 Bacteria 3720
175 Ga0207689_10005533 3300025942 Bacteria 11280
176 Ga0207689_10046652 3300025942 Bacteria 3580
177 Ga0207661_10076652 3300025944 Bacteria 2746
178 Ga0207661_10147580 3300025944 Bacteria 2031
179 Ga0207679_10075405 3300025945 Bacteria 2559
180 Ga0207667_10162707 3300025949 Bacteria 2295
181 Ga0207651_10191933 3300025960 Bacteria 1630
182 Ga0207712_10263585 3300025961 Bacteria 1399
183 Ga0207640_10057783 3300025981 Bacteria 2553
184 Ga0207703_10025518 3300026035 Bacteria 4648
185 Ga0207639_10006559 3300026041 Bacteria 7913
186 Ga0207678_10001822 3300026067 Bacteria 19525
187 Ga0207678_10002951 3300026067 Bacteria 15407
188 Ga0207708_10009034 3300026075 Bacteria 7373
189 Ga0207641_10093722 3300026088 Bacteria 2632
190 Ga0207641_10464744 3300026088 Bacteria 1224
191 Ga0207674_10021023 3300026116 Bacteria 7038
192 Ga0207674_10122602 3300026116 Bacteria 2565
193 Ga0207674_10246083 3300026116 Bacteria 1735
194 Ga0207675_100006660 3300026118 Bacteria 10929
195 Ga0207683_10000558 3300026121 Bacteria 34428
196 Ga0207683_10052120 3300026121 Bacteria 3585
197 Ga0209371_1008803 3300027312 Bacteria 3295
198 Ga0268266_10002138 3300028379 Bacteria 21775
199 Ga0268266_10059472 3300028379 Bacteria 3293
200 Ga0268265_10066935 3300028380 Bacteria 2779
201 Ga0268264_10050028 3300028381 Bacteria 3479
202 Ga0268264_10095453 3300028381 Bacteria 2573
203 Ga0307517_10059196 3300028786 Bacteria 3673
204 Ga0307515_10001617 3300028794 Bacteria 50228
205 Ga0307515_10018584 3300028794 Bacteria 12560
206 Ga0307515_10123340 3300028794 Bacteria 2915
207 Ga0307515_10174043 3300028794 Bacteria 2131
208 Ga0265338_10007751 3300028800 Bacteria 13211
209 Ga0265338_10025364 3300028800 Bacteria 6018
210 Ga0307511_10014203 3300030521 Bacteria 7751
211 Ga0307511_10015988 3300030521 Bacteria 7247
212 Ga0307512_10029811 3300030522 Bacteria 4758
213 Ga0307512_10088477 3300030522 Bacteria 2173
214 Ga0307513_10033310 3300031456 Bacteria 5792
215 Ga0307513_10097245 3300031456 Bacteria 2979
216 Ga0307513_10133134 3300031456 Bacteria 2427
217 Ga0307509_10123349 3300031507 Bacteria 2563
218 Ga0307508_10004580 3300031616 Bacteria 13457
219 Ga0307514_10027363 3300031649 Bacteria 4606
220 Ga0307514_10033526 3300031649 Bacteria 4097
221 Ga0307514_10070706 3300031649 Bacteria 2620
222 Ga0307516_10006178 3300031730 Bacteria 14097
223 Ga0307516_10012725 3300031730 Bacteria 9043
224 Ga0307518_10049331 3300031838 Bacteria 3060
225 Ga0307406_10001678 3300031901 Bacteria 12177
226 Ga0307407_10034076 3300031903 Bacteria 2784
227 Ga0307409_100113163 3300031995 Bacteria 2280
228 Ga0307416_100004305 3300032002 Bacteria 8548
229 Ga0307416_100076216 3300032002 Bacteria 2810
230 Ga0307416_100204595 3300032002 Bacteria 1877
231 Ga0307414_10041944 3300032004 Bacteria 3105
232 Ga0307414_10108194 3300032004 Bacteria 2108
233 Ga0307415_100036361 3300032126 Bacteria 3225
234 Ga0307507_10034694 3300033179 Bacteria 5203
235 Ga0307507_10057244 3300033179 Bacteria 3673
236 Ga0307510_10021098 3300033180 Bacteria 7599
237 Ga0307510_10095691 3300033180 Bacteria 2788
238 Ga0307510_10155037 3300033180 Bacteria 1899
239 Ga0307510_10170555 3300033180 Bacteria 1755
240 Ga0307510_10254722 3300033180 Bacteria 1240
241 Ga0316212_1006041 3300033547 Bacteria 1758
242 Ga0373926_0006875 3300035083 Bacteria 3782
243 Ga0373928_0004916 3300035084 Bacteria 2547
244 Ga0373934_0075919 3300035086 Bacteria 1347
245 Ga0373944_0000461 3300035089 Bacteria 9453
246 Ga0373949_0030878 3300035090 Bacteria 1275
247 Ga0373951_0010037 3300035091 Bacteria 2125
248 Ga0373952_0011595 3300035092 Bacteria 1722
249 Ga0373923_0020436 3300035111 Bacteria 2572
250 Ga0373936_0000278 3300035113 Bacteria 17059
251 Ga0373936_0038826 3300035113 Bacteria 1904
252 Ga0373939_0042787 3300035114 Bacteria 1371
253 Ga0373945_0000084 3300035116 Bacteria 21863
254 Ga0373945_0004823 3300035116 Bacteria 4296
255 Ga0373953_0026912 3300035117 Bacteria 2206
256 Ga0373956_0012266 3300035119 Bacteria 3549
257 Ga0373957_0073032 3300035120 Bacteria 1344
258 Ga0373960_0009885 3300035121 Bacteria 2320
259 Ga0373943_0000119 3300035170 Bacteria 29368
260 Ga0373946_0000484 3300035171 Bacteria 13152
261 Ga0373946_0001797 3300035171 Bacteria 7478
262 Ga0373955_0017885 3300035172 Bacteria 3514
263 Ga0373935_0002246 3300035692 Bacteria 10991
264 Ga0373935_0069159 3300035692 Bacteria 2273
265 Ga0373927_0000726 3300035695 Bacteria 25216
266 Ga0373947_0000141 3300035725 Bacteria 37478
267 Ga0373947_0008944 3300035725 Bacteria 5756
268 Ga0373937_0374266 3300036401 Bacteria 1350
269 Ga0373925_0000799 3300037068 Bacteria 29013
270 Ga0373925_0001150 3300037068 Bacteria 23461
271 Ga0395900_0253262 3300037418 Bacteria 1761
272 Ga0395900_0314677 3300037418 Bacteria 1548
273 Ga0395898_0068644 3300037466 Bacteria 3430
274 Ga0395898_0150183 3300037466 Bacteria 2230
275 Ga0436364_0687596 3300037853 Bacteria 1636
276 Ga0395901_0040566 3300038443 Bacteria 4822
277 Ga0436361_0970262 3300039447 Bacteria 2136
278 Ga0439436_0000125 3300041404 Bacteria 17780
279 Ga0439436_0001917 3300041404 Bacteria 6157
280 Ga0439439_0007729 3300041406 Bacteria 2520
281 Ga0439439_0009676 3300041406 Bacteria 2297
282 Ga0451853_1868916 3300041512 Bacteria 2665
283 Ga0451853_2253133 3300041512 Bacteria 2347
284 Ga0451853_2373291 3300041512 Bacteria 1678
285 Ga0439448_0013296 3300042005 Bacteria 2472
286 Ga0439449_0002264 3300042007 Bacteria 7565
287 Ga0439449_0020532 3300042007 Bacteria 2474
288 Ga0439450_004963 3300042008 Bacteria 2309
289 Ga0439455_0000667 3300042012 Bacteria 5045
290 Ga0439455_0004610 3300042012 Bacteria 2745
291 Ga0439457_001349 3300042014 Bacteria 7373
292 Ga0439457_006283 3300042014 Bacteria 2918
293 Ga0439462_0003587 3300042015 Bacteria 3735
294 Ga0450894_000037 3300042131 Bacteria 19538
295 Ga0450896_000889 3300042133 Bacteria 3436
296 Ga0450899_000077 3300042135 Bacteria 8149
297 Ga0450906_000093 3300042145 Bacteria 14880
298 Ga0450908_002524 3300042184 Bacteria 3588
299 Ga0439459_0008827 3300042438 Bacteria 1732
300 Ga0466969_0019127 3300044656 Bacteria 3563
301 Ga0466972_0002655 3300044658 Bacteria 8854
302 Ga0466972_0008487 3300044658 Bacteria 5153
303 Ga0466972_0025634 3300044658 Bacteria 2920
304 Ga0466972_0028025 3300044658 Bacteria 2783
305 Ga0466965_0000976 3300044683 Bacteria 11072
306 Ga0466966_0017463 3300044684 Bacteria 4740
307 Ga0466961_0024027 3300044693 Bacteria 3921
308 Ga0466961_0047153 3300044693 Bacteria 2755
309 Ga0466963_0000616 3300044694 Bacteria 17068
310 Ga0466963_0039416 3300044694 Bacteria 3093
311 Ga0466964_0009239 3300044706 Bacteria 3708
312 Ga0466971_0001392 3300044719 Bacteria 10146
313 Ga0466971_0045785 3300044719 Bacteria 1965
314 Ga0466968_0015675 3300044735 Bacteria 3008
315 Ga0466970_0000087 3300044765 Bacteria 38510
316 Ga0466970_0007752 3300044765 Bacteria 5386
317 Ga0466970_0009370 3300044765 Bacteria 4947
318 Ga0466970_0019253 3300044765 Bacteria 3538
319 Ga0466970_0042026 3300044765 Bacteria 2430
320 Ga0466957_0070608 3300044842 Bacteria 2158
321 Ga0466967_0009681 3300045976 Bacteria 7170
322 Ga0466967_0009957 3300045976 Bacteria 7095
323 Ga0466967_0033816 3300045976 Bacteria 4332
324 Ga0466967_0038140 3300045976 Bacteria 4118
325 Ga0495592_0029277 3300046454 Bacteria 4170
326 Ga0495592_0048009 3300046454 Bacteria 3177
327 Ga0495603_0001577 3300046455 Bacteria 13336
328 Ga0495603_0016731 3300046455 Bacteria 4435
329 Ga0495603_0017955 3300046455 Bacteria 4281
330 Ga0495603_0048845 3300046455 Bacteria 2519
331 Ga0495629_0001919 3300046459 Bacteria 16205
332 Ga0495629_0004087 3300046459 Bacteria 10948
333 Ga0495629_0014235 3300046459 Bacteria 5728
334 Ga0495629_0018577 3300046459 Bacteria 4972
335 Ga0495629_0051936 3300046459 Bacteria 2868
336 Ga0495629_0070291 3300046459 Bacteria 2442
337 Ga0495629_0153632 3300046459 Bacteria 1599
338 Ga0495638_0032314 3300046460 Bacteria 3356
339 Ga0495641_0017048 3300046461 Bacteria 3799
340 Ga0495651_0007284 3300046462 Bacteria 8456
341 Ga0495651_0044734 3300046462 Bacteria 3431
342 Ga0495651_0177975 3300046462 Bacteria 1508
343 Ga0495653_0008878 3300046463 Bacteria 8223
344 Ga0495653_0080297 3300046463 Bacteria 2413
345 Ga0495582_0007628 3300046473 Bacteria 5981
346 Ga0495582_0043033 3300046473 Bacteria 2487
347 Ga0495582_0073963 3300046473 Bacteria 1886
348 Ga0495605_0012782 3300046474 Bacteria 4646
349 Ga0495605_0020240 3300046474 Bacteria 3538
350 Ga0495639_0005702 3300046475 Bacteria 5355
351 Ga0495662_0005123 3300046476 Bacteria 6565
352 Ga0495662_0006659 3300046476 Bacteria 5763
353 Ga0495662_0010595 3300046476 Bacteria 4508
354 Ga0495664_0002082 3300046477 Bacteria 10703
355 Ga0495664_0011486 3300046477 Bacteria 4995
356 Ga0495585_0060008 3300046492 Bacteria 2095
357 Ga0495594_0000151 3300046499 Bacteria 33013
358 Ga0495594_0012685 3300046499 Bacteria 4395
359 Ga0495594_0018104 3300046499 Bacteria 3730
