F471861

General Info

Members Datasets Scaffolds Average Seq Length
642 337 620 255

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10039751|Ga0163161_100397512
Length 306
Sequence MLFPEAPVATGAFFVSAAWLSLLKRLPHGVPLGPVGGRVLPFTVSTAPNRPMRIALGVEYDGTDFLGWQRLSHAKTVQGSLEQALSFVAHTPIEVTAAGRTDAGVHGRCQVVHFDTEVVRDLRGWILGACSNLPHAVAVTWAQPVPDDFHARFSARARRYRYRILPRFVRPALDARFVAWERRQIDAEAMNEAAQAIVGEHDFTAFRAISCQAAHARRNVRSIRVFREDIHVVVEIEANAFLHHMVRNIVGSLLRIGRGEEGVGWMAELLAGRDREVAGATAPAEGLTFLGPLYEAHWGLPPEVTL

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
10 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
11 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
12 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
13 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
14 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
15 2919085039 Luteibacter sp. 1214 Isolate Unclassified
16 2919404418 Luteibacter sp. 3190 Isolate Unclassified
17 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
18 2941471342 Luteibacter sp. 621 Isolate Unclassified
19 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
20 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
230 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
236 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
297 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
304 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
305 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
308 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
309 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
310 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
311 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
314 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
318 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
336 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
337 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0.31
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0
Rhizoplane 1.71
Rhizosphere 83.49
Stem 0
Stem Tuber 0
Unclassified 9.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003392 3300001904 Bacteria 2768
2 JGI25156J39149_1003324 3300002705 Bacteria 5316
3 JGI25154J39366_1004852 3300002738 Bacteria 2284
4 JGI25157J39369_1001473 3300002741 Bacteria 8720
5 JGI25157J39369_1003405 3300002741 Bacteria 3270
6 JGI25164J39214_1000587 3300002772 Bacteria 16308
7 JGI25406J46586_10014833 3300003203 Unclassified 3303
8 JGI25165J46597_1001159 3300003214 Bacteria 16326
9 Ga0055533_1006060 3300003756 Bacteria 1840
10 Ga0055535_1000395 3300003761 Bacteria 41210
11 Ga0055535_1001113 3300003761 Bacteria 16309
12 Ga0055542_1000167 3300003762 Bacteria 83068
13 Ga0055529_1000908 3300003763 Bacteria 16313
14 Ga0065165_1000113 3300005262 Bacteria 135963
15 Ga0065165_1006139 3300005262 Bacteria 6425
16 Ga0065714_10064432 3300005288 Bacteria 133542
17 Ga0065704_10234515 3300005289 Bacteria 1029
18 Ga0065712_10067730 3300005290 Bacteria 133482
19 Ga0065715_10121787 3300005293 Unclassified 2221
20 Ga0065715_10411379 3300005293 Unclassified 869
21 Ga0070658_10007718 3300005327 Bacteria 8668
22 Ga0070658_10022952 3300005327 Bacteria 5009
23 Ga0070658_10040995 3300005327 Bacteria 3735
24 Ga0070683_100341668 3300005329 Bacteria 1425
25 Ga0070670_100000324 3300005331 Bacteria 40556
26 Ga0070670_100051251 3300005331 Bacteria 3545
27 Ga0070670_100171689 3300005331 Bacteria 1881
28 Ga0068869_100018668 3300005334 Bacteria 4725
29 Ga0070666_10000007 3300005335 Bacteria 293732
30 Ga0070682_100002049 3300005337 Bacteria 11249
31 Ga0070682_100040957 3300005337 Bacteria 2853
32 Ga0068868_100370875 3300005338 Unclassified 1230
33 Ga0070660_100063451 3300005339 Bacteria 2872
34 Ga0070689_100011673 3300005340 Bacteria 6301
35 Ga0070689_100210824 3300005340 Bacteria 1590
36 Ga0070661_100122142 3300005344 Bacteria 1952
37 Ga0070692_10018538 3300005345 Bacteria 3349
38 Ga0070692_10022138 3300005345 Bacteria 3102
39 Ga0070668_100010998 3300005347 Bacteria 6737
40 Ga0070675_100057996 3300005354 Bacteria 3193
41 Ga0070675_100308208 3300005354 Bacteria 1396
42 Ga0070671_100007584 3300005355 Bacteria 8675
43 Ga0070671_100019383 3300005355 Bacteria 5536
44 Ga0070674_100010419 3300005356 Bacteria 5622
45 Ga0070688_100055843 3300005365 Bacteria 2478
46 Ga0070659_100017308 3300005366 Bacteria 5420
47 Ga0070659_100130734 3300005366 Bacteria 2039
48 Ga0070659_100355356 3300005366 Unclassified 1230
