F471996

General Info

Members Datasets Scaffolds Average Seq Length
643 511 341 173

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154107|2515608801
Length 203
Sequence RLSWLTGLRSNAFSARAVAAIAFSRAGGMDISNLGPILVLGGARSGKSTFAEKLVEATGSPMHYLATGRAFDEEMRERIALHQATRQGKGWTTHEEPLDLVGLLRRIDEPSRAVLIDCLTLWVTNLMMEERDMAAEFAALAAFLPAARSRLVFVSNEVGLGIVPENRMARDFRDHAGRLHQIVAEKSAEVYFVAAGLPLKMKG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
16 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
17 2516143018 Ensifer sp. BR816 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
20 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
21 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
22 2534681786 Brucella suis 92/29 Isolate Unclassified
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
25 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
26 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
27 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
28 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
29 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
30 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
31 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
32 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
33 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
34 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
35 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
36 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
37 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
38 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
39 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
40 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
41 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
42 2643221582 Rhizobium sp. Root651 Isolate Unclassified
43 2643221626 Ensifer sp. Root31 Isolate Unclassified
44 2643221629 Devosia sp. Root105 Isolate Unclassified
45 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
46 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
47 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
48 2643221655 Ensifer sp. Root1252 Isolate Unclassified
49 2643221662 Devosia sp. Root413D1 Isolate Unclassified
50 2643221688 Rhizobium sp. Root482 Isolate Unclassified
51 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
52 2643221698 Ensifer sp. Root142 Isolate Unclassified
53 2643221712 Ensifer sp. Root258 Isolate Unclassified
54 2643221718 Rhizobium sp. Root268 Isolate Unclassified
55 2643221719 Rhizobium sp. Root274 Isolate Unclassified
56 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
57 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
58 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
59 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
60 2718217882 Rhizobium sp. N741 Isolate Nodule
61 2718218009 Rhizobium sp. N561 Isolate Nodule
62 2718218363 Rhizobium sp. N113 Isolate Nodule
63 2718218365 Rhizobium sp. N731 Isolate Nodule
64 2718218366 Rhizobium sp. N621 Isolate Nodule
65 2721755514 Rhizobium sp. N6212 Isolate Nodule
66 2721755810 Rhizobium sp. N871 Isolate Nodule
67 2728369365 Rhizobium sp. N1341 Isolate Nodule
68 2728369397 Rhizobium sp. N1314 Isolate Nodule
69 2738541293 Rhizobium sp. GV031 Isolate Unclassified
70 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
71 2751185800 Brucella pituitosa AA2 Isolate Unclassified
72 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
73 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
74 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
75 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
76 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
77 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
78 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
79 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
80 2791355264 Rhizobium sp. S9 Isolate Nodule
81 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
82 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
83 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
84 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
85 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
86 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
87 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
88 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
89 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
90 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
91 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
92 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
93 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
94 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
95 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
96 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
97 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
98 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
99 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
100 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
101 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
102 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
103 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
104 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
105 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
106 2844163670 Ensifer sp. 1H6 Isolate Unclassified
107 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
108 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
109 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
110 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
111 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
112 2854911287 Brucella lupini LUP21 Isolate Unclassified
113 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
114 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
115 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
116 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
117 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
118 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
119 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
120 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
121 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
122 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
123 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
124 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
125 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
126 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
127 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
128 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
129 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
130 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
131 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
132 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
133 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
134 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
135 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
136 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
137 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
138 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
139 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
140 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
141 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
142 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
143 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
144 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
145 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
146 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
147 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
148 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
149 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
150 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
151 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
152 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
153 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
154 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
155 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
156 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
157 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
158 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
159 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
160 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
161 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
162 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
163 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
164 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
165 2932401849 Devosia sp. 2618 Isolate Rhizosphere
166 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
167 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
168 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
169 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
170 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
171 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
172 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
173 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
174 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
175 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
176 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
177 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
178 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
179 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
180 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
181 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
182 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
183 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
184 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
185 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