360 Ga0495594_0026491 3300046499 Bacteria 3119
361 Ga0495594_0033733 3300046499 Bacteria 2784
362 Ga0495594_0036254 3300046499 Bacteria 2689
363 Ga0495607_0150956 3300046501 Bacteria 1189
364 Ga0495608_0054715 3300046511 Bacteria 2638
365 Ga0495608_0054723 3300046511 Bacteria 2638
366 Ga0495610_0049794 3300046512 Bacteria 2049
367 Ga0495616_0017012 3300046513 Bacteria 4014
368 Ga0495620_0011340 3300046515 Bacteria 4649
369 Ga0495628_0027887 3300046516 Bacteria 4591
370 Ga0495628_0071089 3300046516 Bacteria 2713
371 Ga0495630_0006432 3300046517 Bacteria 8357
372 Ga0495631_0005294 3300046518 Bacteria 6775
373 Ga0495637_0027447 3300046520 Bacteria 2547
374 Ga0495643_0011246 3300046522 Bacteria 5463
375 Ga0495648_0033113 3300046524 Bacteria 3380
376 Ga0495652_0008484 3300046529 Bacteria 9375
377 Ga0495652_0022853 3300046529 Bacteria 5548
378 Ga0495654_0012180 3300046530 Bacteria 4627
379 Ga0495665_0033551 3300046531 Bacteria 2745
380 Ga0495640_0007645 3300046533 Bacteria 8499
381 Ga0495640_0030845 3300046533 Bacteria 3833
382 Ga0495586_0026471 3300046535 Bacteria 3103
383 Ga0495587_0033380 3300046536 Bacteria 3107
384 Ga0495587_0087460 3300046536 Bacteria 1803
385 Ga0495609_0010839 3300046538 Bacteria 4356
386 Ga0495597_0041673 3300046542 Bacteria 2049
387 Ga0495645_0051369 3300046543 Bacteria 3000
388 Ga0495645_0105425 3300046543 Bacteria 2000
389 Ga0495622_0005199 3300046557 Bacteria 6031
390 Ga0495633_0052813 3300046558 Bacteria 1913
391 Ga0495667_0002180 3300046559 Bacteria 13083
392 Ga0495667_0041508 3300046559 Bacteria 3051
393 Ga0495667_0092538 3300046559 Bacteria 1958
394 Ga0495668_0073248 3300046616 Bacteria 1881
395 Ga0495668_0143195 3300046616 Bacteria 1308
396 Ga0495634_0001776 3300046642 Bacteria 18660
397 Ga0495611_0017431 3300046648 Bacteria 3072
398 Ga0495625_0026795 3300046660 Bacteria 4348
399 Ga0495625_0078233 3300046660 Bacteria 2309
400 Ga0495625_0191563 3300046660 Bacteria 1354
401 Ga0495635_0000701 3300046663 Bacteria 21595
402 Ga0495635_0001270 3300046663 Bacteria 16868
403 Ga0495661_0016076 3300046665 Bacteria 4972
404 Ga0495588_0001826 3300046674 Bacteria 9071
405 Ga0495588_0003754 3300046674 Bacteria 6642
406 Ga0495588_0027033 3300046674 Bacteria 2866
407 Ga0495657_0002809 3300046675 Bacteria 14470
408 Ga0495657_0016267 3300046675 Bacteria 5421
409 Ga0495599_0026447 3300046678 Bacteria 3636
410 Ga0495599_0079018 3300046678 Bacteria 2054
411 Ga0495623_0092392 3300046679 Bacteria 1855
412 Ga0495646_0076248 3300046680 Bacteria 1964
413 Ga0495647_0028764 3300046681 Bacteria 2051
414 Ga0495658_0006519 3300046683 Bacteria 5734
415 Ga0495658_0084553 3300046683 Bacteria 1868
416 Ga0495613_0003082 3300046689 Bacteria 12452
417 Ga0495613_0009204 3300046689 Bacteria 7324
418 Ga0495613_0055352 3300046689 Bacteria 2914
419 Ga0495613_0105546 3300046689 Bacteria 2033
420 Ga0495624_0007672 3300046690 Bacteria 7573
421 Ga0495671_0011019 3300046692 Bacteria 4991
422 Ga0495649_0028152 3300046694 Bacteria 3115
423 Ga0495589_0009062 3300046794 Bacteria 5173
424 Ga0495589_0021920 3300046794 Bacteria 3263
425 Ga0495589_0022462 3300046794 Bacteria 3219
426 Ga0495600_0065896 3300046809 Bacteria 2368
427 Ga0495600_0080921 3300046809 Bacteria 2120
428 Ga0495581_0011020 3300047315 Bacteria 5225
429 Ga0495581_0102568 3300047315 Bacteria 1662
430 Ga0495581_0126521 3300047315 Bacteria 1488
431 Ga0495604_0002054 3300047317 Bacteria 16246
432 Ga0495604_0020250 3300047317 Bacteria 5316
433 Ga0495636_0002978 3300047318 Bacteria 6550
434 Ga0495636_0008299 3300047318 Bacteria 4100
435 Ga0495636_0024186 3300047318 Bacteria 2462
436 Ga0495636_0065785 3300047318 Bacteria 1540
437 Ga0495636_0097607 3300047318 Bacteria 1281
438 Ga0495674_0000739 3300047319 Bacteria 30884
439 Ga0495674_0125374 3300047319 Bacteria 2167
440 Ga0495676_0001188 3300047321 Bacteria 22211
441 Ga0495676_0003601 3300047321 Bacteria 14057
442 Ga0495676_0008085 3300047321 Bacteria 9651
443 Ga0495676_0017612 3300047321 Bacteria 6312
444 Ga0495676_0046759 3300047321 Bacteria 3508
445 Ga0495676_0052646 3300047321 Bacteria 3247
446 Ga0495676_0056053 3300047321 Bacteria 3119
447 Ga0495680_0006565 3300047322 Bacteria 10794
448 Ga0495680_0111234 3300047322 Bacteria 2029
449 Ga0495683_0022666 3300047323 Bacteria 3229
450 Ga0495687_011722 3300047443 Bacteria 4690
451 Ga0495687_016714 3300047443 Bacteria 3682
452 Ga0495687_037713 3300047443 Bacteria 2150
453 Ga0495675_0070627 3300047444 Bacteria 2204
454 Ga0495677_0022038 3300047445 Bacteria 2309
455 Ga0495685_012006 3300047447 Bacteria 2930
456 Ga0495681_0048152 3300047470 Bacteria 2023
457 Ga0495684_0001876 3300047471 Bacteria 16827
458 Ga0495684_0015935 3300047471 Bacteria 5788
459 Ga0495684_0026721 3300047471 Bacteria 4435
460 Ga0495684_0053522 3300047471 Bacteria 3080
461 Ga0495593_0011515 3300047673 Bacteria 5077
462 Ga0495593_0025998 3300047673 Bacteria 3236
463 Ga0495614_0000088 3300048089 Bacteria 30664
464 Ga0495614_0024349 3300048089 Bacteria 2613
465 Ga0495626_0016013 3300048091 Bacteria 3821
466 Ga0496102_0238870 3300048905 Bacteria 1713
467 Ga0496103_0020268 3300048906 Bacteria 3995
468 Ga0496103_0084930 3300048906 Bacteria 1994
469 Ga0496104_0005657 3300048907 Bacteria 10946
470 Ga0496106_0005516 3300048909 Bacteria 9360
471 Ga0496107_0175563 3300048910 Bacteria 1590
472 Ga0496108_0040929 3300048911 Bacteria 3865
473 Ga0496108_0152023 3300048911 Bacteria 1997
474 Ga0496109_0030590 3300048912 Bacteria 4826
475 Ga0496110_0031946 3300048913 Bacteria 4543
476 Ga0496111_0060140 3300048914 Bacteria 2753
477 Ga0496113_0011663 3300048916 Bacteria 5877
478 Ga0496113_0101301 3300048916 Bacteria 2232
479 Ga0496115_0065632 3300048918 Bacteria 2932
480 Ga0496115_0094525 3300048918 Bacteria 2445
481 Ga0496117_0000585 3300048920 Bacteria 60104
482 Ga0496119_0004150 3300048922 Bacteria 14575
483 Ga0496119_0007131 3300048922 Bacteria 10147
484 Ga0496120_0001621 3300048923 Bacteria 26118
485 Ga0496122_0001174 3300048925 Bacteria 44774
486 Ga0496123_0002245 3300048926 Bacteria 24434
487 Ga0496124_0001320 3300048927 Bacteria 37380
488 Ga0496125_0000077 3300048928 Bacteria 232629
489 Ga0496125_0005847 3300048928 Bacteria 13504
490 Ga0496126_0012878 3300048929 Bacteria 8544
491 Ga0496126_0038577 3300048929 Bacteria 4443
492 Ga0496126_0066101 3300048929 Bacteria 3234
493 Ga0501031_0006724 3300049568 Bacteria 7501
494 Ga0501032_0005448 3300049569 Bacteria 9447
495 Ga0501032_0035355 3300049569 Bacteria 3416
496 Ga0501032_0070984 3300049569 Bacteria 2322
497 Ga0501033_0001923 3300049570 Bacteria 18084
498 Ga0501033_0024436 3300049570 Bacteria 4558
499 Ga0501034_0007616 3300049571 Bacteria 11519
500 Ga0501034_0044899 3300049571 Bacteria 4466
501 Ga0501036_0030091 3300049572 Bacteria 4587
502 Ga0501037_0006882 3300049573 Bacteria 8305
503 Ga0501037_0072369 3300049573 Bacteria 2507
504 Ga0501037_0225256 3300049573 Bacteria 1318
505 Ga0501038_0007747 3300049574 Bacteria 9899
506 Ga0501038_0027304 3300049574 Bacteria 5080
507 Ga0501038_0052635 3300049574 Bacteria 3509
508 Ga0501042_0057353 3300049578 Bacteria 2779
509 Ga0501043_0008709 3300049579 Bacteria 7983
510 Ga0501043_0011863 3300049579 Bacteria 6825
511 Ga0501043_0040479 3300049579 Bacteria 3663
512 Ga0501046_0005075 3300049580 Bacteria 11805
513 Ga0501046_0066638 3300049580 Bacteria 2806
514 Ga0501047_0035492 3300049581 Bacteria 4818
515 Ga0501047_0056484 3300049581 Bacteria 3796
516 Ga0501047_0088998 3300049581 Bacteria 2964
517 Ga0501047_0089514 3300049581 Bacteria 2955
518 Ga0501047_0102429 3300049581 Bacteria 2742
519 Ga0501048_0001906 3300049582 Bacteria 15830
520 Ga0501070_0000534 3300049586 Bacteria 34857
521 Ga0501070_0176682 3300049586 Bacteria 1758
522 Ga0501070_0199229 3300049586 Bacteria 1645
523 Ga0501074_0013961 3300049590 Bacteria 5837
524 Ga0501080_0048838 3300049742 Bacteria 3937
525 Ga0501035_0010126 3300049822 Bacteria 8750
526 Ga0501035_0033245 3300049822 Bacteria 4690
527 Ga0501044_0000847 3300049823 Bacteria 36738
528 Ga0501044_0005672 3300049823 Bacteria 13838
529 Ga0501044_0014121 3300049823 Bacteria 8622
530 Ga0501044_0038244 3300049823 Bacteria 5011
531 Ga0501044_0059992 3300049823 Bacteria 3896
532 nmdc:mga00v17_105631_c2 3300050491 Bacteria 1475
533 nmdc:mga06z11_3893_c1 3300050494 Bacteria 5820
534 nmdc:mga05p37_140663_c1 3300050507 Bacteria 2957
535 nmdc:mga09592_198655_c1 3300050508 Bacteria 1736
536 nmdc:mga08y16_5861_c1 3300050511 Bacteria 12873
537 nmdc:mga0n895_19936_c1 3300050512 Bacteria 6244
538 nmdc:mga08x19_228300_c1 3300050514 Bacteria 1281
539 nmdc:mga0a205_9224_c1 3300050515 Bacteria 9008
540 Ga0495601_0171870 3300053077 Bacteria 1416
541 Ga0500644_0052741 3300053088 Bacteria 1401
542 Ga0500641_0032258 3300053096 Bacteria 2071
543 Ga0466962_0000455 3300061719 Bacteria 17755
544 Ga0466962_0003816 3300061719 Bacteria 7201