49 Ga0070659_100506015 3300005366 Bacteria 1030
50 Ga0070667_100037500 3300005367 Bacteria 4063
51 Ga0070703_10042242 3300005406 Unclassified 1425
52 Ga0070709_10156858 3300005434 Bacteria 1579
53 Ga0070714_100003249 3300005435 Bacteria 12096
54 Ga0070714_100028051 3300005435 Bacteria 4667
55 Ga0070711_100490752 3300005439 Bacteria 1011
56 Ga0070705_100362117 3300005440 Unclassified 1061
57 Ga0070705_100377643 3300005440 Bacteria 1042
58 Ga0070700_100000042 3300005441 Bacteria 99515
59 Ga0070700_100007847 3300005441 Bacteria 5788
60 Ga0070700_100169994 3300005441 Unclassified 1509
61 Ga0070694_100020752 3300005444 Bacteria 4191
62 Ga0070694_100122443 3300005444 Bacteria 1868
63 Ga0070694_100184655 3300005444 Bacteria 1544
64 Ga0070694_100333824 3300005444 Unclassified 1170
65 Ga0070663_100233621 3300005455 Bacteria 1449
66 Ga0070678_100161452 3300005456 Bacteria 1816
67 Ga0070678_100365835 3300005456 Bacteria 1244
68 Ga0070662_100479855 3300005457 Bacteria 1035
69 Ga0070681_10004241 3300005458 Bacteria 13592
70 Ga0070681_10012618 3300005458 Bacteria 8383
71 Ga0070681_10098046 3300005458 Bacteria 2877
72 Ga0068867_100420511 3300005459 Bacteria 1132
73 Ga0070706_100000480 3300005467 Bacteria 47075
74 Ga0070698_100079102 3300005471 Bacteria 3285
75 Ga0070699_100002826 3300005518 Bacteria 15494
76 Ga0070699_100013038 3300005518 Bacteria 7163
77 Ga0070699_100238296 3300005518 Bacteria 1623
78 Ga0070679_100001229 3300005530 Bacteria 22504
79 Ga0070679_100006483 3300005530 Bacteria 10908
80 Ga0070679_100145625 3300005530 Bacteria 2347
81 Ga0070679_100420621 3300005530 Bacteria 1282
82 Ga0070684_100046220 3300005535 Bacteria 3772
83 Ga0068853_100034519 3300005539 Bacteria 4294
84 Ga0068853_100055834 3300005539 Bacteria 3404
85 Ga0070672_100016560 3300005543 Bacteria 5280
86 Ga0070672_100128033 3300005543 Bacteria 2084
87 Ga0070695_100042586 3300005545 Unclassified 2883
88 Ga0070693_100000402 3300005547 Bacteria 19643
89 Ga0070693_100244316 3300005547 Bacteria 1187
90 Ga0070665_100000817 3300005548 Bacteria 40729
91 Ga0070704_100139640 3300005549 Bacteria 1890
92 Ga0070704_100393916 3300005549 Bacteria 1180
93 Ga0068855_100001822 3300005563 Bacteria 26575
94 Ga0068855_100020227 3300005563 Bacteria 7990
95 Ga0070664_100000284 3300005564 Bacteria 36685
96 Ga0070664_100157169 3300005564 Bacteria 2009
97 Ga0068857_100014323 3300005577 Bacteria 6912
98 Ga0068857_100061456 3300005577 Bacteria 3337
99 Ga0068857_100160021 3300005577 Bacteria 2043
100 Ga0068857_100691664 3300005577 Bacteria 968
101 Ga0068854_100001800 3300005578 Bacteria 13042
102 Ga0068854_100012317 3300005578 Bacteria 5597
103 Ga0068854_100097033 3300005578 Bacteria 2203
104 Ga0068854_100145988 3300005578 Bacteria 1820
105 Ga0068854_100187328 3300005578 Bacteria 1620
106 Ga0068856_100000238 3300005614 Bacteria 59833
107 Ga0068856_100055306 3300005614 Bacteria 3916
108 Ga0068856_100097250 3300005614 Bacteria 2933
109 Ga0068856_100807426 3300005614 Unclassified 958
110 Ga0070702_100109460 3300005615 Bacteria 1710
111 Ga0068852_100123517 3300005616 Bacteria 2374
112 Ga0068859_100041310 3300005617 Bacteria 4632
113 Ga0068859_100057602 3300005617 Bacteria 3914
114 Ga0068859_100059419 3300005617 Bacteria 3851
115 Ga0068859_100070970 3300005617 Bacteria 3518
116 Ga0068859_100272047 3300005617 Unclassified 1786
117 Ga0068859_100302356 3300005617 Bacteria 1693
118 Ga0068859_100517625 3300005617 Bacteria 1288
119 Ga0068859_101409112 3300005617 Bacteria 769
120 Ga0068864_100013842 3300005618 Bacteria 6684
121 Ga0068864_100209229 3300005618 Bacteria 1795
122 Ga0068861_100031108 3300005719 Bacteria 3917
123 Ga0068861_100281273 3300005719 Bacteria 1433
124 Ga0068851_10014190 3300005834 Bacteria 3780
125 Ga0068851_10168100 3300005834 Bacteria 1208
126 Ga0068851_10174682 3300005834 Bacteria 1187
127 Ga0068870_10015961 3300005840 Bacteria 3577
128 Ga0068870_10031416 3300005840 Bacteria 2691
129 Ga0068863_100050680 3300005841 Bacteria 3934
130 Ga0068863_100207210 3300005841 Bacteria 1887
131 Ga0068863_100461878 3300005841 Bacteria 1247
132 Ga0068858_100014053 3300005842 Bacteria 7551
133 Ga0068858_100044656 3300005842 Bacteria 4106
134 Ga0068858_100074702 3300005842 Bacteria 3148
135 Ga0068858_100084713 3300005842 Bacteria 2948
136 Ga0068858_100229282 3300005842 Bacteria 1760
137 Ga0068858_100939546 3300005842 Unclassified 846
138 Ga0068860_100004070 3300005843 Bacteria 15007
139 Ga0068860_100084274 3300005843 Bacteria 3024