186 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
187 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
188 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
189 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
190 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
191 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
192 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
193 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
194 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
195 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
196 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
197 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
198 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
199 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
200 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
201 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
202 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
203 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
204 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
205 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
206 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
207 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
208 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
209 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
210 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
211 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
212 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
213 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
214 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
215 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
216 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
217 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
218 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
219 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
220 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
221 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
222 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
223 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
224 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
225 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
226 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
227 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
228 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
229 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
230 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
231 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
232 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
233 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
234 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
235 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
236 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
237 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
238 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
239 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
240 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
241 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
242 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
243 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
244 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
245 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
246 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
247 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
248 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
249 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
250 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
251 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
252 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
253 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
254 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
255 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
256 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
257 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
258 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
259 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
260 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
261 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
262 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
263 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
264 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
265 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
266 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
267 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
268 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
269 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
270 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
271 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
272 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
273 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
274 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
275 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
276 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
277 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
278 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
279 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
280 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
281 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
282 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
283 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
284 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
285 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
286 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
287 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
288 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
289 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
290 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
291 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
292 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
293 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
294 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
295 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
296 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
297 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
298 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
299 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
300 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
301 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
302 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
303 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
304 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
305 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
306 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
307 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
308 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
309 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
310 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
311 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
312 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
313 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
314 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
315 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
316 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
317 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
318 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
319 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
320 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
321 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
322 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
323 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
324 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
325 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
326 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
327 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
328 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
329 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
330 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
331 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
332 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
333 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
334 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
335 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
336 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
337 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
338 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
339 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
340 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
341 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
342 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
343 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
344 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
345 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
346 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
347 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
348 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
349 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
350 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
351 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
352 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
353 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
354 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
355 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
356 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
357 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