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0065632 Ga0496115_0065632_16_891 285
2 3300044693 Ga0466961_0047153 Ga0466961_0047153_25_915 288
3 3300039447 Ga0436361_0970262 Ga0436361_0970262_1015_1932 301
4 iso_pu_bacteria 2954682443 2954685464 317
5 3300003322 rootL2_10020111 rootL2_100201111 327
6 3300003316 rootH1_10013452 rootH1_100134522 343
7 3300005355 Ga0070671_100003983 Ga0070671_10000398316 344
8 3300005548 Ga0070665_100001778 Ga0070665_1000017781 344
9 3300005843 Ga0068860_100275835 Ga0068860_1002758352 344
10 3300028379 Ga0268266_10002138 Ga0268266_1000213824 344
11 3300028381 Ga0268264_10050028 Ga0268264_100500281 344
12 3300035692 Ga0373935_0069159 Ga0373935_0069159_619_1659 345
13 iso_pu_bacteria 2866612099 2866618752 345
14 iso_pu_bacteria 2899359706 2899360201 345
15 iso_pu_bacteria 2582580736 2583152311 346
16 iso_pu_bacteria 2795385470 2795779802 346
17 iso_pu_bacteria 2643221724 2644679518 347
18 iso_pu_bacteria 2728369380 2730229025 347
19 iso_pu_bacteria 2870628048 2870630721 347
20 iso_pu_bacteria 2917736166 2917737508 347
21 iso_pu_bacteria 2946033335 2946034379 347
22 3300031838 Ga0307518_10049331 Ga0307518_100493313 348
23 3300042005 Ga0439448_0013296 Ga0439448_0013296_469_1533 348
24 iso_pu_bacteria 2643221597 2643997623 348
25 iso_pu_bacteria 2643221962 2645723596 348
26 iso_pu_bacteria 2675903058 2676477814 348
27 iso_pu_bacteria 2827628540 2827629138 348
28 iso_pu_bacteria 2833709550 2833711355 348
29 iso_pu_bacteria 2855386786 2855389051 348
30 iso_pu_bacteria 8016254467 8016257195 348
31 3300005328 Ga0070676_10090160 Ga0070676_100901601 349
32 3300005335 Ga0070666_10029086 Ga0070666_100290862 349
33 3300005336 Ga0070680_100069713 Ga0070680_1000697132 349
34 3300005339 Ga0070660_100053486 Ga0070660_1000534862 349
35 3300005340 Ga0070689_100112099 Ga0070689_1001120991 349
36 3300005341 Ga0070691_10012855 Ga0070691_100128553 349
37 3300005344 Ga0070661_100070184 Ga0070661_1000701842 349
38 3300005356 Ga0070674_100392581 Ga0070674_1003925811 349
39 3300005364 Ga0070673_100054815 Ga0070673_1000548152 349
40 3300005367 Ga0070667_100293450 Ga0070667_1002934502 349
41 3300005436 Ga0070713_100359505 Ga0070713_1003595052 349
42 3300005438 Ga0070701_10027477 Ga0070701_100274772 349
43 3300005439 Ga0070711_100064291 Ga0070711_1000642911 349
44 3300005444 Ga0070694_100323416 Ga0070694_1003234161 349
45 3300005445 Ga0070708_100038777 Ga0070708_1000387772 349
46 3300005445 Ga0070708_100094026 Ga0070708_1000940262 349
47 3300005455 Ga0070663_100231749 Ga0070663_1002317492 349
48 3300005457 Ga0070662_100325271 Ga0070662_1003252712 349
49 3300005458 Ga0070681_10104204 Ga0070681_101042043 349
50 3300005467 Ga0070706_100034361 Ga0070706_1000343613 349
51 3300005468 Ga0070707_100056623 Ga0070707_1000566233 349
52 3300005471 Ga0070698_100021955 Ga0070698_1000219557 349
53 3300005471 Ga0070698_100038750 Ga0070698_1000387502 349
54 3300005530 Ga0070679_100104852 Ga0070679_1001048522 349
55 3300005539 Ga0068853_100047395 Ga0068853_1000473952 349
56 3300005543 Ga0070672_100031002 Ga0070672_1000310023 349
57 3300005544 Ga0070686_100034172 Ga0070686_1000341722 349
58 3300005545 Ga0070695_100008066 Ga0070695_1000080664 349
59 3300005547 Ga0070693_100058800 Ga0070693_1000588002 349
60 3300005548 Ga0070665_100312474 Ga0070665_1003124742 349
61 3300005549 Ga0070704_100117106 Ga0070704_1001171062 349
62 3300005564 Ga0070664_100045344 Ga0070664_1000453443 349
63 3300005577 Ga0068857_100023265 Ga0068857_1000232653 349
64 3300005578 Ga0068854_100175713 Ga0068854_1001757132 349
65 3300005615 Ga0070702_100016862 Ga0070702_1000168623 349
66 3300005617 Ga0068859_100122025 Ga0068859_1001220252 349
67 3300005841 Ga0068863_100057543 Ga0068863_1000575433 349
68 3300005843 Ga0068860_100078304 Ga0068860_1000783042 349
69 3300005844 Ga0068862_100051249 Ga0068862_1000512492 349
70 3300005983 Ga0081540_1000037 Ga0081540_100003711 349
71 3300006358 Ga0068871_100073746 Ga0068871_1000737462 349
72 3300006881 Ga0068865_100318707 Ga0068865_1003187072 349
73 3300006931 Ga0097620_100122024 Ga0097620_1001220242 349
74 3300009101 Ga0105247_10132690 Ga0105247_101326902 349
75 3300009174 Ga0105241_10066723 Ga0105241_100667232 349
76 3300009176 Ga0105242_10017678 Ga0105242_100176784 349
77 3300009551 Ga0105238_10432343 Ga0105238_104323432 349
78 3300009553 Ga0105249_10048872 Ga0105249_100488723 349
79 3300011119 Ga0105246_10014236 Ga0105246_100142363 349
80 3300013100 Ga0157373_10065688 Ga0157373_100656881 349
81 3300013102 Ga0157371_10136624 Ga0157371_101366242 349
82 3300013296 Ga0157374_10108637 Ga0157374_101086373 349
83 3300013297 Ga0157378_10289876 Ga0157378_102898762 349
84 3300013306 Ga0163162_10579114 Ga0163162_105791142 349
85 3300014326 Ga0157380_10063764 Ga0157380_100637644 349
86 3300020081 Ga0206354_11360300 Ga0206354_113603002 349
87 3300021377 Ga0213874_10023183 Ga0213874_100231831 349
88 3300025885 Ga0207653_10003977 Ga0207653_100039772 349
89 3300025898 Ga0207692_10103379 Ga0207692_101033792 349
90 3300025901 Ga0207688_10022343 Ga0207688_100223432 349
91 3300025907 Ga0207645_10119010 Ga0207645_101190102 349
92 3300025908 Ga0207643_10017166 Ga0207643_100171663 349
93 3300025915 Ga0207693_10060282 Ga0207693_100602822 349
94 3300025917 Ga0207660_10204258 Ga0207660_102042582 349
95 3300025918 Ga0207662_10024168 Ga0207662_100241682 349
96 3300025919 Ga0207657_10001310 Ga0207657_100013105 349
97 3300025928 Ga0207700_10076087 Ga0207700_100760872 349
98 3300025928 Ga0207700_10101507 Ga0207700_101015072 349
99 3300025929 Ga0207664_10036163 Ga0207664_100361632 349
100 3300025929 Ga0207664_10144740 Ga0207664_101447402 349
101 3300025931 Ga0207644_10002584 Ga0207644_100025841 349
102 3300025931 Ga0207644_10230822 Ga0207644_102308221 349
103 3300025937 Ga0207669_10073685 Ga0207669_100736852 349
104 3300025940 Ga0207691_10053368 Ga0207691_100533682 349
105 3300025942 Ga0207689_10046652 Ga0207689_100466522 349
106 3300025945 Ga0207679_10075405 Ga0207679_100754052 349
107 3300025960 Ga0207651_10191933 Ga0207651_101919331 349
108 3300025961 Ga0207712_10263585 Ga0207712_102635851 349
109 3300025981 Ga0207640_10057783 Ga0207640_100577832 349
110 3300026067 Ga0207678_10002951 Ga0207678_100029514 349
111 3300026075 Ga0207708_10009034 Ga0207708_100090345 349
112 3300026088 Ga0207641_10093722 Ga0207641_100937223 349
113 3300026116 Ga0207674_10021023 Ga0207674_100210233 349
114 3300026118 Ga0207675_100006660 Ga0207675_1000066606 349
115 3300026121 Ga0207683_10052120 Ga0207683_100521203 349
116 3300028380 Ga0268265_10066935 Ga0268265_100669352 349
117 3300028381 Ga0268264_10095453 Ga0268264_100954532 349
118 3300035083 Ga0373926_0006875 Ga0373926_0006875_190_1242 349
119 3300035084 Ga0373928_0004916 Ga0373928_0004916_656_1714 349
120 3300035086 Ga0373934_0075919 Ga0373934_0075919_263_1324 349
121 3300035089 Ga0373944_0000461 Ga0373944_0000461_6628_7680 349
122 3300035090 Ga0373949_0030878 Ga0373949_0030878_122_1180 349
123 3300035091 Ga0373951_0010037 Ga0373951_0010037_518_1576 349
124 3300035092 Ga0373952_0011595 Ga0373952_0011595_176_1234 349
125 3300035111 Ga0373923_0020436 Ga0373923_0020436_445_1506 349
126 3300035113 Ga0373936_0000278 Ga0373936_0000278_4283_5335 349
127 3300035113 Ga0373936_0038826 Ga0373936_0038826_481_1542 349
128 3300035114 Ga0373939_0042787 Ga0373939_0042787_132_1190 349
129 3300035116 Ga0373945_0000084 Ga0373945_0000084_10575_11627 349
130 3300035116 Ga0373945_0004823 Ga0373945_0004823_154_1215 349
131 3300035117 Ga0373953_0026912 Ga0373953_0026912_106_1167 349
132 3300035119 Ga0373956_0012266 Ga0373956_0012266_441_1505 349
133 3300035120 Ga0373957_0073032 Ga0373957_0073032_154_1212 349