140 Ga0068860_100130963 3300005843 Bacteria 2407
141 Ga0068860_100524365 3300005843 Bacteria 1185
142 Ga0068860_100528754 3300005843 Bacteria 1180
143 Ga0068860_100550702 3300005843 Unclassified 1156
144 Ga0068862_100063373 3300005844 Bacteria 3181
145 Ga0068862_100122364 3300005844 Bacteria 2295
146 Ga0068862_100647980 3300005844 Unclassified 1019
147 Ga0081539_10000395 3300005985 Bacteria 93818
148 Ga0070712_100500079 3300006175 Bacteria 1019
149 Ga0075369_10022335 3300006186 Bacteria 2609
150 Ga0075427_10014721 3300006194 Unclassified 1202
151 Ga0075428_100002002 3300006844 Bacteria 21951
152 Ga0075428_100023016 3300006844 Bacteria 6895
153 Ga0075428_100035074 3300006844 Bacteria 5530
154 Ga0075428_100054022 3300006844 Bacteria 4402
155 Ga0075428_100533438 3300006844 Bacteria 1255
156 Ga0075430_100018829 3300006846 Bacteria 5873
157 Ga0075430_100253210 3300006846 Bacteria 1459
158 Ga0075433_10011090 3300006852 Bacteria 7248
159 Ga0075433_10055957 3300006852 Bacteria 3445
160 Ga0075433_10227612 3300006852 Bacteria 1656
161 Ga0075433_10455828 3300006852 Bacteria 1127
162 Ga0075429_100143689 3300006880 Bacteria 2088
163 Ga0068865_100059439 3300006881 Bacteria 2673
164 Ga0097620_100041307 3300006931 Bacteria 4632
165 Ga0097620_100057603 3300006931 Bacteria 3914
166 Ga0097620_100059419 3300006931 Bacteria 3851
167 Ga0097620_100070964 3300006931 Bacteria 3518
168 Ga0097620_100272035 3300006931 Unclassified 1786
169 Ga0097620_100302356 3300006931 Bacteria 1693
170 Ga0097620_100517639 3300006931 Bacteria 1288
171 Ga0097620_101409041 3300006931 Bacteria 769
172 Ga0075435_100095799 3300007076 Bacteria 2455
173 Ga0105251_10092651 3300009011 Bacteria 1387
174 Ga0105240_10083667 3300009093 Bacteria 3915
175 Ga0111539_10000296 3300009094 Bacteria 60206
176 Ga0111539_10001653 3300009094 Bacteria 29768
177 Ga0111539_10081498 3300009094 Unclassified 3806
178 Ga0105247_10000635 3300009101 Bacteria 28087
179 Ga0105247_10007410 3300009101 Bacteria 6735
180 Ga0105247_10104789 3300009101 Bacteria 1812
181 Ga0105247_10169785 3300009101 Unclassified 1449
182 Ga0105247_10175818 3300009101 Bacteria 1426
183 Ga0114129_10038447 3300009147 Bacteria 6750
184 Ga0114129_10471560 3300009147 Bacteria 1644
185 Ga0114129_10963575 3300009147 Bacteria 1077
186 Ga0105241_10026775 3300009174 Bacteria 4292
187 Ga0105241_10030898 3300009174 Bacteria 4006
188 Ga0105241_10036968 3300009174 Bacteria 3676
189 Ga0105242_10090605 3300009176 Bacteria 2573
190 Ga0105248_10011331 3300009177 Bacteria 9830
191 Ga0105248_10030093 3300009177 Bacteria 6059
192 Ga0105248_10101139 3300009177 Bacteria 3249
193 Ga0105248_10329703 3300009177 Bacteria 1719
194 Ga0105248_10410793 3300009177 Bacteria 1524
195 Ga0105237_10003124 3300009545 Bacteria 19932
196 Ga0105237_10034954 3300009545 Bacteria 5086
197 Ga0105237_10228375 3300009545 Bacteria 1862
198 Ga0105238_10001931 3300009551 Bacteria 20819
199 Ga0105238_10104245 3300009551 Bacteria 2817
200 Ga0105238_10117867 3300009551 Bacteria 2635
201 Ga0105238_10164265 3300009551 Bacteria 2196
202 Ga0105238_10370323 3300009551 Bacteria 1423
203 Ga0105238_10708059 3300009551 Bacteria 1019
204 Ga0105249_10019898 3300009553 Bacteria 5995
205 Ga0105249_10332951 3300009553 Bacteria 1532
206 Ga0105239_10065981 3300010375 Bacteria 3977
207 Ga0105239_10218897 3300010375 Bacteria 2135
208 Ga0105239_10259891 3300010375 Bacteria 1951
209 Ga0105239_10409733 3300010375 Bacteria 1535
210 Ga0105239_10798242 3300010375 Bacteria 1081
211 Ga0105246_10020847 3300011119 Bacteria 4210
212 Ga0105246_10398285 3300011119 Unclassified 1142
213 Ga0157373_10000145 3300013100 Bacteria 56614
214 Ga0157373_10013447 3300013100 Bacteria 6004
215 Ga0157373_10013721 3300013100 Bacteria 5940
216 Ga0157371_10000174 3300013102 Bacteria 93381
217 Ga0157370_10000033 3300013104 Bacteria 138137
218 Ga0157370_10003047 3300013104 Bacteria 19875
219 Ga0157370_10009303 3300013104 Bacteria 10520
220 Ga0157370_10042286 3300013104 Bacteria 4392
221 Ga0157370_10065207 3300013104 Bacteria 3446
222 Ga0157370_10436109 3300013104 Bacteria 1205
223 Ga0157369_10000107 3300013105 Bacteria 117307
224 Ga0157369_10067705 3300013105 Bacteria 3837
225 Ga0157369_10241690 3300013105 Bacteria 1886
226 Ga0157369_10244558 3300013105 Bacteria 1873
227 Ga0157378_10035172 3300013297 Bacteria 4430
228 Ga0163162_10001668 3300013306 Bacteria 20833
229 Ga0163162_10139478 3300013306 Bacteria 2537
230 Ga0163162_10148758 3300013306 Bacteria 2459