360 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
361 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
362 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
365 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
367 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
368 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
369 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
370 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
371 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
384 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
386 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
387 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
389 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
391 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
392 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
393 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
394 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
395 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
396 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
397 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
398 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
399 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
400 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
401 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
402 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
403 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
404 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
405 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
406 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
407 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
408 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
409 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
410 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
411 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
412 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
413 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
414 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
415 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
416 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
417 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
418 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
419 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
420 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
421 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
422 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
423 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
424 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
425 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
426 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
427 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
428 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
429 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
430 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
431 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
432 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
433 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
434 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
435 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
436 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
437 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
438 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
439 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
440 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
441 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
442 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
443 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
444 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
445 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
446 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
447 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
455 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
459 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
460 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
461 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
462 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
475 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
476 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
477 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
478 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
479 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
480 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
481 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
482 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
483 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
485 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
486 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
487 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
488 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
489 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
490 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
493 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
494 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
495 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
496 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
497 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
498 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
501 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
502 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
503 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
504 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
505 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
506 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
507 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
508 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
509 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
510 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
511 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.72
Metatranscriptomes 0.16
Isolates 47.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 40.12
Rhizoplane 1.56
Rhizosphere 28.77
Stem 0
Stem Tuber 0
Unclassified 18.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000033 3300001979 Bacteria 46151
2 JGI25152J39213_1002269 3300002773 Bacteria 7414
3 JGI25159J45721_1001112 3300002987 Bacteria 11487
4 JGI25165J46597_1000696 3300003214 Bacteria 26810
5 JGI25153J46596_10020129 3300003215 Bacteria 2531
6 rootH2_10023483 3300003320 Bacteria 6883
7 rootL2_10012458 3300003322 Bacteria 21837
8 rootH1_10018568 3300003316 Bacteria 10350
9 rootH1_10018568 3300003323 Bacteria 2750
10 rootH1_10018569 3300003323 Bacteria 4732
11 JGI25160J50197_1000087 3300003354 Bacteria 93379
12 JGI25161J50226_1000066 3300003374 Bacteria 94505
13 Ga0006562J51391_1010687 3300003578 Bacteria 3616
14 Ga0055526_1057715 3300003771 Bacteria 843
15 Ga0055524_1006319 3300003775 Bacteria 5152
16 Ga0055524_1009181 3300003775 Bacteria 4044
17 Ga0055536_1003640 3300003781 Bacteria 8210
18 Ga0055528_1000240 3300003790 Bacteria 45988
19 Ga0055528_1003572 3300003790 Bacteria 7753
20 Ga0055528_1015670 3300003790 Bacteria 2725
21 Ga0055531_10001342 3300003794 Bacteria 18368
22 Ga0058692_1013067 3300003856 Bacteria 1947
23 Ga0055543_1000068 3300004625 Bacteria 94795
24 Ga0065165_1001569 3300005262 Bacteria 23590
25 Ga0065165_1034983 3300005262 Bacteria 1547
26 Ga0065707_10169146 3300005295 Bacteria 1498
27 Ga0070680_100026616 3300005336 Bacteria 4626
28 Ga0070660_100013513 3300005339 Bacteria 5858
29 Ga0070668_100048809 3300005347 Bacteria 3256
30 Ga0070668_100068541 3300005347 Bacteria 2758
31 Ga0070671_100022521 3300005355 Bacteria 5145
32 Ga0070708_100190042 3300005445 Bacteria 1920
33 Ga0070708_100794777 3300005445 Bacteria 889
34 Ga0070698_100649076 3300005471 Bacteria 996
35 Ga0070695_100008823 3300005545 Bacteria 5990
36 Ga0070696_100377196 3300005546 Bacteria 1104
37 Ga0070693_100250696 3300005547 Bacteria 1173
38 Ga0068856_100002641 3300005614 Bacteria 18397
39 Ga0068858_100072943 3300005842 Bacteria 3186
40 Ga0068860_100012761 3300005843 Bacteria 8261
41 Ga0068862_100391522 3300005844 Bacteria 1298
42 Ga0075365_10154706 3300006038 Bacteria 1596
43 Ga0075368_10129294 3300006042 Bacteria 1049
44 Ga0075364_10130522 3300006051 Bacteria 1686
45 Ga0075367_10219016 3300006178 Bacteria 1191
46 Ga0075367_10588100 3300006178 Bacteria 707
47 Ga0075370_10029657 3300006353 Bacteria 3048
48 Ga0075370_10193449 3300006353 Bacteria 1199
49 Ga0075430_100017936 3300006846 Bacteria 6024
50 Ga0079104_1000129 3300006946 Bacteria 108427
51 Ga0079104_1001459 3300006946 Bacteria 15770
52 Ga0105251_10015236 3300009011 Bacteria 4213
53 Ga0111539_10000808 3300009094 Bacteria 40653
54 Ga0105245_10414773 3300009098 Bacteria 1348
55 Ga0105247_10399640 3300009101 Bacteria 979
56 Ga0114129_10781350 3300009147 Bacteria 1220
57 Ga0105248_10179766 3300009177 Bacteria 2384
58 Ga0105237_11027263 3300009545 Bacteria 831
59 Ga0105238_11884489 3300009551 Bacteria 631
60 Ga0105249_10166016 3300009553 Bacteria 2137
61 Ga0123342_1028101 3300009766 Bacteria 3072
62 Ga0157373_10010698 3300013100 Bacteria 6749
63 Ga0157373_10854115 3300013100 Bacteria 673
64 Ga0157370_10012918 3300013104 Bacteria 8631
65 Ga0157369_10020476 3300013105 Bacteria 7395
66 Ga0157369_10343297 3300013105 Bacteria 1551
67 Ga0157375_10709553 3300013308 Bacteria 1159
68 Ga0163161_10120638 3300017792 Bacteria 1970
69 Ga0214544_1001350 3300021320 Bacteria 50577
70 Ga0214542_1002270 3300021321 Bacteria 39851
71 Ga0214542_1032753 3300021321 Bacteria 1811
72 Ga0214543_1000028 3300021327 Bacteria 214029
73 Ga0214543_1000078 3300021327 Bacteria 119775
74 Ga0213872_10020506 3300021361 Bacteria 3047
75 Ga0213872_10096545 3300021361 Unclassified 1319
76 Ga0228711_1000016 3300022739 Bacteria 126351