134 3300035121 Ga0373960_0009885 Ga0373960_0009885_346_1404 349
135 3300035170 Ga0373943_0000119 Ga0373943_0000119_11328_12380 349
136 3300035171 Ga0373946_0000484 Ga0373946_0000484_3966_5018 349
137 3300035171 Ga0373946_0001797 Ga0373946_0001797_23_1084 349
138 3300035172 Ga0373955_0017885 Ga0373955_0017885_398_1459 349
139 3300035692 Ga0373935_0002246 Ga0373935_0002246_8753_9805 349
140 3300035695 Ga0373927_0000726 Ga0373927_0000726_11770_12822 349
141 3300035725 Ga0373947_0000141 Ga0373947_0000141_19476_20528 349
142 3300035725 Ga0373947_0008944 Ga0373947_0008944_2801_3862 349
143 3300036401 Ga0373937_0374266 Ga0373937_0374266_88_1143 349
144 3300037068 Ga0373925_0001150 Ga0373925_0001150_13648_14700 349
145 3300045976 Ga0466967_0038140 Ga0466967_0038140_2116_3168 349
146 3300046454 Ga0495592_0048009 Ga0495592_0048009_162_1223 349
147 3300046455 Ga0495603_0017955 Ga0495603_0017955_887_1948 349
148 3300046461 Ga0495641_0017048 Ga0495641_0017048_1166_2218 349
149 3300046462 Ga0495651_0007284 Ga0495651_0007284_6617_7672 349
150 3300046462 Ga0495651_0044734 Ga0495651_0044734_212_1264 349
151 3300046463 Ga0495653_0008878 Ga0495653_0008878_4037_5089 349
152 3300046463 Ga0495653_0080297 Ga0495653_0080297_862_1917 349
153 3300046473 Ga0495582_0007628 Ga0495582_0007628_347_1408 349
154 3300046475 Ga0495639_0005702 Ga0495639_0005702_4081_5142 349
155 3300046476 Ga0495662_0006659 Ga0495662_0006659_351_1412 349
156 3300046477 Ga0495664_0002082 Ga0495664_0002082_2813_3865 349
157 3300046499 Ga0495594_0018104 Ga0495594_0018104_1843_2904 349
158 3300046511 Ga0495608_0054715 Ga0495608_0054715_396_1448 349
159 3300046516 Ga0495628_0071089 Ga0495628_0071089_797_1849 349
160 3300046517 Ga0495630_0006432 Ga0495630_0006432_3704_4756 349
161 3300046529 Ga0495652_0008484 Ga0495652_0008484_1255_2307 349
162 3300046531 Ga0495665_0033551 Ga0495665_0033551_1257_2309 349
163 3300046533 Ga0495640_0030845 Ga0495640_0030845_2597_3649 349
164 3300046535 Ga0495586_0026471 Ga0495586_0026471_2016_3077 349
165 3300046536 Ga0495587_0033380 Ga0495587_0033380_1606_2667 349
166 3300046536 Ga0495587_0087460 Ga0495587_0087460_497_1549 349
167 3300046543 Ga0495645_0105425 Ga0495645_0105425_911_1966 349
168 3300046559 Ga0495667_0002180 Ga0495667_0002180_2472_3524 349
169 3300046559 Ga0495667_0041508 Ga0495667_0041508_1230_2285 349
170 3300046663 Ga0495635_0001270 Ga0495635_0001270_8290_9342 349
171 3300046678 Ga0495599_0026447 Ga0495599_0026447_2286_3347 349
172 3300046678 Ga0495599_0079018 Ga0495599_0079018_256_1311 349
173 3300046681 Ga0495647_0028764 Ga0495647_0028764_389_1450 349
174 3300046683 Ga0495658_0006519 Ga0495658_0006519_1604_2665 349
175 3300046690 Ga0495624_0007672 Ga0495624_0007672_4161_5213 349
176 3300046809 Ga0495600_0080921 Ga0495600_0080921_894_1946 349
177 3300047317 Ga0495604_0020250 Ga0495604_0020250_1994_3055 349
178 3300047319 Ga0495674_0000739 Ga0495674_0000739_351_1403 349
179 3300047321 Ga0495676_0017612 Ga0495676_0017612_3188_4249 349
180 3300047321 Ga0495676_0056053 Ga0495676_0056053_984_2036 349
181 3300047322 Ga0495680_0006565 Ga0495680_0006565_8276_9331 349
182 3300047322 Ga0495680_0111234 Ga0495680_0111234_225_1280 349
183 3300047444 Ga0495675_0070627 Ga0495675_0070627_312_1373 349
184 3300047471 Ga0495684_0001876 Ga0495684_0001876_5865_6917 349
185 3300047471 Ga0495684_0015935 Ga0495684_0015935_3715_4776 349
186 3300047471 Ga0495684_0026721 Ga0495684_0026721_776_1831 349
187 3300047673 Ga0495593_0025998 Ga0495593_0025998_45_1106 349
188 3300048905 Ga0496102_0238870 Ga0496102_0238870_637_1695 349
189 3300048906 Ga0496103_0084930 Ga0496103_0084930_744_1802 349
190 3300048910 Ga0496107_0175563 Ga0496107_0175563_479_1537 349
191 3300048911 Ga0496108_0152023 Ga0496108_0152023_921_1979 349
192 3300048913 Ga0496110_0031946 Ga0496110_0031946_1857_2915 349
193 3300048914 Ga0496111_0060140 Ga0496111_0060140_495_1553 349
194 3300048916 Ga0496113_0101301 Ga0496113_0101301_744_1802 349
195 3300048918 Ga0496115_0094525 Ga0496115_0094525_1133_2191 349
196 3300053077 Ga0495601_0171870 Ga0495601_0171870_85_1146 349
197 iso_pu_bacteria 8033684223 8033691452 349
198 3300005339 Ga0070660_100042689 Ga0070660_1000426892 350
199 3300005366 Ga0070659_100115232 Ga0070659_1001152322 350
200 3300025904 Ga0207647_10043188 Ga0207647_100431882 350
201 3300025932 Ga0207690_10087528 Ga0207690_100875282 350
202 3300028794 Ga0307515_10123340 Ga0307515_101233402 350
203 3300033179 Ga0307507_10034694 Ga0307507_100346946 350
204 3300044658 Ga0466972_0025634 Ga0466972_0025634_1466_2536 350
205 3300005327 Ga0070658_10309633 Ga0070658_103096331 351
206 3300005328 Ga0070676_10045712 Ga0070676_100457123 351
207 3300005338 Ga0068868_100036941 Ga0068868_1000369412 351
208 3300005339 Ga0070660_100247389 Ga0070660_1002473892 351
209 3300005341 Ga0070691_10024845 Ga0070691_100248453 351
210 3300005344 Ga0070661_100191864 Ga0070661_1001918641 351
211 3300005345 Ga0070692_10023965 Ga0070692_100239653 351
212 3300005355 Ga0070671_100027438 Ga0070671_1000274387 351
213 3300005365 Ga0070688_100064615 Ga0070688_1000646153 351
214 3300005366 Ga0070659_100070520 Ga0070659_1000705203 351
215 3300005434 Ga0070709_10003363 Ga0070709_100033639 351
216 3300005435 Ga0070714_100014741 Ga0070714_1000147414 351
217 3300005435 Ga0070714_100017702 Ga0070714_1000177024 351
218 3300005435 Ga0070714_100036360 Ga0070714_1000363602 351
219 3300005435 Ga0070714_100116056 Ga0070714_1001160561 351
220 3300005436 Ga0070713_100033092 Ga0070713_1000330922 351
221 3300005436 Ga0070713_100040421 Ga0070713_1000404212 351
222 3300005437 Ga0070710_10002570 Ga0070710_100025707 351
223 3300005457 Ga0070662_100059477 Ga0070662_1000594773 351
224 3300005458 Ga0070681_10110524 Ga0070681_101105243 351
225 3300005468 Ga0070707_100000466 Ga0070707_10000046638 351
226 3300005548 Ga0070665_100330216 Ga0070665_1003302162 351
227 3300005578 Ga0068854_100322825 Ga0068854_1003228251 351
228 3300005614 Ga0068856_100024127 Ga0068856_1000241272 351
229 3300005615 Ga0070702_100001774 Ga0070702_1000017744 351
230 3300005617 Ga0068859_100117599 Ga0068859_1001175992 351
231 3300005834 Ga0068851_10010306 Ga0068851_100103063 351
232 3300005840 Ga0068870_10003104 Ga0068870_100031049 351
233 3300005843 Ga0068860_100372993 Ga0068860_1003729932 351
234 3300006058 Ga0075432_10031065 Ga0075432_100310652 351
235 3300006358 Ga0068871_100021131 Ga0068871_1000211315 351
236 3300006844 Ga0075428_100052509 Ga0075428_1000525095 351
237 3300006847 Ga0075431_100357045 Ga0075431_1003570452 351
238 3300006871 Ga0075434_100023900 Ga0075434_1000239002 351
239 3300006914 Ga0075436_100042426 Ga0075436_1000424261 351
240 3300006931 Ga0097620_100117592 Ga0097620_1001175922 351
241 3300009098 Ga0105245_10171670 Ga0105245_101716702 351
242 3300009147 Ga0114129_10116178 Ga0114129_101161783 351
243 3300009174 Ga0105241_10188474 Ga0105241_101884742 351
244 3300009551 Ga0105238_10124914 Ga0105238_101249143 351
245 3300011119 Ga0105246_10001918 Ga0105246_100019185 351
246 3300013296 Ga0157374_10032344 Ga0157374_100323443 351
247 3300013308 Ga0157375_10125964 Ga0157375_101259643 351
248 3300014497 Ga0182008_10073079 Ga0182008_100730792 351
249 3300014968 Ga0157379_10121278 Ga0157379_101212783 351
250 3300014969 Ga0157376_10215640 Ga0157376_102156402 351
251 3300020070 Ga0206356_10503846 Ga0206356_105038463 351
252 3300025321 Ga0207656_10013812 Ga0207656_100138123 351
253 3300025901 Ga0207688_10001356 Ga0207688_1000135611 351
254 3300025908 Ga0207643_10000252 Ga0207643_1000025210 351
255 3300025910 Ga0207684_10005507 Ga0207684_1000550711 351
256 3300025912 Ga0207707_10251495 Ga0207707_102514952 351
257 3300025913 Ga0207695_10080382 Ga0207695_100803823 351