231 Ga0163162_10479234 3300013306 Unclassified 1376
232 Ga0157372_10020695 3300013307 Bacteria 7100
233 Ga0157372_10033705 3300013307 Bacteria 5627
234 Ga0157372_10048007 3300013307 Bacteria 4746
235 Ga0157372_10109277 3300013307 Bacteria 3166
236 Ga0157375_10032881 3300013308 Bacteria 4923
237 Ga0157375_10712952 3300013308 Bacteria 1156
238 Ga0163163_10002165 3300014325 Bacteria 16602
239 Ga0163163_10006156 3300014325 Bacteria 10458
240 Ga0157380_10360913 3300014326 Bacteria 1363
241 Ga0182008_10006502 3300014497 Bacteria 6526
242 Ga0182008_10049075 3300014497 Bacteria 2095
243 Ga0157377_10294520 3300014745 Bacteria 1069
244 Ga0157379_10024068 3300014968 Bacteria 5404
245 Ga0157379_10167018 3300014968 Bacteria 1986
246 Ga0182006_1000027 3300015261 Bacteria 252946
247 Ga0182007_10024281 3300015262 Bacteria 2122
248 Ga0182005_1000054 3300015265 Bacteria 112885
249 Ga0182005_1013044 3300015265 Bacteria 2340
250 Ga0182005_1024884 3300015265 Bacteria 1634
251 Ga0163161_10039751 3300017792 Bacteria 3378
252 Ga0206356_11228936 3300020070 Bacteria 2725
253 Ga0206353_10991319 3300020082 Bacteria 4713
254 Ga0209674_100711 3300025226 Bacteria 11455
255 Ga0209672_100198 3300025228 Bacteria 47906
256 Ga0209672_100599 3300025228 Bacteria 18942
257 Ga0209147_108415 3300025229 Bacteria 1282
258 Ga0207427_100036 3300025231 Bacteria 309540
259 Ga0209437_101013 3300025233 Bacteria 9710
260 Ga0209437_101381 3300025233 Bacteria 6152
261 Ga0209258_100035 3300025242 Bacteria 430864
262 Ga0209258_100379 3300025242 Bacteria 57256
263 Ga0209258_103102 3300025242 Bacteria 3784
264 Ga0209646_1005067 3300025246 Bacteria 2335
265 Ga0209026_1000056 3300025250 Bacteria 236450
266 Ga0209026_1000513 3300025250 Bacteria 27282
267 Ga0209026_1010953 3300025250 Bacteria 1661
268 Ga0209148_1000045 3300025254 Bacteria 448076
269 Ga0209148_1000048 3300025254 Bacteria 430913
270 Ga0209148_1003490 3300025254 Bacteria 4315
271 Ga0209759_1000166 3300025256 Bacteria 113080
272 Ga0209759_1000670 3300025256 Bacteria 31566
273 Ga0209233_1000101 3300025261 Bacteria 286063
274 Ga0209455_1000035 3300025272 Bacteria 479071
275 Ga0209455_1009763 3300025272 Bacteria 2494
276 Ga0209676_1002569 3300025292 Bacteria 12546
277 Ga0209758_1025347 3300025297 Bacteria 2606
278 Ga0209257_1050858 3300025304 Bacteria 1171
279 Ga0207656_10094643 3300025321 Bacteria 1361
280 Ga0207656_10118881 3300025321 Bacteria 1228
281 Ga0207656_10208490 3300025321 Bacteria 946
282 Ga0207653_10007366 3300025885 Bacteria 3429
283 Ga0207680_10000002 3300025903 Bacteria 1018646
284 Ga0207680_10073532 3300025903 Bacteria 2126
285 Ga0207647_10000445 3300025904 Bacteria 33611
286 Ga0207647_10000548 3300025904 Bacteria 29903
287 Ga0207647_10019324 3300025904 Bacteria 4584
288 Ga0207643_10013247 3300025908 Bacteria 4463
289 Ga0207643_10036221 3300025908 Bacteria 2766
290 Ga0207705_10022212 3300025909 Bacteria 4526
291 Ga0207705_10032332 3300025909 Bacteria 3738
292 Ga0207705_10123931 3300025909 Bacteria 1919
293 Ga0207684_10000533 3300025910 Bacteria 47088
294 Ga0207654_10049534 3300025911 Bacteria 2410
295 Ga0207654_10098110 3300025911 Bacteria 1800
296 Ga0207707_10000044 3300025912 Bacteria 122847
297 Ga0207707_10006527 3300025912 Bacteria 10184
298 Ga0207707_10009412 3300025912 Bacteria 8474
299 Ga0207707_10023298 3300025912 Bacteria 5418
300 Ga0207695_10038674 3300025913 Bacteria 5133
301 Ga0207695_10058106 3300025913 Bacteria 4016
302 Ga0207695_10092009 3300025913 Bacteria 3045
303 Ga0207695_10103134 3300025913 Bacteria 2844
304 Ga0207671_10087119 3300025914 Bacteria 2348
305 Ga0207671_10087816 3300025914 Bacteria 2339
306 Ga0207671_10209106 3300025914 Bacteria 1526
307 Ga0207693_10404518 3300025915 Bacteria 1067
308 Ga0207660_10010225 3300025917 Bacteria 6082
309 Ga0207660_10018985 3300025917 Bacteria 4592
310 Ga0207660_10072519 3300025917 Bacteria 2508
311 Ga0207662_10017703 3300025918 Bacteria 4033
312 Ga0207662_10117514 3300025918 Bacteria 1664
313 Ga0207662_10122369 3300025918 Bacteria 1633
314 Ga0207657_10000193 3300025919 Bacteria 63264
315 Ga0207657_10000234 3300025919 Bacteria 58447
316 Ga0207657_10001113 3300025919 Bacteria 28509
317 Ga0207649_10015990 3300025920 Bacteria 4223
318 Ga0207649_10016120 3300025920 Bacteria 4209
319 Ga0207652_10000462 3300025921 Bacteria 41666
320 Ga0207652_10005477 3300025921 Bacteria 10301
321 Ga0207652_10060943 3300025921 Bacteria 3257
322 Ga0207652_10180709 3300025921 Bacteria 1896
323 Ga0207681_10017812 3300025923 Bacteria 4466