77 Ga0228710_1000013 3300022740 Bacteria 145976
78 Ga0209436_111026 3300025208 Bacteria 1614
79 Ga0209437_100047 3300025233 Bacteria 405163
80 Ga0209437_100242 3300025233 Bacteria 89060
81 Ga0207425_1022977 3300025245 Bacteria 1309
82 Ga0209677_100811 3300025253 Bacteria 15626
83 Ga0209148_1008543 3300025254 Bacteria 2051
84 Ga0209759_1038149 3300025256 Bacteria 856
85 Ga0209129_1001218 3300025258 Bacteria 14786
86 Ga0209233_1000048 3300025261 Bacteria 453669
87 Ga0209233_1000069 3300025261 Bacteria 367639
88 Ga0209233_1000257 3300025261 Bacteria 80366
89 Ga0209455_1025527 3300025272 Bacteria 1073
90 Ga0209673_1000013 3300025273 Bacteria 571633
91 Ga0209673_1001931 3300025273 Bacteria 16424
92 Ga0209130_1000021 3300025284 Bacteria 374278
93 Ga0209130_1006021 3300025284 Bacteria 4036
94 Ga0209130_1040151 3300025284 Bacteria 907
95 Ga0209676_1017034 3300025292 Bacteria 2590
96 Ga0209025_1034688 3300025294 Bacteria 2297
97 Ga0209025_1035344 3300025294 Bacteria 2259
98 Ga0209564_1000525 3300025295 Bacteria 62651
99 Ga0209564_1014246 3300025295 Bacteria 3321
100 Ga0209758_1000418 3300025297 Bacteria 72150
101 Ga0209256_1000769 3300025299 Bacteria 41649
102 Ga0209256_1016176 3300025299 Bacteria 2560
103 Ga0209256_1035188 3300025299 Bacteria 1326
104 Ga0207426_1000010 3300025302 Bacteria 796003
105 Ga0207426_1000697 3300025302 Bacteria 40196
106 Ga0209051_1000482 3300025303 Bacteria 51474
107 Ga0209257_1001560 3300025304 Bacteria 26487
108 Ga0207713_1046512 3300025735 Bacteria 1764
109 Ga0207710_10203125 3300025900 Bacteria 979
110 Ga0207647_10481691 3300025904 Bacteria 693
111 Ga0207647_10507069 3300025904 Bacteria 672
112 Ga0207654_10223716 3300025911 Bacteria 1250
113 Ga0207671_10369841 3300025914 Bacteria 1138
114 Ga0207681_10019343 3300025923 Bacteria 4302
115 Ga0207711_10174914 3300025941 Bacteria 1950
116 Ga0207712_10436198 3300025961 Bacteria 1108
117 Ga0207702_10073460 3300026078 Bacteria 2949
118 Ga0207648_10193965 3300026089 Bacteria 1801
119 Ga0209281_1000036 3300027111 Bacteria 369415
120 Ga0209281_1000047 3300027111 Bacteria 326514
121 Ga0209281_1000221 3300027111 Bacteria 122380
122 Ga0209281_1000453 3300027111 Bacteria 58584
123 Ga0209371_1004612 3300027312 Bacteria 5889
124 Ga0209282_1000041 3300027666 Bacteria 122268
125 Ga0209813_10081388 3300027866 Bacteria 1071
126 Ga0209974_10044679 3300027876 Bacteria 1478
127 Ga0207428_10000009 3300027907 Bacteria 410565
128 Ga0268264_10016052 3300028381 Bacteria 6136
129 Ga0307515_10000023 3300028794 Bacteria 400846
130 Ga0268256_1007692 3300030500 Bacteria 3802
131 Ga0265332_10025030 3300031238 Bacteria 2624
132 Ga0265327_10000070 3300031251 Bacteria 217350
133 Ga0265316_10352382 3300031344 Bacteria 1065
134 Ga0307408_100223954 3300031548 Bacteria 1536
135 Ga0265313_10000289 3300031595 Bacteria 55172
136 Ga0316575_10001265 3300031665 Bacteria 8044
137 Ga0316575_10034973 3300031665 Bacteria 1975
138 Ga0316579_10022303 3300031691 Bacteria 2830
139 Ga0316579_10062690 3300031691 Bacteria 1751
140 Ga0265342_10424080 3300031712 Bacteria 685
141 Ga0316576_10017505 3300031727 Bacteria 4872
142 Ga0316578_10001973 3300031728 Bacteria 8701
143 Ga0307405_10132219 3300031731 Bacteria 1726
144 Ga0316577_10031459 3300031733 Bacteria 2965
145 Ga0316577_10033136 3300031733 Bacteria 2886
146 Ga0316577_10313460 3300031733 Unclassified 889
147 Ga0307406_10112792 3300031901 Bacteria 1875
148 Ga0315914_1000030 3300031967 Bacteria 102599
149 Ga0307416_100390402 3300032002 Bacteria 1426
150 Ga0316583_10050993 3300032133 Bacteria 1456
151 Ga0316585_10060585 3300032137 Bacteria 1223
152 Ga0315913_1000017 3300033430 Bacteria 102835
153 Ga0315915_1000017 3300033464 Bacteria 148111
154 Ga0316574_0001494 3300035398 Bacteria 11126
155 Ga0316574_0450970 3300035398 Bacteria 806
156 Ga0373931_0173387 3300035691 Bacteria 1272
157 Ga0316582_0001131 3300036647 Bacteria 11342
158 Ga0316582_0045510 3300036647 Bacteria 2763
159 Ga0316582_1201655 3300036647 Bacteria 516
160 Ga0316584_0006297 3300036712 Bacteria 8036
161 Ga0316584_0030352 3300036712 Unclassified 3993
162 Ga0395905_0348587 3300037471 Bacteria 1372
163 Ga0400484_34332 3300038725 Bacteria 2546
164 Ga0400485_08985 3300038735 Bacteria 1293
165 Ga0400485_09760 3300038735 Bacteria 1474
166 Ga0400485_13888 3300038735 Bacteria 11152
167 Ga0400485_14444 3300038735 Bacteria 17064
168 Ga0400488_37621 3300038741 Unclassified 1237
169 Ga0400486_01066 3300038742 Bacteria 2945
170 Ga0400486_20956 3300038742 Bacteria 32133
171 Ga0400486_32358 3300038742 Bacteria 29401
172 Ga0400483_008111 3300039062 Bacteria 5798
173 Ga0400483_115597 3300039062 Bacteria 85336
174 Ga0400483_209777 3300039062 Bacteria 96153
175 Ga0400483_267213 3300039062 Bacteria 13434
176 Ga0400489_47896 3300039093 Bacteria 141848
177 Ga0436361_0161023 3300039447 Bacteria 1782
178 Ga0436361_0561334 3300039447 Bacteria 1193
179 Ga0436361_0832657 3300039447 Bacteria 14978
180 Ga0436361_0950671 3300039447 Bacteria 6198
181 Ga0439436_0015279 3300041404 Bacteria 2310
182 Ga0439439_0136648 3300041406 Bacteria 690
183 Ga0439465_0101830 3300041413 Bacteria 992
184 Ga0439465_0107705 3300041413 Bacteria 967
185 Ga0439465_0122057 3300041413 Bacteria 914
186 Ga0451797_0074334 3300041453 Unclassified 588
187 Ga0439449_0103250 3300042007 Bacteria 1054
188 Ga0453683_0075801 3300044673 Bacteria 2106
189 Ga0453683_0081708 3300044673 Bacteria 2024
190 Ga0453683_0290551 3300044673 Bacteria 1045
191 Ga0466965_0518221 3300044683 Bacteria 670
192 Ga0453684_0026922 3300044712 Bacteria 8281
193 Ga0453684_0064960 3300044712 Bacteria 4657
194 Ga0453684_1698729 3300044712 Bacteria 645
195 Ga0466968_0194493 3300044735 Bacteria 948
196 Ga0466970_0088242 3300044765 Bacteria 1682
197 Ga0466960_0231792 3300044901 Bacteria 1019
198 Ga0451576_0002391 3300045051 Bacteria 28217
199 Ga0451576_0011293 3300045051 Bacteria 10163
200 Ga0451576_0025998 3300045051 Bacteria 6299
201 Ga0451576_1426064 3300045051 Bacteria 720
202 Ga0495638_0011275 3300046460 Bacteria 6163
203 Ga0495650_0000366 3300046471 Bacteria 79144
204 Ga0495650_0176115 3300046471 Bacteria 755
205 Ga0495607_0026748 3300046501 Bacteria 3576
206 Ga0495610_0000050 3300046512 Bacteria 143781
207 Ga0495620_0005714 3300046515 Bacteria 6922
208 Ga0495620_0013346 3300046515 Bacteria 4208
209 Ga0495632_0001157 3300046519 Bacteria 22489
210 Ga0495637_0259288 3300046520 Bacteria 624
211 Ga0495654_0000090 3300046530 Bacteria 101947
212 Ga0495654_0009926 3300046530 Bacteria 5204
213 Ga0495654_0113034 3300046530 Bacteria 1237
214 Ga0495681_0000089 3300047470 Bacteria 79789
215 Ga0495686_0429461 3300047472 Bacteria 705
216 Ga0496101_0136844 3300048904 Bacteria 1865
217 Ga0496103_0442879 3300048906 Bacteria 833
218 Ga0496104_0110495 3300048907 Bacteria 2635
219 Ga0496108_0418459 3300048911 Bacteria 1170
220 Ga0496110_0056117 3300048913 Bacteria 3466
221 Ga0496111_0009450 3300048914 Bacteria 6509
222 Ga0496116_0006432 3300048919 Bacteria 10651
223 Ga0496116_0163113 3300048919 Bacteria 1219
224 Ga0496116_0271797 3300048919 Bacteria 827
225 Ga0496116_0355149 3300048919 Bacteria 669
226 Ga0496117_0003168 3300048920 Bacteria 19553
227 Ga0496118_0013788 3300048921 Bacteria 7614
228 Ga0496118_0048747 3300048921 Bacteria 3267
229 Ga0496118_0063761 3300048921 Bacteria 2709
230 Ga0496118_0399519 3300048921 Bacteria 714
231 Ga0496119_0543010 3300048922 Bacteria 535
232 Ga0496120_0012911 3300048923 Bacteria 5654
233 Ga0496121_0000003 3300048924 Bacteria 1191431
234 Ga0496121_0006013 3300048924 Bacteria 15314
235 Ga0496121_0061739 3300048924 Bacteria 3073
236 Ga0496121_0318562 3300048924 Bacteria 1048
237 Ga0496122_0000369 3300048925 Bacteria 96672
238 Ga0496122_0009921 3300048925 Bacteria 9922
239 Ga0496122_0018405 3300048925 Bacteria 6457
240 Ga0496122_0038551 3300048925 Bacteria 3826
241 Ga0496122_0057563 3300048925 Bacteria 2885
242 Ga0496122_0072455 3300048925 Bacteria 2449
243 Ga0496122_0098639 3300048925 Bacteria 1961
244 Ga0496122_0106533 3300048925 Bacteria 1855
245 Ga0496123_0000054 3300048926 Bacteria 234046
246 Ga0496123_0013968 3300048926 Bacteria 6689
247 Ga0496123_0081075 3300048926 Bacteria 1974
248 Ga0496123_0091042 3300048926 Bacteria 1810
249 Ga0496123_0095793 3300048926 Bacteria 1745
250 Ga0496123_0124905 3300048926 Bacteria 1438
251 Ga0496124_0031324 3300048927 Bacteria 4709
252 Ga0496124_0036738 3300048927 Bacteria 4268
253 Ga0496124_0053148 3300048927 Bacteria 3436
254 Ga0496124_0077394 3300048927 Bacteria 2743
255 Ga0496124_0144917 3300048927 Bacteria 1870
256 Ga0496124_0233883 3300048927 Bacteria 1372
257 Ga0496124_0414374 3300048927 Unclassified 931
258 Ga0496124_0545709 3300048927 Unclassified 766
259 Ga0496125_0000141 3300048928 Bacteria 158991
260 Ga0496125_0014104 3300048928 Bacteria 7803
261 Ga0496125_0026229 3300048928 Bacteria 5315
262 Ga0496125_0153737 3300048928 Bacteria 1575
263 Ga0496125_0272894 3300048928 Bacteria 1052
264 Ga0496125_0314611 3300048928 Bacteria 952
265 Ga0496126_0129612 3300048929 Bacteria 2180
266 Ga0496126_0130587 3300048929 Bacteria 2171
267 Ga0496126_0352996 3300048929 Bacteria 1202
268 Ga0496126_0880577 3300048929 Unclassified 680
269 Ga0501031_0071975 3300049568 Bacteria 2251
270 Ga0501031_0624978 3300049568 Bacteria 693
271 Ga0501033_0393006 3300049570 Bacteria 968
272 Ga0501034_0014024 3300049571 Bacteria 8252
273 Ga0501034_0279145 3300049571 Bacteria 1610
274 Ga0501034_0402831 3300049571 Bacteria 1291
275 Ga0501034_0752943 3300049571 Bacteria 869
276 Ga0501034_1111284 3300049571 Bacteria 671
277 Ga0501036_0150650 3300049572 Bacteria 1962
278 Ga0501038_0014889 3300049574 Bacteria 7082
279 Ga0501039_0178789 3300049575 Bacteria 1669
280 Ga0501039_0632427 3300049575 Bacteria 838
281 Ga0501040_0012992 3300049576 Bacteria 5474
282 Ga0501040_0063714 3300049576 Bacteria 2537
283 Ga0501040_0237068 3300049576 Bacteria 1300
284 Ga0501041_0012634 3300049577 Bacteria 5002
285 Ga0501043_0039275 3300049579 Bacteria 3720
286 Ga0501043_0620397 3300049579 Bacteria 797
287 Ga0501046_0192557 3300049580 Bacteria 1520