258 3300025915 Ga0207693_10049796 Ga0207693_100497963 351
259 3300025919 Ga0207657_10012261 Ga0207657_1001226112 351
260 3300025924 Ga0207694_10040321 Ga0207694_100403212 351
261 3300025925 Ga0207650_10176573 Ga0207650_101765732 351
262 3300025928 Ga0207700_10033600 Ga0207700_100336004 351
263 3300025928 Ga0207700_10161653 Ga0207700_101616531 351
264 3300025929 Ga0207664_10196373 Ga0207664_101963732 351
265 3300025941 Ga0207711_10046215 Ga0207711_100462154 351
266 3300025942 Ga0207689_10005533 Ga0207689_1000553310 351
267 3300025944 Ga0207661_10076652 Ga0207661_100766523 351
268 3300026035 Ga0207703_10025518 Ga0207703_100255182 351
269 3300026067 Ga0207678_10001822 Ga0207678_100018229 351
270 3300026088 Ga0207641_10464744 Ga0207641_104647441 351
271 3300026116 Ga0207674_10246083 Ga0207674_102460831 351
272 3300026121 Ga0207683_10000558 Ga0207683_1000055810 351
273 3300028379 Ga0268266_10059472 Ga0268266_100594722 351
274 3300031901 Ga0307406_10001678 Ga0307406_1000167813 351
275 3300032004 Ga0307414_10108194 Ga0307414_101081942 351
276 3300037068 Ga0373925_0000799 Ga0373925_0000799_27792_28862 351
277 3300042012 Ga0439455_0004610 Ga0439455_0004610_446_1522 351
278 3300042438 Ga0439459_0008827 Ga0439459_0008827_628_1704 351
279 3300044658 Ga0466972_0028025 Ga0466972_0028025_191_1264 351
280 3300044765 Ga0466970_0000087 Ga0466970_0000087_25908_26981 351
281 3300044765 Ga0466970_0019253 Ga0466970_0019253_1228_2307 351
282 3300048906 Ga0496103_0020268 Ga0496103_0020268_52_1128 351
283 3300048907 Ga0496104_0005657 Ga0496104_0005657_3546_4622 351
284 3300048909 Ga0496106_0005516 Ga0496106_0005516_5490_6566 351
285 3300048911 Ga0496108_0040929 Ga0496108_0040929_2232_3308 351
286 3300048916 Ga0496113_0011663 Ga0496113_0011663_4772_5848 351
287 3300048929 Ga0496126_0066101 Ga0496126_0066101_722_1795 351
288 3300049574 Ga0501038_0052635 Ga0501038_0052635_1043_2116 351
289 3300050507 nmdc:mga05p37_140663_c1 nmdc:mga05p37_140663_c1_1183_2259 351
290 3300050508 nmdc:mga09592_198655_c1 nmdc:mga09592_198655_c1_530_1606 351
291 3300050511 nmdc:mga08y16_5861_c1 nmdc:mga08y16_5861_c1_7312_8388 351
292 3300050512 nmdc:mga0n895_19936_c1 nmdc:mga0n895_19936_c1_5126_6202 351
293 3300050514 nmdc:mga08x19_228300_c1 nmdc:mga08x19_228300_c1_75_1151 351
294 3300050515 nmdc:mga0a205_9224_c1 nmdc:mga0a205_9224_c1_5563_6639 351
295 3300005327 Ga0070658_10004154 Ga0070658_100041547 352
296 3300005434 Ga0070709_10052580 Ga0070709_100525802 352
297 3300005539 Ga0068853_100012964 Ga0068853_1000129644 352
298 3300005937 Ga0081455_10000288 Ga0081455_1000028836 352
299 3300009551 Ga0105238_10099745 Ga0105238_100997452 352
300 3300026041 Ga0207639_10006559 Ga0207639_100065597 352
301 3300037466 Ga0395898_0150183 Ga0395898_0150183_473_1549 352
302 3300037853 Ga0436364_0687596 Ga0436364_0687596_23_1096 352
303 3300038443 Ga0395901_0040566 Ga0395901_0040566_1119_2195 352
304 3300048920 Ga0496117_0000585 Ga0496117_0000585_17642_18718 352
305 3300048922 Ga0496119_0004150 Ga0496119_0004150_2215_3291 352
306 3300048922 Ga0496119_0007131 Ga0496119_0007131_4804_5880 352
307 3300048923 Ga0496120_0001621 Ga0496120_0001621_4648_5724 352
308 3300048925 Ga0496122_0001174 Ga0496122_0001174_10102_11178 352
309 3300048926 Ga0496123_0002245 Ga0496123_0002245_13245_14321 352
310 3300048927 Ga0496124_0001320 Ga0496124_0001320_28045_29121 352
311 3300048928 Ga0496125_0000077 Ga0496125_0000077_207401_208477 352
312 3300048928 Ga0496125_0005847 Ga0496125_0005847_3454_4530 352
313 3300048929 Ga0496126_0012878 Ga0496126_0012878_2996_4072 352
314 3300050491 nmdc:mga00v17_105631_c2 nmdc:mga00v17_105631_c2_267_1343 352
315 iso_pu_bacteria 2558860280 2559426996 352
316 iso_pu_bacteria 2984580707 2984581454 352
317 3300005435 Ga0070714_100026301 Ga0070714_1000263013 353
318 3300005530 Ga0070679_100128862 Ga0070679_1001288622 353
319 3300025909 Ga0207705_10000001 Ga0207705_10000001117 353
320 3300026116 Ga0207674_10122602 Ga0207674_101226023 353
321 3300028800 Ga0265338_10025364 Ga0265338_100253643 353
322 3300030521 Ga0307511_10014203 Ga0307511_100142036 353
323 3300033547 Ga0316212_1006041 Ga0316212_10060412 353
324 3300048929 Ga0496126_0038577 Ga0496126_0038577_184_1254 353
325 3300025944 Ga0207661_10147580 Ga0207661_101475802 354
326 3300031903 Ga0307407_10034076 Ga0307407_100340762 354
327 3300031995 Ga0307409_100113163 Ga0307409_1001131632 354
328 3300032002 Ga0307416_100004305 Ga0307416_1000043057 354
329 3300032002 Ga0307416_100076216 Ga0307416_1000762162 354
330 3300032004 Ga0307414_10041944 Ga0307414_100419442 354
331 3300032126 Ga0307415_100036361 Ga0307415_1000363611 354
332 3300041512 Ga0451853_2373291 Ga0451853_2373291_86_1171 354
333 3300044656 Ga0466969_0019127 Ga0466969_0019127_145_1242 354
334 3300044765 Ga0466970_0007752 Ga0466970_0007752_3798_4895 354
335 iso_pu_bacteria 2547132111 2547408618 354
336 iso_pu_bacteria 2582581312 2585296360 354
337 iso_pu_bacteria 2582581313 2585307044 354
338 iso_pu_bacteria 2616644814 2616697061 354
339 iso_pu_bacteria 2616644941 2616900150 354
340 iso_pu_bacteria 2643221578 2643902505 354
341 iso_pu_bacteria 2643221647 2644263671 354
342 iso_pu_bacteria 2643221673 2644404076 354
343 iso_pu_bacteria 2643221678 2644439791 354
344 iso_pu_bacteria 2784746763 2785341437 354
345 iso_pu_bacteria 2786546132 2786672419 354
346 iso_pu_bacteria 2802429296 2804847674 354
347 iso_pu_bacteria 2808606359 2808843798 354
348 iso_pu_bacteria 2808606368 2808885972 354
349 iso_pu_bacteria 2808606982 2811844683 354
350 iso_pu_bacteria 2811994917 2812478992 354
351 iso_pu_bacteria 2818991463 2819694850 354
352 iso_pu_bacteria 2852635781 2852642031 354
353 iso_pu_bacteria 2862178590 2862179214 354
354 iso_pu_bacteria 2862281513 2862285005 354
355 iso_pu_bacteria 2862382967 2862385463 354
356 iso_pu_bacteria 2862507626 2862513251 354
357 iso_pu_bacteria 2862574272 2862577764 354
358 iso_pu_bacteria 2863404153 2863408370 354
359 iso_pu_bacteria 2873151551 2873154286 354
360 iso_pu_bacteria 2875391855 2875396450 354
361 iso_pu_bacteria 2877676314 2877679365 354
362 iso_pu_bacteria 2912715099 2912717959 354
363 iso_pu_bacteria 2912723979 2912730386 354
364 iso_pu_bacteria 2919468124 2919474305 354
365 iso_pu_bacteria 2935390628 2935391586 354
366 iso_pu_bacteria 2946045630 2946048107 354
367 iso_pu_bacteria 2947224130 2947227200 354
368 iso_pu_bacteria 2954380949 2954384254 354
369 iso_pu_bacteria 2954673503 2954678692 354
370 iso_pu_bacteria 2954691527 2954695076 354
371 iso_pu_bacteria 2954711539 2954714567 354
372 iso_pu_bacteria 2954721474 2954724512 354
373 iso_pu_bacteria 2954731030 2954737307 354
374 iso_pu_bacteria 2954740390 2954743433 354
375 iso_pu_bacteria 2954749733 2954756157 354
376 iso_pu_bacteria 2954759201 2954762390 354
377 iso_pu_bacteria 2966598605 2966601086 354
378 iso_pu_bacteria 2990059506 2990065310 354
379 iso_pu_bacteria 2990088156 2990089453 354
380 iso_pu_bacteria 3006393351 3006398176 354
381 iso_pu_bacteria 3006425503 3006430107 354
382 iso_pu_bacteria 3006486233 3006487760 354
383 iso_pu_bacteria 3006493962 3006494828 354
384 iso_pu_bacteria 8008558824 8008562542 354
385 iso_pu_bacteria 8008574985 8008577401 354
386 iso_pu_bacteria 8023623736 8023624816 354
387 iso_pu_bacteria 8025413630 8025416482 354
388 iso_pu_bacteria 8025478263 8025481594 354
389 iso_pu_bacteria 8048406513 8048406695 354
390 iso_pu_bacteria 8056667051 8056668966 354
391 iso_pu_bacteria 8056829672 8056831905 354
392 3300005329 Ga0070683_100105911 Ga0070683_1001059112 355
393 3300006051 Ga0075364_10262573 Ga0075364_102625731 355
394 3300013308 Ga0157375_10202987 Ga0157375_102029873 355
395 3300027312 Ga0209371_1008803 Ga0209371_10088035 355
396 3300028800 Ga0265338_10007751 Ga0265338_1000775111 355