324 Ga0207694_10000177 3300025924 Bacteria 65875
325 Ga0207694_10147102 3300025924 Bacteria 1897
326 Ga0207694_10297168 3300025924 Bacteria 1329
327 Ga0207694_10312147 3300025924 Bacteria 1296
328 Ga0207650_10000112 3300025925 Bacteria 106714
329 Ga0207650_10160890 3300025925 Bacteria 1779
330 Ga0207659_10071561 3300025926 Bacteria 2532
331 Ga0207659_10106640 3300025926 Bacteria 2122
332 Ga0207664_10000884 3300025929 Bacteria 20225
333 Ga0207664_10078072 3300025929 Bacteria 2684
334 Ga0207644_10002052 3300025931 Bacteria 13049
335 Ga0207644_10084074 3300025931 Bacteria 2358
336 Ga0207690_10000627 3300025932 Bacteria 22858
337 Ga0207690_10276183 3300025932 Bacteria 1307
338 Ga0207690_10432294 3300025932 Bacteria 1055
339 Ga0207706_10000097 3300025933 Bacteria 91923
340 Ga0207706_10464704 3300025933 Bacteria 1094
341 Ga0207706_10671388 3300025933 Unclassified 887
342 Ga0207686_10058638 3300025934 Bacteria 2428
343 Ga0207709_10005963 3300025935 Bacteria 6871
344 Ga0207670_10000957 3300025936 Bacteria 15223
345 Ga0207670_10302494 3300025936 Bacteria 1253
346 Ga0207704_10081187 3300025938 Bacteria 2096
347 Ga0207711_10023901 3300025941 Bacteria 5115
348 Ga0207711_10063735 3300025941 Bacteria 3183
349 Ga0207711_10444669 3300025941 Bacteria 1206
350 Ga0207689_10048353 3300025942 Bacteria 3508
351 Ga0207689_10064726 3300025942 Bacteria 3007
352 Ga0207689_10082829 3300025942 Bacteria 2638
353 Ga0207689_10267860 3300025942 Bacteria 1414
354 Ga0207679_10023530 3300025945 Bacteria 4214
355 Ga0207667_10004853 3300025949 Bacteria 16441
356 Ga0207667_10028287 3300025949 Bacteria 6090
357 Ga0207667_10044577 3300025949 Bacteria 4699
358 Ga0207651_10004426 3300025960 Bacteria 7076
359 Ga0207651_10204540 3300025960 Bacteria 1585
360 Ga0207712_10007304 3300025961 Bacteria 6971
361 Ga0207712_10465107 3300025961 Bacteria 1075
362 Ga0207668_10009323 3300025972 Bacteria 5877
363 Ga0207640_10000572 3300025981 Bacteria 21945
364 Ga0207640_10059818 3300025981 Bacteria 2516
365 Ga0207640_10071559 3300025981 Bacteria 2336
366 Ga0207640_10112231 3300025981 Bacteria 1935
367 Ga0207640_10268688 3300025981 Bacteria 1333
368 Ga0207658_10133975 3300025986 Bacteria 1995
369 Ga0207677_10385048 3300026023 Bacteria 1185
370 Ga0207703_10064235 3300026035 Bacteria 3012
371 Ga0207703_10375362 3300026035 Bacteria 1314
372 Ga0207703_10634763 3300026035 Bacteria 1012
373 Ga0207639_10009456 3300026041 Bacteria 6728
374 Ga0207639_10326535 3300026041 Bacteria 1364
375 Ga0207678_10015018 3300026067 Bacteria 6814
376 Ga0207678_10042523 3300026067 Bacteria 3935
377 Ga0207708_10000074 3300026075 Bacteria 79215
378 Ga0207708_10005201 3300026075 Bacteria 9594
379 Ga0207708_10030970 3300026075 Bacteria 4060
380 Ga0207708_10112728 3300026075 Bacteria 2112
381 Ga0207702_10021190 3300026078 Bacteria 5379
382 Ga0207702_10524949 3300026078 Bacteria 1156
383 Ga0207702_10533868 3300026078 Bacteria 1146
384 Ga0207641_10029218 3300026088 Bacteria 4558
385 Ga0207641_10059659 3300026088 Bacteria 3250
386 Ga0207641_10104130 3300026088 Bacteria 2505
387 Ga0207641_10120209 3300026088 Bacteria 2343
388 Ga0207641_10217080 3300026088 Bacteria 1772
389 Ga0207676_10002522 3300026095 Bacteria 13053
390 Ga0207674_10008517 3300026116 Bacteria 11840
391 Ga0207674_10016443 3300026116 Bacteria 8098
392 Ga0207674_10025639 3300026116 Bacteria 6280
393 Ga0207674_10043503 3300026116 Bacteria 4631
394 Ga0207674_10062147 3300026116 Bacteria 3772
395 Ga0207674_10075626 3300026116 Bacteria 3377
396 Ga0207675_100098816 3300026118 Bacteria 2749
397 Ga0207683_10131010 3300026121 Bacteria 2256
398 Ga0207698_10043169 3300026142 Bacteria 3376
399 Ga0207428_10015306 3300027907 Bacteria 6639
400 Ga0268266_10000004 3300028379 Bacteria 1495817
401 Ga0268265_10055139 3300028380 Bacteria 3019
402 Ga0268264_10016780 3300028381 Bacteria 5992
403 Ga0268264_10074513 3300028381 Bacteria 2883
404 Ga0268264_10129413 3300028381 Bacteria 2236
405 Ga0268264_10173582 3300028381 Bacteria 1952
406 Ga0268264_10267572 3300028381 Bacteria 1595
407 Ga0307511_10000291 3300030521 Bacteria 52887
408 Ga0307408_100001522 3300031548 Bacteria 17223
409 Ga0307408_100337899 3300031548 Bacteria 1274
410 Ga0307408_100459729 3300031548 Bacteria 1106
411 Ga0307408_100725722 3300031548 Unclassified 895
412 Ga0307413_10001172 3300031824 Bacteria 9644
413 Ga0307413_10144233 3300031824 Bacteria 1650
414 Ga0307413_10387086 3300031824 Bacteria 1091
415 Ga0307410_10028486 3300031852 Bacteria 3544