288 Ga0501047_0419942 3300049581 Bacteria 1169
289 Ga0501048_0190796 3300049582 Bacteria 1452
290 Ga0501068_0259740 3300049584 Bacteria 1108
291 Ga0501072_0058356 3300049588 Bacteria 3042
292 Ga0501075_0015393 3300049591 Bacteria 5489
293 Ga0501075_0511395 3300049591 Bacteria 916
294 Ga0501076_0000325 3300049592 Bacteria 29487
295 Ga0501077_0040711 3300049593 Bacteria 2959
296 Ga0501077_0113530 3300049593 Bacteria 1718
297 Ga0501077_0154182 3300049593 Bacteria 1458
298 Ga0501079_0009896 3300049741 Bacteria 7234
299 Ga0501079_0161934 3300049741 Bacteria 1745
300 Ga0501080_0174954 3300049742 Bacteria 1978
301 Ga0501080_0346451 3300049742 Bacteria 1342
302 Ga0501081_0008841 3300049743 Bacteria 6548
303 Ga0501081_0448213 3300049743 Bacteria 959
304 Ga0501083_0162804 3300049744 Bacteria 1459
305 Ga0501044_0065074 3300049823 Bacteria 3719
306 Ga0501044_0085303 3300049823 Bacteria 3191
307 Ga0501044_0763049 3300049823 Bacteria 849
308 Ga0501045_0026887 3300049824 Bacteria 4141
309 Ga0501045_0236975 3300049824 Bacteria 1358
310 Ga0501045_0657892 3300049824 Bacteria 774
311 nmdc:mga0yw44_547207_c1 3300050492 Bacteria 786
312 nmdc:mga06z11_563240_c1 3300050494 Bacteria 692
313 nmdc:mga07m45_438538_c1 3300050496 Bacteria 757
314 nmdc:mga05p37_287628_c1 3300050507 Bacteria 1957
315 nmdc:mga08x19_16479_c1 3300050514 Bacteria 4507
316 Ga0500643_000822 3300053087 Bacteria 20046
317 Ga0500643_034811 3300053087 Bacteria 1514
318 Ga0500608_022277 3300053122 Bacteria 2936
319 Ga0500608_042044 3300053122 Bacteria 2193
320 Ga0500618_001774 3300053125 Bacteria 9129
321 Ga0500618_014282 3300053125 Bacteria 2031
322 Ga0500618_095206 3300053125 Bacteria 669
323 Ga0500568_0203370 3300053139 Bacteria 725
324 Ga0500573_0000901 3300053140 Bacteria 13488
325 Ga0500616_0059101 3300053153 Bacteria 1992
326 Ga0500616_0070061 3300053153 Bacteria 1791
327 Ga0500616_0141227 3300053153 Bacteria 1125
328 Ga0500622_0056204 3300053156 Bacteria 2015
329 Ga0500627_0090770 3300053158 Bacteria 1367
330 Ga0500627_0220366 3300053158 Bacteria 847
331 Ga0500634_0053005 3300053161 Bacteria 2177
332 Ga0501084_0005047 3300054114 Bacteria 10801
333 Ga0501082_0127919 3300060353 Bacteria 2203
334 Ga0501082_0145933 3300060353 Bacteria 2054
335 Ga0501082_0158898 3300060353 Bacteria 1964
336 Ga0501082_0174882 3300060353 Bacteria 1867
337 Ga0501082_1128965 3300060353 Bacteria 685
338 Ga0530510_0003753 3300061734 Bacteria 10455
339 Ga0530510_0011223 3300061734 Bacteria 6285
340 Ga0530510_0068615 3300061734 Bacteria 2572
341 Ga0530510_0281033 3300061734 Bacteria 1243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0107705 Ga0439465_0107705_320_937 140
2 3300049572 Ga0501036_0150650 Ga0501036_0150650_473_955 140
3 3300049574 Ga0501038_0014889 Ga0501038_0014889_968_1450 140
4 3300049576 Ga0501040_0012992 Ga0501040_0012992_680_1162 140
5 3300049577 Ga0501041_0012634 Ga0501041_0012634_2354_2836 140
6 3300049579 Ga0501043_0039275 Ga0501043_0039275_652_1134 140
7 3300049580 Ga0501046_0192557 Ga0501046_0192557_730_1212 140
8 3300049588 Ga0501072_0058356 Ga0501072_0058356_2173_2655 140
9 3300049591 Ga0501075_0015393 Ga0501075_0015393_714_1196 140
10 3300049592 Ga0501076_0000325 Ga0501076_0000325_21627_22109 140
11 3300049593 Ga0501077_0040711 Ga0501077_0040711_712_1194 140
12 3300049741 Ga0501079_0009896 Ga0501079_0009896_5364_5846 140
13 3300049742 Ga0501080_0174954 Ga0501080_0174954_1285_1767 140
14 3300049743 Ga0501081_0008841 Ga0501081_0008841_772_1254 140
15 3300049744 Ga0501083_0162804 Ga0501083_0162804_693_1175 140
16 3300049824 Ga0501045_0026887 Ga0501045_0026887_3108_3590 140
17 3300054114 Ga0501084_0005047 Ga0501084_0005047_9574_10056 140
18 3300060353 Ga0501082_0127919 Ga0501082_0127919_1430_1912 140
19 3300061734 Ga0530510_0003753 Ga0530510_0003753_801_1283 140
20 3300049571 Ga0501034_1111284 Ga0501034_1111284_16_504 147
21 3300036647 Ga0316582_1201655 Ga0316582_1201655_29_496 151
22 3300003320 rootH2_10023483 rootH2_100234833 156
23 3300038735 Ga0400485_09760 Ga0400485_09760_899_1420 161
24 3300035691 Ga0373931_0173387 Ga0373931_0173387_225_743 163
25 3300021361 Ga0213872_10020506 Ga0213872_100205064 164
26 3300039447 Ga0436361_0950671 Ga0436361_0950671_4013_4507 164
27 3300048922 Ga0496119_0543010 Ga0496119_0543010_20_514 164
28 3300049823 Ga0501044_0065074 Ga0501044_0065074_310_876 164
29 iso_pu_bacteria 2687453129 2687579044 164
30 3300031251 Ga0265327_10000070 Ga0265327_1000007097 165
31 3300044712 Ga0453684_0064960 Ga0453684_0064960_4057_4563 165
32 3300045051 Ga0451576_1426064 Ga0451576_1426064_132_638 165
33 iso_pu_bacteria 2643221629 2644165849 165
34 iso_pu_bacteria 2643221662 2644348493 165
35 iso_pu_bacteria 2718217882 2719181339 165
36 iso_pu_bacteria 2718218009 2719732088 165
37 iso_pu_bacteria 2718218363 2721147433 165
38 iso_pu_bacteria 2718218365 2721158966 165
39 iso_pu_bacteria 2718218366 2721164351 165
40 iso_pu_bacteria 2721755514 2722840521 165
41 iso_pu_bacteria 2721755810 2724044844 165
42 iso_pu_bacteria 2728369365 2730164576 165
43 iso_pu_bacteria 2728369397 2730298598 165
44 iso_pu_bacteria 2791355264 2793349957 165
45 3300009147 Ga0114129_10781350 Ga0114129_107813501 166
46 3300021361 Ga0213872_10096545 Ga0213872_100965452 166
47 3300039447 Ga0436361_0161023 Ga0436361_0161023_804_1304 166
48 3300039447 Ga0436361_0832657 Ga0436361_0832657_10486_10986 166
49 3300044712 Ga0453684_0026922 Ga0453684_0026922_6841_7356 166
50 3300050507 nmdc:mga05p37_287628_c1 nmdc:mga05p37_287628_c1_254_766 166
51 iso_pu_bacteria 2643221643 2644239714 166
52 iso_pu_bacteria 2738541293 2738804176 166
53 iso_pu_bacteria 2740891818 2740994510 166
54 iso_pu_bacteria 2932401849 2932404484 166
55 3300031238 Ga0265332_10025030 Ga0265332_100250302 167
56 3300031595 Ga0265313_10000289 Ga0265313_1000028933 167
57 3300044673 Ga0453683_0075801 Ga0453683_0075801_367_888 167
58 3300044673 Ga0453683_0081708 Ga0453683_0081708_289_810 167
59 3300044673 Ga0453683_0290551 Ga0453683_0290551_401_922 167
60 3300045051 Ga0451576_0002391 Ga0451576_0002391_12031_12552 167
61 3300045051 Ga0451576_0011293 Ga0451576_0011293_371_892 167
62 3300045051 Ga0451576_0025998 Ga0451576_0025998_76_597 167
63 3300049576 Ga0501040_0237068 Ga0501040_0237068_594_1157 167
64 3300049593 Ga0501077_0113530 Ga0501077_0113530_302_868 167
65 3300049593 Ga0501077_0154182 Ga0501077_0154182_665_1189 167
66 3300049741 Ga0501079_0161934 Ga0501079_0161934_400_963 167
67 3300049743 Ga0501081_0448213 Ga0501081_0448213_425_949 167
68 3300061734 Ga0530510_0281033 Ga0530510_0281033_147_713 167
69 iso_pu_bacteria 2643221637 2644210196 167
70 iso_pu_bacteria 2643221718 2644653748 167
71 iso_pu_bacteria 2791355253 2793279963 167
72 iso_pu_bacteria 2837678835 2837681337 167
73 3300005295 Ga0065707_10169146 Ga0065707_101691462 168
74 3300005336 Ga0070680_100026616 Ga0070680_1000266165 168
75 3300005347 Ga0070668_100068541 Ga0070668_1000685413 168
76 3300005445 Ga0070708_100190042 Ga0070708_1001900423 168
77 3300005445 Ga0070708_100794777 Ga0070708_1007947771 168
78 3300005471 Ga0070698_100649076 Ga0070698_1006490761 168
79 3300005842 Ga0068858_100072943 Ga0068858_1000729432 168
80 3300005843 Ga0068860_100012761 Ga0068860_1000127618 168
81 3300006846 Ga0075430_100017936 Ga0075430_1000179362 168
82 3300009094 Ga0111539_10000808 Ga0111539_1000080835 168
83 3300013308 Ga0157375_10709553 Ga0157375_107095532 168
84 3300025911 Ga0207654_10223716 Ga0207654_102237162 168
85 3300025923 Ga0207681_10019343 Ga0207681_100193433 168
86 3300026089 Ga0207648_10193965 Ga0207648_101939652 168
87 3300027907 Ga0207428_10000009 Ga0207428_10000009348 168
88 3300028381 Ga0268264_10016052 Ga0268264_100160528 168
89 3300031344 Ga0265316_10352382 Ga0265316_103523822 168
90 3300031712 Ga0265342_10424080 Ga0265342_104240802 168
91 3300031733 Ga0316577_10313460 Ga0316577_103134602 168
92 3300032137 Ga0316585_10060585 Ga0316585_100605852 168
93 3300038735 Ga0400485_13888 Ga0400485_13888_5427_5945 168
94 3300038742 Ga0400486_20956 Ga0400486_20956_8795_9313 168
95 3300048904 Ga0496101_0136844 Ga0496101_0136844_693_1250 168
96 3300048919 Ga0496116_0006432 Ga0496116_0006432_3999_4505 168
97 3300048920 Ga0496117_0003168 Ga0496117_0003168_16941_17447 168
98 3300048921 Ga0496118_0013788 Ga0496118_0013788_312_818 168
99 3300049576 Ga0501040_0063714 Ga0501040_0063714_1799_2362 168
100 3300049591 Ga0501075_0511395 Ga0501075_0511395_318_881 168
101 3300049824 Ga0501045_0236975 Ga0501045_0236975_627_1190 168
102 3300053087 Ga0500643_034811 Ga0500643_034811_300_806 168
103 3300060353 Ga0501082_0158898 Ga0501082_0158898_245_808 168
104 3300061734 Ga0530510_0011223 Ga0530510_0011223_2843_3409 168
105 3300061734 Ga0530510_0068615 Ga0530510_0068615_1201_1764 168
106 3300003790 Ga0055528_1015670 Ga0055528_10156703 169
107 3300006353 Ga0075370_10193449 Ga0075370_101934491 169
108 3300009101 Ga0105247_10399640 Ga0105247_103996402 169
109 3300025900 Ga0207710_10203125 Ga0207710_102031252 169
110 3300031665 Ga0316575_10034973 Ga0316575_100349732 169
111 3300031733 Ga0316577_10033136 Ga0316577_100331362 169
112 3300038725 Ga0400484_34332 Ga0400484_34332_841_1362 169
113 3300038735 Ga0400485_08985 Ga0400485_08985_435_956 169
114 3300038735 Ga0400485_14444 Ga0400485_14444_13086_13607 169
115 3300038741 Ga0400488_37621 Ga0400488_37621_460_981 169
116 3300038742 Ga0400486_01066 Ga0400486_01066_1722_2243 169
117 3300038742 Ga0400486_32358 Ga0400486_32358_17701_18222 169
118 3300039062 Ga0400483_115597 Ga0400483_115597_29539_30060 169
119 3300039062 Ga0400483_209777 Ga0400483_209777_51942_52463 169
120 3300039093 Ga0400489_47896 Ga0400489_47896_93023_93544 169
121 3300041413 Ga0439465_0101830 Ga0439465_0101830_343_900 169
122 3300044683 Ga0466965_0518221 Ga0466965_0518221_16_573 169
123 3300046471 Ga0495650_0000366 Ga0495650_0000366_15810_16319 169
124 3300046512 Ga0495610_0000050 Ga0495610_0000050_15744_16253 169
125 3300046515 Ga0495620_0005714 Ga0495620_0005714_5885_6394 169
126 3300046515 Ga0495620_0013346 Ga0495620_0013346_2137_2646 169