397 iso_pu_bacteria 8056447290 8056449848 355
398 iso_pu_bacteria 2643221587 2643941566 356
399 iso_pu_bacteria 2643221670 2644386665 356
400 iso_pu_bacteria 2643221677 2644428650 356
401 iso_pu_bacteria 2867475112 2867478351 356
402 iso_pu_bacteria 2918501144 2918506246 356
403 iso_pu_bacteria 2997451912 2997453300 356
404 iso_pu_bacteria 8054160619 8054161236 356
405 3300046455 Ga0495603_0001577 Ga0495603_0001577_6563_7642 357
406 3300046459 Ga0495629_0001919 Ga0495629_0001919_7835_8914 357
407 3300046459 Ga0495629_0004087 Ga0495629_0004087_4398_5477 357
408 3300046492 Ga0495585_0060008 Ga0495585_0060008_852_1931 357
409 3300046499 Ga0495594_0000151 Ga0495594_0000151_21722_22801 357
410 3300046557 Ga0495622_0005199 Ga0495622_0005199_4350_5429 357
411 3300046674 Ga0495588_0001826 Ga0495588_0001826_5422_6501 357
412 3300046689 Ga0495613_0055352 Ga0495613_0055352_176_1255 357
413 3300047318 Ga0495636_0024186 Ga0495636_0024186_491_1570 357
414 3300047321 Ga0495676_0003601 Ga0495676_0003601_8853_9932 357
415 3300047321 Ga0495676_0008085 Ga0495676_0008085_5504_6583 357
416 3300048089 Ga0495614_0000088 Ga0495614_0000088_1678_2757 357
417 iso_pu_bacteria 2912757875 2912762520 357
418 iso_pu_bacteria 8025530807 8025537509 357
419 3300003316 rootH1_10004178 rootH1_100041782 358
420 3300003323 rootH1_10006175 rootH1_100061759 358
421 3300003323 rootH1_10008994 rootH1_100089943 358
422 3300003578 Ga0006562J51391_1076183 Ga0006562J51391_10761836 358
423 3300003578 Ga0006562J51391_1076186 Ga0006562J51391_10761861 358
424 3300003578 Ga0006562J51391_1131149 Ga0006562J51391_11311492 358
425 3300005937 Ga0081455_10105888 Ga0081455_101058882 358
426 3300006048 Ga0075363_100002322 Ga0075363_1000023226 358
427 3300006178 Ga0075367_10000660 Ga0075367_1000066011 358
428 3300006948 Ga0099826_10020443 Ga0099826_100204436 358
429 3300009148 Ga0105243_10215639 Ga0105243_102156392 358
430 3300011119 Ga0105246_10008217 Ga0105246_100082175 358
431 3300011119 Ga0105246_10254041 Ga0105246_102540412 358
432 3300014497 Ga0182008_10002554 Ga0182008_100025542 358
433 3300015262 Ga0182007_10000334 Ga0182007_1000033412 358
434 3300025297 Ga0209758_1003976 Ga0209758_10039762 358
435 3300025302 Ga0207426_1002494 Ga0207426_10024947 358
436 3300025302 Ga0207426_1004622 Ga0207426_10046226 358
437 3300025904 Ga0207647_10030640 Ga0207647_100306403 358
438 3300025949 Ga0207667_10162707 Ga0207667_101627072 358
439 3300028786 Ga0307517_10059196 Ga0307517_100591963 358
440 3300028794 Ga0307515_10001617 Ga0307515_1000161741 358
441 3300028794 Ga0307515_10018584 Ga0307515_100185845 358
442 3300028794 Ga0307515_10174043 Ga0307515_101740431 358
443 3300030521 Ga0307511_10015988 Ga0307511_100159885 358
444 3300030522 Ga0307512_10029811 Ga0307512_100298112 358
445 3300030522 Ga0307512_10088477 Ga0307512_100884772 358
446 3300031456 Ga0307513_10033310 Ga0307513_100333102 358
447 3300031456 Ga0307513_10097245 Ga0307513_100972452 358
448 3300031456 Ga0307513_10133134 Ga0307513_101331342 358
449 3300031507 Ga0307509_10123349 Ga0307509_101233493 358
450 3300031616 Ga0307508_10004580 Ga0307508_100045807 358
451 3300031649 Ga0307514_10027363 Ga0307514_100273634 358
452 3300031649 Ga0307514_10033526 Ga0307514_100335263 358
453 3300031649 Ga0307514_10070706 Ga0307514_100707062 358
454 3300031730 Ga0307516_10006178 Ga0307516_100061782 358
455 3300031730 Ga0307516_10012725 Ga0307516_100127259 358
456 3300032002 Ga0307416_100204595 Ga0307416_1002045952 358
457 3300033179 Ga0307507_10057244 Ga0307507_100572443 358
458 3300033180 Ga0307510_10021098 Ga0307510_100210984 358
459 3300033180 Ga0307510_10095691 Ga0307510_100956912 358
460 3300033180 Ga0307510_10155037 Ga0307510_101550372 358
461 3300033180 Ga0307510_10170555 Ga0307510_101705552 358
462 3300033180 Ga0307510_10254722 Ga0307510_102547221 358
463 3300037418 Ga0395900_0253262 Ga0395900_0253262_195_1274 358
464 3300037418 Ga0395900_0314677 Ga0395900_0314677_144_1223 358
465 3300037466 Ga0395898_0068644 Ga0395898_0068644_1302_2381 358
466 3300041404 Ga0439436_0000125 Ga0439436_0000125_8917_9996 358
467 3300041404 Ga0439436_0001917 Ga0439436_0001917_3300_4379 358
468 3300041406 Ga0439439_0007729 Ga0439439_0007729_745_1824 358
469 3300041406 Ga0439439_0009676 Ga0439439_0009676_901_1980 358
470 3300041512 Ga0451853_1868916 Ga0451853_1868916_1468_2547 358
471 3300041512 Ga0451853_2253133 Ga0451853_2253133_832_1911 358
472 3300042007 Ga0439449_0002264 Ga0439449_0002264_1960_3039 358
473 3300042007 Ga0439449_0020532 Ga0439449_0020532_48_1127 358
474 3300042008 Ga0439450_004963 Ga0439450_004963_1054_2133 358
475 3300042012 Ga0439455_0000667 Ga0439455_0000667_1105_2184 358
476 3300042014 Ga0439457_001349 Ga0439457_001349_3668_4747 358
477 3300042014 Ga0439457_006283 Ga0439457_006283_1071_2150 358
478 3300042015 Ga0439462_0003587 Ga0439462_0003587_1724_2803 358
479 3300042131 Ga0450894_000037 Ga0450894_000037_12388_13467 358
480 3300042133 Ga0450896_000889 Ga0450896_000889_277_1356 358
481 3300042135 Ga0450899_000077 Ga0450899_000077_4638_5717 358
482 3300042145 Ga0450906_000093 Ga0450906_000093_4307_5386 358
483 3300042184 Ga0450908_002524 Ga0450908_002524_616_1695 358
484 3300044658 Ga0466972_0002655 Ga0466972_0002655_4515_5594 358
485 3300044658 Ga0466972_0008487 Ga0466972_0008487_59_1138 358
486 3300044683 Ga0466965_0000976 Ga0466965_0000976_6577_7656 358
487 3300044684 Ga0466966_0017463 Ga0466966_0017463_2184_3263 358
488 3300044693 Ga0466961_0024027 Ga0466961_0024027_831_1910 358
489 3300044694 Ga0466963_0000616 Ga0466963_0000616_4442_5521 358
490 3300044694 Ga0466963_0039416 Ga0466963_0039416_1090_2169 358
491 3300044706 Ga0466964_0009239 Ga0466964_0009239_2568_3647 358
492 3300044719 Ga0466971_0001392 Ga0466971_0001392_6372_7451 358
493 3300044719 Ga0466971_0045785 Ga0466971_0045785_57_1136 358
494 3300044735 Ga0466968_0015675 Ga0466968_0015675_866_1945 358
495 3300044765 Ga0466970_0009370 Ga0466970_0009370_2807_3886 358
496 3300044765 Ga0466970_0042026 Ga0466970_0042026_599_1711 358
497 3300044842 Ga0466957_0070608 Ga0466957_0070608_917_1996 358
498 3300045976 Ga0466967_0009681 Ga0466967_0009681_861_1940 358
499 3300045976 Ga0466967_0009957 Ga0466967_0009957_3886_4965 358
500 3300045976 Ga0466967_0033816 Ga0466967_0033816_3013_4092 358
501 3300046454 Ga0495592_0029277 Ga0495592_0029277_571_1650 358
502 3300046455 Ga0495603_0016731 Ga0495603_0016731_2061_3149 358
503 3300046455 Ga0495603_0048845 Ga0495603_0048845_1365_2444 358
504 3300046459 Ga0495629_0014235 Ga0495629_0014235_3202_4281 358
505 3300046459 Ga0495629_0018577 Ga0495629_0018577_2030_3109 358
506 3300046459 Ga0495629_0051936 Ga0495629_0051936_1704_2783 358
507 3300046459 Ga0495629_0070291 Ga0495629_0070291_588_1667 358
508 3300046459 Ga0495629_0153632 Ga0495629_0153632_83_1162 358
509 3300046460 Ga0495638_0032314 Ga0495638_0032314_708_1787 358
510 3300046462 Ga0495651_0177975 Ga0495651_0177975_77_1156 358
511 3300046473 Ga0495582_0043033 Ga0495582_0043033_696_1775 358
512 3300046473 Ga0495582_0073963 Ga0495582_0073963_110_1189 358
513 3300046474 Ga0495605_0012782 Ga0495605_0012782_2947_4026 358
514 3300046474 Ga0495605_0020240 Ga0495605_0020240_666_1745 358
515 3300046476 Ga0495662_0005123 Ga0495662_0005123_1942_3021 358
516 3300046476 Ga0495662_0010595 Ga0495662_0010595_2530_3609 358
517 3300046477 Ga0495664_0011486 Ga0495664_0011486_2571_3650 358
518 3300046499 Ga0495594_0012685 Ga0495594_0012685_2250_3338 358
519 3300046499 Ga0495594_0026491 Ga0495594_0026491_972_2051 358
520 3300046499 Ga0495594_0033733 Ga0495594_0033733_126_1205 358
521 3300046499 Ga0495594_0036254 Ga0495594_0036254_1565_2644 358
522 3300046501 Ga0495607_0150956 Ga0495607_0150956_72_1151 358