416 Ga0307406_10003612 3300031901 Bacteria 8426
417 Ga0307406_10316047 3300031901 Bacteria 1206
418 Ga0307407_10009948 3300031903 Bacteria 4456
419 Ga0307407_10374759 3300031903 Bacteria 1014
420 Ga0307412_10082467 3300031911 Bacteria 2227
421 Ga0307412_10117655 3300031911 Bacteria 1908
422 Ga0307416_100008950 3300032002 Bacteria 6510
423 Ga0307416_100125391 3300032002 Bacteria 2299
424 Ga0307414_10002715 3300032004 Bacteria 9314
425 Ga0307414_10006856 3300032004 Bacteria 6374
426 Ga0307414_10051296 3300032004 Bacteria 2863
427 Ga0307414_10188432 3300032004 Bacteria 1667
428 Ga0307411_10008953 3300032005 Bacteria 5226
429 Ga0307411_10019968 3300032005 Bacteria 3884
430 Ga0307411_10028717 3300032005 Bacteria 3387
431 Ga0307415_100003868 3300032126 Bacteria 7682
432 Ga0307507_10114012 3300033179 Bacteria 2194
433 Ga0307510_10001742 3300033180 Bacteria 24237
434 Ga0307510_10102827 3300033180 Bacteria 2637
435 Ga0373940_0103440 3300035088 Unclassified 867
436 Ga0373949_0059215 3300035090 Bacteria 982
437 Ga0373942_0057000 3300035207 Bacteria 1110
438 Ga0373931_0020639 3300035691 Bacteria 3298
439 Ga0395899_0010991 3300037312 Bacteria 6934
440 Ga0395899_0011924 3300037312 Bacteria 6657
441 Ga0395900_0000107 3300037418 Bacteria 149024
442 Ga0395900_0008421 3300037418 Bacteria 10610
443 Ga0395900_0115104 3300037418 Bacteria 2759
444 Ga0395898_0000078 3300037466 Bacteria 244514
445 Ga0395898_0053030 3300037466 Bacteria 3961
446 Ga0395898_0101704 3300037466 Bacteria 2759
447 Ga0395898_0181060 3300037466 Bacteria 2014
448 Ga0395901_0002361 3300038443 Bacteria 19197
449 Ga0395901_0978061 3300038443 Bacteria 823
450 Ga0242420_001924 3300038996 Bacteria 2879
451 Ga0439436_0000026 3300041404 Bacteria 55607
452 Ga0439465_0000172 3300041413 Bacteria 16547
453 Ga0451833_1420711 3300041491 Bacteria 1396
454 Ga0450889_003766 3300042144 Bacteria 1495
455 Ga0439458_0002859 3300042157 Bacteria 4150
456 Ga0450908_002562 3300042184 Bacteria 3565
457 Ga0451577_0062915 3300042876 Bacteria 3309
458 Ga0466969_0002513 3300044656 Bacteria 9807
459 Ga0466969_0024094 3300044656 Bacteria 3130
460 Ga0466976_0269238 3300044662 Bacteria 978
461 Ga0466982_0007854 3300044672 Bacteria 5306
462 Ga0466961_0000906 3300044693 Bacteria 18402
463 Ga0466961_0002884 3300044693 Bacteria 10664
464 Ga0466961_0008386 3300044693 Bacteria 6582
465 Ga0466963_0210316 3300044694 Bacteria 1361
466 Ga0466964_0008393 3300044706 Bacteria 3881
467 Ga0466971_0014434 3300044719 Bacteria 3475
468 Ga0466971_0072250 3300044719 Bacteria 1567
469 Ga0466968_0003694 3300044735 Bacteria 5679
470 Ga0466970_0005775 3300044765 Bacteria 6151
471 Ga0466957_0062767 3300044842 Bacteria 2282
472 Ga0466957_0489570 3300044842 Bacteria 851
473 Ga0466959_0002734 3300045049 Bacteria 11352
474 Ga0451576_0000490 3300045051 Bacteria 87626
475 Ga0451576_0547136 3300045051 Bacteria 1216
476 Ga0451576_0881643 3300045051 Bacteria 939
477 Ga0466958_0081242 3300045836 Bacteria 1994
478 Ga0466967_0011210 3300045976 Bacteria 6776
479 Ga0495617_000321 3300046452 Bacteria 26962
480 Ga0495617_000583 3300046452 Bacteria 18579
481 Ga0495638_0000873 3300046460 Bacteria 31227
482 Ga0495650_0000250 3300046471 Bacteria 105746
483 Ga0495650_0001452 3300046471 Bacteria 22732
484 Ga0495650_0050865 3300046471 Bacteria 1710
485 Ga0495585_0000019 3300046492 Bacteria 156966
486 Ga0495585_0009413 3300046492 Bacteria 5859
487 Ga0495607_0000250 3300046501 Bacteria 57693
488 Ga0495607_0000538 3300046501 Bacteria 37198
489 Ga0495607_0021990 3300046501 Bacteria 4010
490 Ga0495606_0000665 3300046507 Bacteria 53891
491 Ga0495606_0000888 3300046507 Bacteria 44688
492 Ga0495606_0010914 3300046507 Bacteria 7475
493 Ga0495606_0027722 3300046507 Bacteria 4009
494 Ga0495606_0070583 3300046507 Bacteria 2202
495 Ga0495610_0007835 3300046512 Bacteria 7033
496 Ga0495616_0000047 3300046513 Bacteria 110592
497 Ga0495620_0001659 3300046515 Bacteria 13165
498 Ga0495620_0009649 3300046515 Bacteria 5123
499 Ga0495631_0001326 3300046518 Bacteria 15169
500 Ga0495631_0003442 3300046518 Bacteria 8667
501 Ga0495632_0000080 3300046519 Bacteria 99523
502 Ga0495632_0016870 3300046519 Bacteria 4048
503 Ga0495632_0071241 3300046519 Bacteria 1670
504 Ga0495637_0018732 3300046520 Bacteria 3208
505 Ga0495648_0000424 3300046524 Bacteria 46425
506 Ga0495609_0026527 3300046538 Bacteria 2652
507 Ga0495668_0012653 3300046616 Bacteria 5000
508 Ga0495611_0000001 3300046648 Bacteria 2628469