127 3300046519 Ga0495632_0001157 Ga0495632_0001157_6172_6681 169
128 3300046520 Ga0495637_0259288 Ga0495637_0259288_19_528 169
129 3300046530 Ga0495654_0009926 Ga0495654_0009926_2726_3235 169
130 3300047470 Ga0495681_0000089 Ga0495681_0000089_63471_63980 169
131 3300048919 Ga0496116_0355149 Ga0496116_0355149_92_613 169
132 3300048921 Ga0496118_0048747 Ga0496118_0048747_2690_3211 169
133 3300048921 Ga0496118_0399519 Ga0496118_0399519_77_586 169
134 3300048927 Ga0496124_0233883 Ga0496124_0233883_93_626 169
135 3300048929 Ga0496126_0130587 Ga0496126_0130587_91_648 169
136 3300049571 Ga0501034_0402831 Ga0501034_0402831_142_699 169
137 3300049582 Ga0501048_0190796 Ga0501048_0190796_568_1077 169
138 3300049823 Ga0501044_0763049 Ga0501044_0763049_206_763 169
139 3300050496 nmdc:mga07m45_438538_c1 nmdc:mga07m45_438538_c1_151_708 169
140 3300053087 Ga0500643_000822 Ga0500643_000822_11726_12265 169
141 3300053158 Ga0500627_0090770 Ga0500627_0090770_148_702 169
142 iso_pu_bacteria 2510917026 2511169996 169
143 iso_pu_bacteria 2534681786 2535485018 169
144 iso_pu_bacteria 2600254933 2600375686 169
145 iso_pu_bacteria 2643221582 2643919249 169
146 iso_pu_bacteria 2643221626 2644148673 169
147 iso_pu_bacteria 2643221655 2644309049 169
148 iso_pu_bacteria 2643221688 2644491827 169
149 iso_pu_bacteria 2643221698 2644545950 169
150 iso_pu_bacteria 2643221712 2644614991 169
151 iso_pu_bacteria 2775507049 2776913594 169
152 iso_pu_bacteria 2818991461 2819684768 169
153 iso_pu_bacteria 2821123053 2821129449 169
154 iso_pu_bacteria 2838736955 2838738518 169
155 iso_pu_bacteria 2841840854 2841841113 169
156 iso_pu_bacteria 2842140634 2842140891 169
157 iso_pu_bacteria 2844163670 2844167801 169
158 iso_pu_bacteria 2854896431 2854899376 169
159 iso_pu_bacteria 2854911287 2854912276 169
160 iso_pu_bacteria 2854916844 2854917988 169
161 iso_pu_bacteria 2857531043 2857535148 169
162 iso_pu_bacteria 2919171160 2919174941 169
163 iso_pu_bacteria 2929138655 2929140644 169
164 3300003578 Ga0006562J51391_1010687 Ga0006562J51391_10106874 170
165 3300005339 Ga0070660_100013513 Ga0070660_1000135134 170
166 3300005545 Ga0070695_100008823 Ga0070695_1000088232 170
167 3300005546 Ga0070696_100377196 Ga0070696_1003771962 170
168 3300005547 Ga0070693_100250696 Ga0070693_1002506962 170
169 3300009098 Ga0105245_10414773 Ga0105245_104147733 170
170 3300009545 Ga0105237_11027263 Ga0105237_110272632 170
171 3300025294 Ga0209025_1034688 Ga0209025_10346883 170
172 3300025914 Ga0207671_10369841 Ga0207671_103698412 170
173 3300027876 Ga0209974_10044679 Ga0209974_100446793 170
174 3300031665 Ga0316575_10001265 Ga0316575_100012658 170
175 3300031691 Ga0316579_10022303 Ga0316579_100223034 170
176 3300031691 Ga0316579_10062690 Ga0316579_100626904 170
177 3300031727 Ga0316576_10017505 Ga0316576_100175052 170
178 3300031728 Ga0316578_10001973 Ga0316578_100019732 170
179 3300031733 Ga0316577_10031459 Ga0316577_100314594 170
180 3300032133 Ga0316583_10050993 Ga0316583_100509933 170
181 3300035398 Ga0316574_0001494 Ga0316574_0001494_10293_10832 170
182 3300035398 Ga0316574_0450970 Ga0316574_0450970_32_571 170
183 3300036647 Ga0316582_0001131 Ga0316582_0001131_10793_11332 170
184 3300036647 Ga0316582_0045510 Ga0316582_0045510_1450_1974 170
185 3300036712 Ga0316584_0006297 Ga0316584_0006297_6828_7367 170
186 3300036712 Ga0316584_0030352 Ga0316584_0030352_1238_1762 170
187 3300039447 Ga0436361_0561334 Ga0436361_0561334_414_929 170
188 3300041453 Ga0451797_0074334 Ga0451797_0074334_16_576 170
189 3300044712 Ga0453684_1698729 Ga0453684_1698729_60_596 170
190 3300044735 Ga0466968_0194493 Ga0466968_0194493_288_833 170
191 3300044901 Ga0466960_0231792 Ga0466960_0231792_241_762 170
192 3300048924 Ga0496121_0061739 Ga0496121_0061739_2080_2592 170
193 3300049568 Ga0501031_0071975 Ga0501031_0071975_1548_2084 170
194 3300049575 Ga0501039_0178789 Ga0501039_0178789_1051_1587 170
195 3300049742 Ga0501080_0346451 Ga0501080_0346451_223_759 170
196 3300049824 Ga0501045_0657892 Ga0501045_0657892_81_593 170
197 3300053153 Ga0500616_0059101 Ga0500616_0059101_475_1026 170
198 3300053161 Ga0500634_0053005 Ga0500634_0053005_621_1142 170
199 3300060353 Ga0501082_0145933 Ga0501082_0145933_1176_1688 170
200 3300060353 Ga0501082_0174882 Ga0501082_0174882_655_1191 170
201 iso_pu_bacteria 2508501122 2509111424 170
202 iso_pu_bacteria 2509276019 2509375635 170
203 iso_pu_bacteria 2510065057 2510303255 170
204 iso_pu_bacteria 2511231052 2511502008 170
205 iso_pu_bacteria 2512047086 2512533378 170
206 iso_pu_bacteria 2512875026 2512971054 170
207 iso_pu_bacteria 2513237086 2513582596 170
208 iso_pu_bacteria 2513237089 2513604589 170
209 iso_pu_bacteria 2513237091 2513615502 170
210 iso_pu_bacteria 2513237140 2513881291 170
211 iso_pu_bacteria 2513237143 2513902422 170
212 iso_pu_bacteria 2513237146 2513926036 170
213 iso_pu_bacteria 2513237156 2513984555 170
214 iso_pu_bacteria 2513237160 2514007641 170
215 iso_pu_bacteria 2516143018 2516209739 170
216 iso_pu_bacteria 2516653046 2516893304 170
217 iso_pu_bacteria 2517487022 2517570062 170
218 iso_pu_bacteria 2524023207 2524448794 170
219 iso_pu_bacteria 2524023209 2524459409 170
220 iso_pu_bacteria 2534681796 2535516638 170
221 iso_pu_bacteria 2551306084 2551675118 170
222 iso_pu_bacteria 2551306084 2551680556 170
223 iso_pu_bacteria 2551306085 2551688088 170
224 iso_pu_bacteria 2551306086 2551691102 170
225 iso_pu_bacteria 2551306087 2551704454 170
226 iso_pu_bacteria 2551306089 2551709591 170
227 iso_pu_bacteria 2551306090 2551722474 170
228 iso_pu_bacteria 2551306091 2551727336 170
229 iso_pu_bacteria 2551306092 2551735305 170
230 iso_pu_bacteria 2551306093 2551741817 170
231 iso_pu_bacteria 2558860100 2558867950 170
232 iso_pu_bacteria 2582581299 2585229861 170
233 iso_pu_bacteria 2582581867 2585404362 170
234 iso_pu_bacteria 2585427527 2585533932 170
235 iso_pu_bacteria 2585427590 2585821938 170
236 iso_pu_bacteria 2599185170 2599417512 170
237 iso_pu_bacteria 2615840698 2616556985 170
238 iso_pu_bacteria 2643221653 2644300272 170
239 iso_pu_bacteria 2643221689 2644501383 170
240 iso_pu_bacteria 2643221719 2644658498 170
241 iso_pu_bacteria 2657244999 2657681254 170
242 iso_pu_bacteria 2667528174 2671111591 170
243 iso_pu_bacteria 2690316117 2692315805 170
244 iso_pu_bacteria 2751185821 2753461903 170
245 iso_pu_bacteria 2775507266 2778175276 170
246 iso_pu_bacteria 2791355082 2792581692 170
247 iso_pu_bacteria 2791355091 2792620201 170
248 iso_pu_bacteria 2791355092 2792626379 170
249 iso_pu_bacteria 2791355094 2792639325 170
250 iso_pu_bacteria 2802428858 2802719556 170
251 iso_pu_bacteria 2802428859 2802726850 170
252 iso_pu_bacteria 2802428860 2802732290 170
253 iso_pu_bacteria 2802428861 2802739893 170
254 iso_pu_bacteria 2802428862 2802745399 170
255 iso_pu_bacteria 2802428863 2802752791 170
256 iso_pu_bacteria 2802429268 2804752452 170
257 iso_pu_bacteria 2818991272 2819242110 170
258 iso_pu_bacteria 2818991448 2819608992 170
259 iso_pu_bacteria 2838029111 2838029962 170
260 iso_pu_bacteria 2838035591 2838038275 170
261 iso_pu_bacteria 2838074704 2838079549 170
262 iso_pu_bacteria 2838661181 2838661848 170
263 iso_pu_bacteria 2842298080 2842301187 170
264 iso_pu_bacteria 2842357229 2842357634 170
265 iso_pu_bacteria 2842475841 2842476753 170
266 iso_pu_bacteria 2842502639 2842503490 170
267 iso_pu_bacteria 2842509118 2842511294 170
268 iso_pu_bacteria 2842922631 2842924011 170
269 iso_pu_bacteria 2847417321 2847419131 170
270 iso_pu_bacteria 2848992105 2848994160 170
271 iso_pu_bacteria 2850079185 2850081190 170
272 iso_pu_bacteria 2852387548 2852390039 170
273 iso_pu_bacteria 2855825444 2855826027 170
274 iso_pu_bacteria 2855839649 2855841372 170
275 iso_pu_bacteria 2855872281 2855876803 170
276 iso_pu_bacteria 2858800743 2858802358 170
277 iso_pu_bacteria 2894652903 2894656144 170
278 iso_pu_bacteria 2896384573 2896384893 170
279 iso_pu_bacteria 2899803654 2899809066 170
280 iso_pu_bacteria 2913295892 2913300792 170
281 iso_pu_bacteria 2915980308 2915981850 170
282 iso_pu_bacteria 2915986958 2915990045 170
283 iso_pu_bacteria 2915993759 2915994326 170
284 iso_pu_bacteria 2916000859 2916004347 170
285 iso_pu_bacteria 2916007675 2916012436 170
286 iso_pu_bacteria 2916014648 2916017733 170
287 iso_pu_bacteria 2916021584 2916024196 170
288 iso_pu_bacteria 2916028427 2916031729 170
289 iso_pu_bacteria 2916035215 2916041309 170
290 iso_pu_bacteria 2916041962 2916045242 170
291 iso_pu_bacteria 2916048683 2916052314 170
292 iso_pu_bacteria 2916055098 2916056398 170
293 iso_pu_bacteria 2916061851 2916067536 170
294 iso_pu_bacteria 2916068649 2916074900 170
295 iso_pu_bacteria 2916076590 2916077387 170
296 iso_pu_bacteria 2919408235 2919411562 170
297 iso_pu_bacteria 2920760137 2920765751 170
298 iso_pu_bacteria 2921201388 2921205509 170
299 iso_pu_bacteria 2921208531 2921213179 170
300 iso_pu_bacteria 2921237296 2921240762 170
301 iso_pu_bacteria 2921244191 2921244673 170
302 iso_pu_bacteria 2921250672 2921251132 170
303 iso_pu_bacteria 2921257292 2921259530 170
304 iso_pu_bacteria 2921263974 2921265077 170
305 iso_pu_bacteria 2921282425 2921283534 170
306 iso_pu_bacteria 2921289301 2921293686 170
307 iso_pu_bacteria 2921296804 2921299329 170
308 iso_pu_bacteria 2924144063 2924147137 170
309 iso_pu_bacteria 2924150972 2924155219 170
310 iso_pu_bacteria 2924158325 2924160804 170
311 iso_pu_bacteria 2924165586 2924167380 170
312 iso_pu_bacteria 2924172951 2924179021 170
313 iso_pu_bacteria 2924179722 2924184109 170
314 iso_pu_bacteria 2924186466 2924189030 170
315 iso_pu_bacteria 2924193448 2924194757 170
316 iso_pu_bacteria 2924200457 2924203395 170
317 iso_pu_bacteria 2924207177 2924208870 170
318 iso_pu_bacteria 2924214083 2924219147 170
319 iso_pu_bacteria 2924221636 2924227232 170
320 iso_pu_bacteria 2924228884 2924229911 170
321 iso_pu_bacteria 2937002841 2937005103 170
322 iso_pu_bacteria 2937009748 2937012169 170
323 iso_pu_bacteria 2937016420 2937018672 170
324 iso_pu_bacteria 2937023124 2937029011 170