523 3300046511 Ga0495608_0054723 Ga0495608_0054723_805_1884 358
524 3300046512 Ga0495610_0049794 Ga0495610_0049794_470_1549 358
525 3300046513 Ga0495616_0017012 Ga0495616_0017012_808_1887 358
526 3300046515 Ga0495620_0011340 Ga0495620_0011340_596_1675 358
527 3300046516 Ga0495628_0027887 Ga0495628_0027887_1571_2650 358
528 3300046518 Ga0495631_0005294 Ga0495631_0005294_3262_4341 358
529 3300046520 Ga0495637_0027447 Ga0495637_0027447_1052_2131 358
530 3300046522 Ga0495643_0011246 Ga0495643_0011246_3563_4642 358
531 3300046524 Ga0495648_0033113 Ga0495648_0033113_1979_3058 358
532 3300046529 Ga0495652_0022853 Ga0495652_0022853_1188_2267 358
533 3300046530 Ga0495654_0012180 Ga0495654_0012180_2497_3576 358
534 3300046533 Ga0495640_0007645 Ga0495640_0007645_6228_7307 358
535 3300046538 Ga0495609_0010839 Ga0495609_0010839_1911_2990 358
536 3300046542 Ga0495597_0041673 Ga0495597_0041673_835_1914 358
537 3300046543 Ga0495645_0051369 Ga0495645_0051369_1111_2190 358
538 3300046558 Ga0495633_0052813 Ga0495633_0052813_20_1099 358
539 3300046559 Ga0495667_0092538 Ga0495667_0092538_818_1897 358
540 3300046616 Ga0495668_0073248 Ga0495668_0073248_636_1715 358
541 3300046616 Ga0495668_0143195 Ga0495668_0143195_198_1286 358
542 3300046642 Ga0495634_0001776 Ga0495634_0001776_13944_15023 358
543 3300046648 Ga0495611_0017431 Ga0495611_0017431_1328_2407 358
544 3300046660 Ga0495625_0026795 Ga0495625_0026795_446_1525 358
545 3300046660 Ga0495625_0078233 Ga0495625_0078233_27_1106 358
546 3300046660 Ga0495625_0191563 Ga0495625_0191563_158_1237 358
547 3300046663 Ga0495635_0000701 Ga0495635_0000701_7725_8804 358
548 3300046665 Ga0495661_0016076 Ga0495661_0016076_825_1904 358
549 3300046674 Ga0495588_0003754 Ga0495588_0003754_448_1527 358
550 3300046674 Ga0495588_0027033 Ga0495588_0027033_675_1754 358
551 3300046675 Ga0495657_0002809 Ga0495657_0002809_5610_6689 358
552 3300046675 Ga0495657_0016267 Ga0495657_0016267_3394_4473 358
553 3300046679 Ga0495623_0092392 Ga0495623_0092392_236_1315 358
554 3300046680 Ga0495646_0076248 Ga0495646_0076248_16_1095 358
555 3300046683 Ga0495658_0084553 Ga0495658_0084553_45_1124 358
556 3300046689 Ga0495613_0003082 Ga0495613_0003082_3541_4620 358
557 3300046689 Ga0495613_0009204 Ga0495613_0009204_2070_3149 358
558 3300046689 Ga0495613_0105546 Ga0495613_0105546_610_1689 358
559 3300046692 Ga0495671_0011019 Ga0495671_0011019_3173_4252 358
560 3300046694 Ga0495649_0028152 Ga0495649_0028152_1155_2234 358
561 3300046794 Ga0495589_0009062 Ga0495589_0009062_1504_2583 358
562 3300046794 Ga0495589_0021920 Ga0495589_0021920_383_1471 358
563 3300046794 Ga0495589_0022462 Ga0495589_0022462_809_1888 358
564 3300046809 Ga0495600_0065896 Ga0495600_0065896_1167_2246 358
565 3300047315 Ga0495581_0011020 Ga0495581_0011020_3501_4580 358
566 3300047315 Ga0495581_0102568 Ga0495581_0102568_244_1323 358
567 3300047315 Ga0495581_0126521 Ga0495581_0126521_394_1473 358
568 3300047317 Ga0495604_0002054 Ga0495604_0002054_6267_7346 358
569 3300047318 Ga0495636_0002978 Ga0495636_0002978_4282_5361 358
570 3300047318 Ga0495636_0008299 Ga0495636_0008299_982_2061 358
571 3300047318 Ga0495636_0065785 Ga0495636_0065785_205_1284 358
572 3300047318 Ga0495636_0097607 Ga0495636_0097607_190_1269 358
573 3300047319 Ga0495674_0125374 Ga0495674_0125374_236_1315 358
574 3300047321 Ga0495676_0001188 Ga0495676_0001188_10593_11672 358
575 3300047321 Ga0495676_0046759 Ga0495676_0046759_16_1095 358
576 3300047321 Ga0495676_0052646 Ga0495676_0052646_665_1744 358
577 3300047323 Ga0495683_0022666 Ga0495683_0022666_2129_3208 358
578 3300047443 Ga0495687_011722 Ga0495687_011722_3015_4094 358
579 3300047443 Ga0495687_016714 Ga0495687_016714_740_1819 358
580 3300047443 Ga0495687_037713 Ga0495687_037713_148_1227 358
581 3300047445 Ga0495677_0022038 Ga0495677_0022038_846_1925 358
582 3300047447 Ga0495685_012006 Ga0495685_012006_1277_2356 358
583 3300047470 Ga0495681_0048152 Ga0495681_0048152_595_1674 358
584 3300047471 Ga0495684_0053522 Ga0495684_0053522_485_1564 358
585 3300047673 Ga0495593_0011515 Ga0495593_0011515_3913_4992 358
586 3300048089 Ga0495614_0024349 Ga0495614_0024349_295_1374 358
587 3300048091 Ga0495626_0016013 Ga0495626_0016013_497_1576 358
588 3300048912 Ga0496109_0030590 Ga0496109_0030590_2311_3474 358
589 3300049568 Ga0501031_0006724 Ga0501031_0006724_2776_3855 358
590 3300049569 Ga0501032_0005448 Ga0501032_0005448_1391_2470 358
591 3300049569 Ga0501032_0035355 Ga0501032_0035355_1379_2458 358
592 3300049569 Ga0501032_0070984 Ga0501032_0070984_352_1431 358
593 3300049570 Ga0501033_0001923 Ga0501033_0001923_14194_15273 358
594 3300049570 Ga0501033_0024436 Ga0501033_0024436_912_1991 358
595 3300049571 Ga0501034_0007616 Ga0501034_0007616_5118_6197 358
596 3300049571 Ga0501034_0044899 Ga0501034_0044899_2760_3839 358
597 3300049572 Ga0501036_0030091 Ga0501036_0030091_936_2015 358
598 3300049573 Ga0501037_0006882 Ga0501037_0006882_1461_2540 358
599 3300049573 Ga0501037_0072369 Ga0501037_0072369_960_2039 358
600 3300049573 Ga0501037_0225256 Ga0501037_0225256_70_1149 358
601 3300049574 Ga0501038_0007747 Ga0501038_0007747_5118_6197 358
602 3300049574 Ga0501038_0027304 Ga0501038_0027304_3475_4554 358
603 3300049578 Ga0501042_0057353 Ga0501042_0057353_132_1211 358
604 3300049579 Ga0501043_0008709 Ga0501043_0008709_4470_5549 358
605 3300049579 Ga0501043_0011863 Ga0501043_0011863_1337_2416 358
606 3300049579 Ga0501043_0040479 Ga0501043_0040479_1206_2285 358
607 3300049580 Ga0501046_0005075 Ga0501046_0005075_7504_8583 358
608 3300049580 Ga0501046_0066638 Ga0501046_0066638_1525_2604 358
609 3300049581 Ga0501047_0035492 Ga0501047_0035492_3152_4231 358
610 3300049581 Ga0501047_0056484 Ga0501047_0056484_445_1524 358
611 3300049581 Ga0501047_0088998 Ga0501047_0088998_29_1108 358
612 3300049581 Ga0501047_0089514 Ga0501047_0089514_1847_2926 358
613 3300049581 Ga0501047_0102429 Ga0501047_0102429_74_1153 358
614 3300049582 Ga0501048_0001906 Ga0501048_0001906_7131_8210 358
615 3300049586 Ga0501070_0000534 Ga0501070_0000534_10923_12002 358
616 3300049586 Ga0501070_0176682 Ga0501070_0176682_609_1688 358
617 3300049586 Ga0501070_0199229 Ga0501070_0199229_483_1562 358
618 3300049590 Ga0501074_0013961 Ga0501074_0013961_333_1412 358
619 3300049742 Ga0501080_0048838 Ga0501080_0048838_2059_3138 358
620 3300049822 Ga0501035_0010126 Ga0501035_0010126_4426_5505 358
621 3300049822 Ga0501035_0033245 Ga0501035_0033245_2056_3135 358
622 3300049823 Ga0501044_0000847 Ga0501044_0000847_34662_35741 358
623 3300049823 Ga0501044_0005672 Ga0501044_0005672_3275_4354 358
624 3300049823 Ga0501044_0014121 Ga0501044_0014121_3680_4759 358
625 3300049823 Ga0501044_0038244 Ga0501044_0038244_825_1904 358
626 3300049823 Ga0501044_0059992 Ga0501044_0059992_1222_2301 358
627 3300050494 nmdc:mga06z11_3893_c1 nmdc:mga06z11_3893_c1_3395_4474 358
628 3300053088 Ga0500644_0052741 Ga0500644_0052741_114_1193 358
629 3300053096 Ga0500641_0032258 Ga0500641_0032258_584_1663 358
630 3300061719 Ga0466962_0000455 Ga0466962_0000455_5236_6315 358
631 3300061719 Ga0466962_0003816 Ga0466962_0003816_1836_2915 358
632 iso_pu_bacteria 2554235005 2554256443 358
633 iso_pu_bacteria 2582581314 2585320525 358
634 iso_pu_bacteria 2643221714 2644632881 358
635 iso_pu_bacteria 2784132148 2784590181 358
636 iso_pu_bacteria 2784746768 2785371234 358
637 iso_pu_bacteria 2808606375 2808913342 358
638 iso_pu_bacteria 2808606448 2809233853 358
639 iso_pu_bacteria 2811994879 2812356244 358
640 iso_pu_bacteria 2862290372 2862293899 358
641 iso_pu_bacteria 2946064051 2946069612 358
642 iso_pu_bacteria 2946072368 2946077510 358
643 iso_pu_bacteria 2954002825 2954005213 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