509 Ga0495611_0000955 3300046648 Bacteria 15433
510 Ga0495625_0000001 3300046660 Bacteria 1641829
511 Ga0495625_0018610 3300046660 Bacteria 5415
512 Ga0495625_0022138 3300046660 Bacteria 4878
513 Ga0495625_0027249 3300046660 Bacteria 4305
514 Ga0495661_0001772 3300046665 Bacteria 17368
515 Ga0495661_0063471 3300046665 Bacteria 2183
516 Ga0495670_0002102 3300046691 Bacteria 9827
517 Ga0495670_0057167 3300046691 Bacteria 1958
518 Ga0495670_0062949 3300046691 Bacteria 1867
519 Ga0495671_0000552 3300046692 Bacteria 28021
520 Ga0495589_0000272 3300046794 Bacteria 42126
521 Ga0495660_0000746 3300046810 Bacteria 24565
522 Ga0495660_0001683 3300046810 Bacteria 14811
523 Ga0495683_0002438 3300047323 Bacteria 11243
524 Ga0495679_000001 3300047446 Bacteria 1607568
525 Ga0495673_0000001 3300047469 Bacteria 1630730
526 Ga0495673_0000099 3300047469 Bacteria 179978
527 Ga0495673_0002188 3300047469 Bacteria 14190
528 Ga0495681_0033967 3300047470 Bacteria 2547
529 Ga0495686_0000255 3300047472 Bacteria 95600
530 Ga0495686_0000276 3300047472 Bacteria 91066
531 Ga0495686_0202759 3300047472 Bacteria 1137
532 Ga0496100_0168472 3300048903 Bacteria 1575
533 Ga0496101_0000936 3300048904 Bacteria 17238
534 Ga0496101_0085001 3300048904 Bacteria 2344
535 Ga0496102_0007152 3300048905 Bacteria 9527
536 Ga0496102_0211519 3300048905 Bacteria 1828
537 Ga0496106_0000153 3300048909 Bacteria 51161
538 Ga0496106_0174461 3300048909 Bacteria 1705
539 Ga0496107_0008205 3300048910 Bacteria 7222
540 Ga0496108_0148653 3300048911 Bacteria 2021
541 Ga0496112_0199481 3300048915 Bacteria 1961
542 Ga0496113_0013168 3300048916 Bacteria 5590
543 Ga0496116_0137687 3300048919 Bacteria 1379
544 Ga0496116_0139433 3300048919 Bacteria 1367
545 Ga0496116_0178578 3300048919 Bacteria 1140
546 Ga0496117_0108213 3300048920 Bacteria 1739
547 Ga0496117_0193852 3300048920 Bacteria 1154
548 Ga0496118_0000749 3300048921 Bacteria 52548
549 Ga0496118_0006551 3300048921 Bacteria 12736
550 Ga0496119_0031754 3300048922 Bacteria 3533
551 Ga0496119_0120649 3300048922 Bacteria 1441
552 Ga0496120_0002521 3300048923 Bacteria 18302
553 Ga0496121_0000210 3300048924 Bacteria 128287
554 Ga0496121_0003580 3300048924 Bacteria 21935
555 Ga0496122_0026085 3300048925 Bacteria 5054
556 Ga0496122_0029343 3300048925 Bacteria 4642
557 Ga0496123_0003137 3300048926 Bacteria 18959
558 Ga0496123_0024748 3300048926 Bacteria 4551
559 Ga0496123_0090032 3300048926 Bacteria 1826
560 Ga0496124_0000582 3300048927 Bacteria 61634
561 Ga0496124_0005258 3300048927 Bacteria 14649
562 Ga0496124_0133656 3300048927 Bacteria 1967
563 Ga0496125_0003846 3300048928 Bacteria 17813
564 Ga0496126_0025112 3300048929 Bacteria 5740
565 Ga0496126_0031117 3300048929 Bacteria 5047
566 Ga0496126_0122272 3300048929 Bacteria 2256
567 Ga0495678_000207 3300049459 Bacteria 68441
568 Ga0495682_0002356 3300049460 Bacteria 8981
569 Ga0501292_004593 3300049515 Bacteria 1895
570 Ga0501297_013275 3300049520 Bacteria 965
571 Ga0501034_0187478 3300049571 Bacteria 2031
572 Ga0501067_0113537 3300049583 Bacteria 1506
573 Ga0501070_0012849 3300049586 Bacteria 7056
574 Ga0501070_0045118 3300049586 Bacteria 3666
575 Ga0501073_0007135 3300049589 Bacteria 8323
576 Ga0501074_0135993 3300049590 Bacteria 1758
577 Ga0501198_007283 3300049649 Bacteria 1589
578 Ga0501209_086214 3300049656 Bacteria 909
579 Ga0501217_000392 3300049661 Bacteria 7053
580 Ga0501223_002306 3300049663 Bacteria 4257
581 Ga0501227_000419 3300049665 Bacteria 9050
582 Ga0501233_003913 3300049668 Bacteria 2700
583 Ga0501235_006699 3300049669 Bacteria 2507
584 Ga0501240_003036 3300049673 Bacteria 1838
585 Ga0501249_040329 3300049679 Bacteria 1057
586 Ga0501257_060683 3300049686 Bacteria 955
587 Ga0501225_0002302 3300049705 Bacteria 5901
588 Ga0501225_0023550 3300049705 Bacteria 1697
589 Ga0501225_0043422 3300049705 Bacteria 1242
590 Ga0501234_001008 3300049707 Bacteria 4471
591 Ga0501080_0150206 3300049742 Bacteria 2154
592 Ga0501080_0271423 3300049742 Bacteria 1543
593 Ga0501083_0025015 3300049744 Bacteria 4135
594 Ga0501263_009137 3300049760 Unclassified 1196
595 Ga0501226_007012 3300049853 Bacteria 1268
596 nmdc:mga05p37_280222_c1 3300050507 Bacteria 1988
597 nmdc:mga05p37_82913_c1 3300050507 Unclassified 3951
598 nmdc:mga05p37_895598_c1 3300050507 Bacteria 957
599 nmdc:mga09592_119509_c1 3300050508 Bacteria 2263
600 nmdc:mga09592_269791_c1 3300050508 Bacteria 1476
601 nmdc:mga0qj67_348786_c1 3300050509 Bacteria 1197