325 iso_pu_bacteria 2937029754 2937031317 170
326 iso_pu_bacteria 2937036028 2937038543 170
327 iso_pu_bacteria 2937042894 2937047315 170
328 iso_pu_bacteria 2937049772 2937050910 170
329 iso_pu_bacteria 2937056579 2937061757 170
330 iso_pu_bacteria 2937063883 2937065189 170
331 iso_pu_bacteria 2937071275 2937073087 170
332 iso_pu_bacteria 2937078374 2937079838 170
333 iso_pu_bacteria 2937084907 2937087040 170
334 iso_pu_bacteria 2937091812 2937096221 170
335 iso_pu_bacteria 2937098957 2937099576 170
336 iso_pu_bacteria 2937106411 2937110047 170
337 iso_pu_bacteria 2937113482 2937116230 170
338 iso_pu_bacteria 2937119839 2937123040 170
339 iso_pu_bacteria 2937126314 2937128747 170
340 iso_pu_bacteria 2957375807 2957376624 170
341 iso_pu_bacteria 2957382221 2957384841 170
342 iso_pu_bacteria 2957388812 2957394884 170
343 iso_pu_bacteria 2957395598 2957398231 170
344 iso_pu_bacteria 2957402308 2957403167 170
345 iso_pu_bacteria 2957408893 2957411560 170
346 iso_pu_bacteria 2957415311 2957418288 170
347 iso_pu_bacteria 2957422303 2957422474 170
348 iso_pu_bacteria 2957430029 2957432838 170
349 iso_pu_bacteria 2957437181 2957440791 170
350 iso_pu_bacteria 2957443900 2957445027 170
351 iso_pu_bacteria 2957450854 2957456008 170
352 iso_pu_bacteria 2957457609 2957459881 170
353 iso_pu_bacteria 2957464669 2957466031 170
354 iso_pu_bacteria 2957471148 2957474223 170
355 iso_pu_bacteria 2957478035 2957479180 170
356 iso_pu_bacteria 2957484790 2957486295 170
357 iso_pu_bacteria 2957491536 2957498000 170
358 iso_pu_bacteria 2957498199 2957503666 170
359 iso_pu_bacteria 2957505466 2957507619 170
360 iso_pu_bacteria 2960584000 2960589655 170
361 iso_pu_bacteria 2960591022 2960592677 170
362 iso_pu_bacteria 2960597568 2960602648 170
363 iso_pu_bacteria 2960603979 2960605973 170
364 iso_pu_bacteria 2960610863 2960612458 170
365 iso_pu_bacteria 2960617483 2960619975 170
366 iso_pu_bacteria 2960624210 2960627856 170
367 iso_pu_bacteria 2960631154 2960632794 170
368 iso_pu_bacteria 2960637947 2960638217 170
369 iso_pu_bacteria 2960645483 2960650543 170
370 iso_pu_bacteria 2960652885 2960660001 170
371 iso_pu_bacteria 2960660292 2960660811 170
372 iso_pu_bacteria 2960667422 2960671005 170
373 iso_pu_bacteria 2960674078 2960679012 170
374 iso_pu_bacteria 2960680706 2960681899 170
375 iso_pu_bacteria 2960687367 2960689988 170
376 iso_pu_bacteria 2960693952 2960694242 170
377 iso_pu_bacteria 2964615318 2964616615 170
378 iso_pu_bacteria 2964621998 2964622543 170
379 iso_pu_bacteria 2964628898 2964635764 170
380 iso_pu_bacteria 2964636051 2964640986 170
381 iso_pu_bacteria 2964643177 2964644000 170
382 iso_pu_bacteria 2964649959 2964651747 170
383 iso_pu_bacteria 2964656573 2964657055 170
384 iso_pu_bacteria 2964663802 2964667083 170
385 iso_pu_bacteria 2964670856 2964675781 170
386 iso_pu_bacteria 2964678106 2964679513 170
387 iso_pu_bacteria 2964685014 2964686457 170
388 iso_pu_bacteria 2964691889 2964695710 170
389 iso_pu_bacteria 2964698721 2964702283 170
390 iso_pu_bacteria 2964705432 2964711883 170
391 iso_pu_bacteria 2964712639 2964716732 170
392 iso_pu_bacteria 2964719344 2964723929 170
393 iso_pu_bacteria 2967664464 2967664688 170
394 iso_pu_bacteria 2967671571 2967674478 170
395 iso_pu_bacteria 2967678726 2967681818 170
396 iso_pu_bacteria 2967686174 2967690815 170
397 iso_pu_bacteria 2967693043 2967695215 170
398 iso_pu_bacteria 2967699805 2967700267 170
399 iso_pu_bacteria 2967706974 2967713322 170
400 iso_pu_bacteria 2967714385 2967716700 170
401 iso_pu_bacteria 2967721400 2967721701 170
402 iso_pu_bacteria 2967728569 2967735023 170
403 iso_pu_bacteria 2967735183 2967736899 170
404 iso_pu_bacteria 2967742019 2967746709 170
405 iso_pu_bacteria 2967748971 2967755520 170
406 iso_pu_bacteria 2967755722 2967758788 170
407 iso_pu_bacteria 2967762386 2967765418 170
408 iso_pu_bacteria 2967769361 2967775696 170
409 iso_pu_bacteria 2967775926 2967777002 170
410 iso_pu_bacteria 2970019648 2970026480 170
411 iso_pu_bacteria 2970026789 2970030760 170
412 iso_pu_bacteria 2970033650 2970039760 170
413 iso_pu_bacteria 2970040964 2970047357 170
414 iso_pu_bacteria 2970047711 2970051527 170
415 iso_pu_bacteria 2970054988 2970057773 170
416 iso_pu_bacteria 2970061556 2970066736 170
417 iso_pu_bacteria 2970068827 2970072961 170
418 iso_pu_bacteria 2970076120 2970077497 170
419 iso_pu_bacteria 2970082768 2970086160 170
420 iso_pu_bacteria 2970088815 2970091134 170
421 iso_pu_bacteria 2970095765 2970100645 170
422 iso_pu_bacteria 2970102677 2970107538 170
423 iso_pu_bacteria 2970109326 2970110827 170
424 iso_pu_bacteria 2970116247 2970122126 170
425 iso_pu_bacteria 2970122695 2970123020 170
426 iso_pu_bacteria 2970129317 2970131723 170
427 iso_pu_bacteria 2970136068 2970142186 170
428 iso_pu_bacteria 2970143518 2970144060 170
429 iso_pu_bacteria 2970149975 2970154217 170
430 iso_pu_bacteria 2970156795 2970160178 170
431 iso_pu_bacteria 2970164137 2970167161 170
432 iso_pu_bacteria 2970170962 2970173245 170
433 iso_pu_bacteria 2970177841 2970180283 170
434 iso_pu_bacteria 2970184632 2970187618 170
435 iso_pu_bacteria 2970191845 2970193375 170
436 iso_pu_bacteria 2977516862 2977521898 170
437 iso_pu_bacteria 2977523885 2977528965 170
438 iso_pu_bacteria 2977530762 2977531709 170
439 iso_pu_bacteria 2977537788 2977540525 170
440 iso_pu_bacteria 2977544691 2977548524 170
441 iso_pu_bacteria 2977551784 2977554377 170
442 iso_pu_bacteria 2977558990 2977564481 170
443 iso_pu_bacteria 2977565890 2977572221 170
444 iso_pu_bacteria 2977572785 2977575328 170
445 iso_pu_bacteria 2977579622 2977580213 170
446 iso_pu_bacteria 2989771324 2989774980 170
447 iso_pu_bacteria 643692032 643826020 170
448 iso_pu_bacteria 648276728 648739596 170
449 iso_pu_bacteria 8003992118 8003993886 170
450 iso_pu_bacteria 8003999396 8004001433 170
451 iso_pu_bacteria 8005246636 8005250888 170
452 iso_pu_bacteria 8005484373 8005485276 170
453 iso_pu_bacteria 8005645114 8005649739 170
454 iso_pu_bacteria 8005682033 8005683055 170
455 iso_pu_bacteria 8049293176 8049295025 170
456 iso_pu_bacteria 8057575449 8057575904 170
457 3300048924 Ga0496121_0318562 Ga0496121_0318562_283_798 171
458 3300050514 nmdc:mga08x19_16479_c1 nmdc:mga08x19_16479_c1_3891_4463 171
459 3300006051 Ga0075364_10130522 Ga0075364_101305222 172
460 3300006178 Ga0075367_10588100 Ga0075367_105881001 172
461 3300025284 Ga0209130_1040151 Ga0209130_10401512 172
462 3300046471 Ga0495650_0176115 Ga0495650_0176115_21_539 172
463 3300048925 Ga0496122_0106533 Ga0496122_0106533_670_1191 172
464 3300048926 Ga0496123_0124905 Ga0496123_0124905_464_985 172
465 3300048929 Ga0496126_0880577 Ga0496126_0880577_37_558 172
466 3300049568 Ga0501031_0624978 Ga0501031_0624978_123_641 172
467 3300049571 Ga0501034_0752943 Ga0501034_0752943_143_661 172
468 3300049575 Ga0501039_0632427 Ga0501039_0632427_134_652 172
469 3300049579 Ga0501043_0620397 Ga0501043_0620397_169_687 172
470 3300049584 Ga0501068_0259740 Ga0501068_0259740_413_931 172
471 3300049823 Ga0501044_0085303 Ga0501044_0085303_2466_2984 172
472 3300050492 nmdc:mga0yw44_547207_c1 nmdc:mga0yw44_547207_c1_31_555 172
473 3300050494 nmdc:mga06z11_563240_c1 nmdc:mga06z11_563240_c1_133_657 172
474 3300053140 Ga0500573_0000901 Ga0500573_0000901_12733_13251 172
475 3300060353 Ga0501082_1128965 Ga0501082_1128965_69_587 172
476 3300003215 JGI25153J46596_10020129 JGI25153J46596_100201292 173
477 3300003781 Ga0055536_1003640 Ga0055536_10036403 173
478 3300003794 Ga0055531_10001342 Ga0055531_1000134216 173
479 3300006946 Ga0079104_1000129 Ga0079104_100012914 173
480 3300013100 Ga0157373_10010698 Ga0157373_100106988 173
481 3300013104 Ga0157370_10012918 Ga0157370_100129184 173
482 3300013105 Ga0157369_10020476 Ga0157369_100204763 173
483 3300017792 Ga0163161_10120638 Ga0163161_101206381 173
484 3300025292 Ga0209676_1017034 Ga0209676_10170341 173
485 3300025297 Ga0209758_1000418 Ga0209758_100041835 173
486 3300025303 Ga0209051_1000482 Ga0209051_100048215 173
487 3300025304 Ga0209257_1001560 Ga0209257_100156019 173
488 3300027111 Ga0209281_1000036 Ga0209281_1000036234 173
489 3300027111 Ga0209281_1000047 Ga0209281_1000047176 173
490 3300039062 Ga0400483_008111 Ga0400483_008111_3584_4126 173
491 3300039062 Ga0400483_267213 Ga0400483_267213_5679_6221 173
492 3300044765 Ga0466970_0088242 Ga0466970_0088242_41_562 173
493 3300046501 Ga0495607_0026748 Ga0495607_0026748_1805_2326 173
494 3300046530 Ga0495654_0113034 Ga0495654_0113034_700_1221 173
495 3300048913 Ga0496110_0056117 Ga0496110_0056117_674_1195 173
496 3300048914 Ga0496111_0009450 Ga0496111_0009450_3016_3537 173
497 3300048924 Ga0496121_0006013 Ga0496121_0006013_6385_6906 173
498 3300048925 Ga0496122_0000369 Ga0496122_0000369_69449_69970 173
499 3300048926 Ga0496123_0000054 Ga0496123_0000054_127765_128286 173
500 3300048926 Ga0496123_0013968 Ga0496123_0013968_955_1476 173
501 3300048927 Ga0496124_0031324 Ga0496124_0031324_3693_4214 173
502 3300048927 Ga0496124_0053148 Ga0496124_0053148_53_574 173
503 3300048927 Ga0496124_0144917 Ga0496124_0144917_610_1131 173
504 3300053125 Ga0500618_001774 Ga0500618_001774_4704_5225 173
505 3300053125 Ga0500618_014282 Ga0500618_014282_1121_1642 173
506 3300053125 Ga0500618_095206 Ga0500618_095206_131_652 173
507 3300053139 Ga0500568_0203370 Ga0500568_0203370_130_651 173
508 3300053156 Ga0500622_0056204 Ga0500622_0056204_45_566 173
509 iso_pu_bacteria 2751185800 2753359657 173
510 3300001979 JGI24740J21852_10000033 JGI24740J21852_1000003325 174
511 3300002773 JGI25152J39213_1002269 JGI25152J39213_10022693 174
512 3300002987 JGI25159J45721_1001112 JGI25159J45721_10011123 174
513 3300003214 JGI25165J46597_1000696 JGI25165J46597_100069615 174
514 3300003322 rootL2_10012458 rootL2_100124583 174
515 3300003323 rootH1_10018568 rootH1_100185682 174
516 3300003323 rootH1_10018569 rootH1_100185694 174
517 3300003354 JGI25160J50197_1000087 JGI25160J50197_100008751 174
518 3300003374 JGI25161J50226_1000066 JGI25161J50226_100006645 174
519 3300003771 Ga0055526_1057715 Ga0055526_10577151 174