200

306

0.92

PF04389

Peptidase_M28

Peptidase family M28

87

193

0.86

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

101

392

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.8499 8 355
4q7a-assembly1.cif.gz_D-2 crystal structure of n-acetyl-ornithine/n-acetyl-lysine deacetylase from sphaerobacter thermophilus 0.8417 10 358
4q7a-assembly1.cif.gz_D-2 crystal structure of n-acetyl-ornithine/n-acetyl-lysine deacetylase from sphaerobacter thermophilus 0.8371 10 358
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8358 12 161
5xoy-assembly1.cif.gz_A-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.8327 10 355
ID Description Score Start End Superfamily
af_P9WHS9_166_276_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9871 171 280 3.40.630.10
af_P9WHS9_166_276_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9696 171 280 3.40.630.10
3tx8A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9289 7 358 3.40.630.10
3tx8A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9252 7 358 3.40.630.10
3ct9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8614 12 358 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A353ZV57-F1-model_v4 Succinyl-diaminopimelate desuccinylase 0.9809 154 333 GO:0006526
GO:0008777
AF-A0A353ZV57-F1-model_v4 Succinyl-diaminopimelate desuccinylase 0.9755 154 333 GO:0006526
GO:0008777
AF-A0A0S7CQ99-F1-model_v4 Putative succinyl-diaminopimelate desuccinylase DapE 0.9627 3 168 GO:0006526
GO:0008777
AF-A0A538TL39-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9477 12 356 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A3C2BQ81-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9446 4 160 GO:0006526
GO:0008777
GO:0009014

Feature Viewer

pLDDT pTM Quality
95.63 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map