520 3300003775 Ga0055524_1006319 Ga0055524_10063193 174
521 3300003775 Ga0055524_1009181 Ga0055524_10091813 174
522 3300003790 Ga0055528_1000240 Ga0055528_100024032 174
523 3300003790 Ga0055528_1003572 Ga0055528_10035724 174
524 3300003856 Ga0058692_1013067 Ga0058692_10130671 174
525 3300004625 Ga0055543_1000068 Ga0055543_100006851 174
526 3300005262 Ga0065165_1001569 Ga0065165_100156920 174
527 3300005262 Ga0065165_1034983 Ga0065165_10349831 174
528 3300005347 Ga0070668_100048809 Ga0070668_1000488092 174
529 3300005355 Ga0070671_100022521 Ga0070671_1000225213 174
530 3300005614 Ga0068856_100002641 Ga0068856_1000026412 174
531 3300005844 Ga0068862_100391522 Ga0068862_1003915221 174
532 3300006038 Ga0075365_10154706 Ga0075365_101547062 174
533 3300006042 Ga0075368_10129294 Ga0075368_101292941 174
534 3300006178 Ga0075367_10219016 Ga0075367_102190162 174
535 3300006353 Ga0075370_10029657 Ga0075370_100296571 174
536 3300006946 Ga0079104_1001459 Ga0079104_10014596 174
537 3300009011 Ga0105251_10015236 Ga0105251_100152363 174
538 3300009177 Ga0105248_10179766 Ga0105248_101797662 174
539 3300009551 Ga0105238_11884489 Ga0105238_118844891 174
540 3300009553 Ga0105249_10166016 Ga0105249_101660162 174
541 3300009766 Ga0123342_1028101 Ga0123342_10281011 174
542 3300013100 Ga0157373_10854115 Ga0157373_108541151 174
543 3300013105 Ga0157369_10343297 Ga0157369_103432972 174
544 3300021320 Ga0214544_1001350 Ga0214544_100135017 174
545 3300021321 Ga0214542_1002270 Ga0214542_100227016 174
546 3300021321 Ga0214542_1032753 Ga0214542_10327532 174
547 3300021327 Ga0214543_1000028 Ga0214543_1000028182 174
548 3300021327 Ga0214543_1000078 Ga0214543_100007857 174
549 3300022739 Ga0228711_1000016 Ga0228711_100001678 174
550 3300022740 Ga0228710_1000013 Ga0228710_100001357 174
551 3300025208 Ga0209436_111026 Ga0209436_1110261 174
552 3300025233 Ga0209437_100047 Ga0209437_100047101 174
553 3300025233 Ga0209437_100242 Ga0209437_1002423 174
554 3300025245 Ga0207425_1022977 Ga0207425_10229772 174
555 3300025253 Ga0209677_100811 Ga0209677_10081112 174
556 3300025254 Ga0209148_1008543 Ga0209148_10085433 174
557 3300025256 Ga0209759_1038149 Ga0209759_10381492 174
558 3300025258 Ga0209129_1001218 Ga0209129_10012182 174
559 3300025261 Ga0209233_1000048 Ga0209233_1000048301 174
560 3300025261 Ga0209233_1000069 Ga0209233_1000069129 174
561 3300025261 Ga0209233_1000257 Ga0209233_100025753 174
562 3300025272 Ga0209455_1025527 Ga0209455_10255272 174
563 3300025273 Ga0209673_1000013 Ga0209673_1000013270 174
564 3300025273 Ga0209673_1001931 Ga0209673_10019313 174
565 3300025284 Ga0209130_1000021 Ga0209130_1000021306 174
566 3300025284 Ga0209130_1006021 Ga0209130_10060212 174
567 3300025294 Ga0209025_1035344 Ga0209025_10353442 174
568 3300025295 Ga0209564_1000525 Ga0209564_100052533 174
569 3300025295 Ga0209564_1014246 Ga0209564_10142462 174
570 3300025299 Ga0209256_1000769 Ga0209256_100076911 174
571 3300025299 Ga0209256_1016176 Ga0209256_10161762 174
572 3300025299 Ga0209256_1035188 Ga0209256_10351881 174
573 3300025302 Ga0207426_1000010 Ga0207426_100001052 174
574 3300025302 Ga0207426_1000697 Ga0207426_100069722 174
575 3300025735 Ga0207713_1046512 Ga0207713_10465121 174
576 3300025904 Ga0207647_10481691 Ga0207647_104816911 174
577 3300025904 Ga0207647_10507069 Ga0207647_105070691 174
578 3300025941 Ga0207711_10174914 Ga0207711_101749142 174
579 3300025961 Ga0207712_10436198 Ga0207712_104361981 174
580 3300026078 Ga0207702_10073460 Ga0207702_100734603 174
581 3300027111 Ga0209281_1000221 Ga0209281_100022175 174
582 3300027111 Ga0209281_1000453 Ga0209281_100045342 174
583 3300027312 Ga0209371_1004612 Ga0209371_10046124 174
584 3300027666 Ga0209282_1000041 Ga0209282_100004175 174
585 3300027866 Ga0209813_10081388 Ga0209813_100813881 174
586 3300028794 Ga0307515_10000023 Ga0307515_10000023258 174
587 3300030500 Ga0268256_1007692 Ga0268256_10076922 174
588 3300031548 Ga0307408_100223954 Ga0307408_1002239542 174
589 3300031731 Ga0307405_10132219 Ga0307405_101322192 174
590 3300031901 Ga0307406_10112792 Ga0307406_101127922 174
591 3300031967 Ga0315914_1000030 Ga0315914_100003057 174
592 3300032002 Ga0307416_100390402 Ga0307416_1003904022 174
593 3300033430 Ga0315913_1000017 Ga0315913_100001757 174
594 3300033464 Ga0315915_1000017 Ga0315915_1000017111 174
595 3300037471 Ga0395905_0348587 Ga0395905_0348587_514_1206 174
596 3300041404 Ga0439436_0015279 Ga0439436_0015279_170_697 174
597 3300041406 Ga0439439_0136648 Ga0439439_0136648_26_550 174
598 3300041413 Ga0439465_0122057 Ga0439465_0122057_155_679 174
599 3300042007 Ga0439449_0103250 Ga0439449_0103250_273_797 174
600 3300046460 Ga0495638_0011275 Ga0495638_0011275_1188_1712 174
601 3300046530 Ga0495654_0000090 Ga0495654_0000090_93816_94355 174
602 3300047472 Ga0495686_0429461 Ga0495686_0429461_100_654 174
603 3300048906 Ga0496103_0442879 Ga0496103_0442879_24_548 174
604 3300048907 Ga0496104_0110495 Ga0496104_0110495_15_539 174
605 3300048911 Ga0496108_0418459 Ga0496108_0418459_466_990 174
606 3300048919 Ga0496116_0163113 Ga0496116_0163113_639_1178 174
607 3300048919 Ga0496116_0271797 Ga0496116_0271797_178_717 174
608 3300048921 Ga0496118_0063761 Ga0496118_0063761_1627_2166 174
609 3300048923 Ga0496120_0012911 Ga0496120_0012911_3019_3558 174
610 3300048924 Ga0496121_0000003 Ga0496121_0000003_172702_173241 174
611 3300048925 Ga0496122_0009921 Ga0496122_0009921_6822_7367 174
612 3300048925 Ga0496122_0018405 Ga0496122_0018405_847_1380 174
613 3300048925 Ga0496122_0038551 Ga0496122_0038551_3265_3789 174
614 3300048925 Ga0496122_0057563 Ga0496122_0057563_2281_2805 174
615 3300048925 Ga0496122_0072455 Ga0496122_0072455_708_1241 174
616 3300048925 Ga0496122_0098639 Ga0496122_0098639_174_698 174
617 3300048926 Ga0496123_0081075 Ga0496123_0081075_529_1062 174
618 3300048926 Ga0496123_0091042 Ga0496123_0091042_464_1003 174
619 3300048926 Ga0496123_0095793 Ga0496123_0095793_94_627 174
620 3300048927 Ga0496124_0036738 Ga0496124_0036738_746_1285 174
621 3300048927 Ga0496124_0077394 Ga0496124_0077394_2064_2588 174
622 3300048927 Ga0496124_0414374 Ga0496124_0414374_218_757 174
623 3300048927 Ga0496124_0545709 Ga0496124_0545709_29_580 174
624 3300048928 Ga0496125_0000141 Ga0496125_0000141_93545_94084 174
625 3300048928 Ga0496125_0014104 Ga0496125_0014104_5932_6477 174
626 3300048928 Ga0496125_0026229 Ga0496125_0026229_4048_4581 174
627 3300048928 Ga0496125_0153737 Ga0496125_0153737_164_697 174
628 3300048928 Ga0496125_0272894 Ga0496125_0272894_478_1002 174
629 3300048928 Ga0496125_0314611 Ga0496125_0314611_294_818 174
630 3300048929 Ga0496126_0129612 Ga0496126_0129612_367_906 174
631 3300048929 Ga0496126_0352996 Ga0496126_0352996_595_1119 174
632 3300049570 Ga0501033_0393006 Ga0501033_0393006_312_836 174
633 3300049571 Ga0501034_0014024 Ga0501034_0014024_7410_8024 174
634 3300049571 Ga0501034_0279145 Ga0501034_0279145_518_1084 174
635 3300049581 Ga0501047_0419942 Ga0501047_0419942_130_654 174
636 3300053122 Ga0500608_022277 Ga0500608_022277_368_892 174
637 3300053122 Ga0500608_042044 Ga0500608_042044_973_1497 174
638 3300053153 Ga0500616_0070061 Ga0500616_0070061_296_898 174
639 3300053153 Ga0500616_0141227 Ga0500616_0141227_105_629 174
640 3300053158 Ga0500627_0220366 Ga0500627_0220366_176_700 174
641 iso_pu_bacteria 2515154107 2515608801 174
642 iso_pu_bacteria 2599185156 2599331612 174
643 iso_pu_bacteria 2936996657 2936998084 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02283

CobU

Cobinamide kinase / cobinamide phosphate guanyltransferase

37

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c9k-assembly1.cif.gz_A the three dimensional structure of adenosylcobinamide kinase/ adenosylcobinamide phosphate gualylyltransferase (cobu) complexed with gmp: evidence for a substrate induced transferase active site 0.8738 9 173
1c9k-assembly1.cif.gz_A the three dimensional structure of adenosylcobinamide kinase/ adenosylcobinamide phosphate gualylyltransferase (cobu) complexed with gmp: evidence for a substrate induced transferase active site 0.8444 9 173
1c9k-assembly1.cif.gz_C the three dimensional structure of adenosylcobinamide kinase/ adenosylcobinamide phosphate gualylyltransferase (cobu) complexed with gmp: evidence for a substrate induced transferase active site 0.8375 9 173
1c9k-assembly1.cif.gz_C the three dimensional structure of adenosylcobinamide kinase/ adenosylcobinamide phosphate gualylyltransferase (cobu) complexed with gmp: evidence for a substrate induced transferase active site 0.8278 9 173
7tm8-assembly1.cif.gz_B crystal structure of bifunctional adenosylcobalamin biosynthesis protein from klebsiella pneumoniae 0.826 8 173
ID Description Score Start End Superfamily
af_O53676_2_174_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8863 9 172 3.40.50.300
1c9kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8375 9 173 3.40.50.300
af_O53676_2_174_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8373 9 172 3.40.50.300
1c9kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8278 9 173 3.40.50.300
af_G5EEZ5_28_168_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6765 8 164 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A087NIT1-F1-model_v4 Adenosylcobinamide kinase (EC 2.7.1.156) (EC 2.7.7.62) (Adenosylcobinamide-phosphate guanylyltransferase) 0.9858 86 174 GO:0005524
GO:0005525
GO:0008820
GO:0009236
GO:0043752
AF-A0A2M7WDV0-F1-model_v4 Bifunctional adenosylcobalamin biosynthesis protein (EC 2.7.1.156) (EC 2.7.7.62) 0.9802 8 174 GO:0005524
GO:0005525
GO:0008820
GO:0009236
GO:0043752
AF-A0A7R9L9B9-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21) (N(1)-alpha-phosphoribosyltransferase) 0.9771 8 171 GO:0000166
GO:0008939
GO:0043752
AF-A0A435QUK9-F1-model_v4 deleted 0.9765 70 173
AF-A0A1Y5D2G5-F1-model_v4 Bifunctional adenosylcobalamin biosynthesis protein (EC 2.7.1.156) (EC 2.7.7.62) 0.975 9 174 GO:0005524
GO:0005525
GO:0008820
GO:0009236
GO:0043752

Feature Viewer

pLDDT pTM Quality
90.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map