602 nmdc:mga0qj67_47167_c1 3300050509 Bacteria 3403
603 nmdc:mga06r32_271040_c1 3300050510 Bacteria 1685
604 nmdc:mga08y16_17931_c1 3300050511 Bacteria 7459
605 nmdc:mga08y16_244383_c1 3300050511 Unclassified 1855
606 nmdc:mga08y16_4046_c1 3300050511 Bacteria 15302
607 nmdc:mga0n895_601073_c1 3300050512 Unclassified 1102
608 nmdc:mga0rr50_72054_c1 3300050513 Bacteria 2638
609 nmdc:mga0a205_177982_c1 3300050515 Bacteria 2022
610 nmdc:mga0a205_198289_c1 3300050515 Bacteria 1898
611 nmdc:mga0a205_44105_c1 3300050515 Bacteria 4298
612 nmdc:mga0sz30_21548_c1 3300050516 Bacteria 2609
613 nmdc:mga0sz30_74707_c1 3300050516 Bacteria 1462
614 Ga0500643_000002 3300053087 Bacteria 1277657
615 Ga0500555_001433 3300053103 Bacteria 7310
616 Ga0500622_0000001 3300053156 Bacteria 657715
617 Ga0500633_0027065 3300053160 Bacteria 1811
618 Ga0500645_000733 3300053730 Bacteria 20211
619 Ga0501082_0066014 3300060353 Bacteria 3116
620 Ga0466962_0002526 3300061719 Bacteria 8691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100337899 Ga0307408_1003378992 228
2 3300005842 Ga0068858_100044656 Ga0068858_1000446562 237
3 3300005843 Ga0068860_100004070 Ga0068860_10000407014 237
4 3300006881 Ga0068865_100059439 Ga0068865_1000594393 237
5 3300014326 Ga0157380_10360913 Ga0157380_103609132 237
6 3300025938 Ga0207704_10081187 Ga0207704_100811872 237
7 3300028381 Ga0268264_10016780 Ga0268264_100167803 237
8 3300032004 Ga0307414_10006856 Ga0307414_100068565 237
9 3300005331 Ga0070670_100000324 Ga0070670_10000032430 240
10 3300005354 Ga0070675_100308208 Ga0070675_1003082082 240
11 3300005617 Ga0068859_101409112 Ga0068859_1014091121 240
12 3300006931 Ga0097620_101409041 Ga0097620_1014090411 240
13 3300014325 Ga0163163_10002165 Ga0163163_1000216511 240
14 3300014745 Ga0157377_10294520 Ga0157377_102945202 240
15 3300025925 Ga0207650_10000112 Ga0207650_1000011232 240
16 3300025926 Ga0207659_10106640 Ga0207659_101066403 240
17 3300026075 Ga0207708_10112728 Ga0207708_101127283 240
18 3300009176 Ga0105242_10090605 Ga0105242_100906054 241
19 3300025933 Ga0207706_10671388 Ga0207706_106713882 241
20 3300025918 Ga0207662_10122369 Ga0207662_101223692 242
21 3300026035 Ga0207703_10375362 Ga0207703_103753622 242
22 3300005441 Ga0070700_100000042 Ga0070700_10000004268 243
23 3300006852 Ga0075433_10055957 Ga0075433_100559572 243
24 3300006880 Ga0075429_100143689 Ga0075429_1001436892 243
25 3300013308 Ga0157375_10712952 Ga0157375_107129522 243
26 3300026075 Ga0207708_10000074 Ga0207708_1000007448 243
27 3300049571 Ga0501034_0187478 Ga0501034_0187478_352_1134 243
28 3300049583 Ga0501067_0113537 Ga0501067_0113537_472_1254 243
29 3300049586 Ga0501070_0045118 Ga0501070_0045118_532_1314 243
30 3300049589 Ga0501073_0007135 Ga0501073_0007135_679_1461 243
31 3300049590 Ga0501074_0135993 Ga0501074_0135993_585_1367 243
32 3300049742 Ga0501080_0271423 Ga0501080_0271423_424_1206 243
33 3300049744 Ga0501083_0025015 Ga0501083_0025015_3064_3846 243
34 3300050508 nmdc:mga09592_119509_c1 nmdc:mga09592_119509_c1_1092_1841 243
35 3300050510 nmdc:mga06r32_271040_c1 nmdc:mga06r32_271040_c1_162_911 243
36 3300060353 Ga0501082_0066014 Ga0501082_0066014_2213_2995 243
37 3300003203 JGI25406J46586_10014833 JGI25406J46586_100148333 244
38 3300005288 Ga0065714_10064432 Ga0065714_10064432107 244
39 3300005289 Ga0065704_10234515 Ga0065704_102345151 244
40 3300005290 Ga0065712_10067730 Ga0065712_10067730107 244
41 3300005293 Ga0065715_10121787 Ga0065715_101217873 244
42 3300005293 Ga0065715_10411379 Ga0065715_104113791 244
43 3300005334 Ga0068869_100018668 Ga0068869_1000186682 244
44 3300005337 Ga0070682_100002049 Ga0070682_1000020492 244
45 3300005340 Ga0070689_100011673 Ga0070689_1000116737 244
46 3300005345 Ga0070692_10018538 Ga0070692_100185382 244
47 3300005345 Ga0070692_10022138 Ga0070692_100221384 244
48 3300005366 Ga0070659_100355356 Ga0070659_1003553561 244
49 3300005366 Ga0070659_100506015 Ga0070659_1005060151 244
50 3300005406 Ga0070703_10042242 Ga0070703_100422422 244
51 3300005440 Ga0070705_100377643 Ga0070705_1003776432 244
52 3300005441 Ga0070700_100007847 Ga0070700_1000078473 244
53 3300005441 Ga0070700_100169994 Ga0070700_1001699942 244
54 3300005444 Ga0070694_100122443 Ga0070694_1001224432 244
55 3300005444 Ga0070694_100184655 Ga0070694_1001846552 244
56 3300005444 Ga0070694_100333824 Ga0070694_1003338242 244
57 3300005459 Ga0068867_100420511 Ga0068867_1004205112 244
58 3300005467 Ga0070706_100000480 Ga0070706_10000048018 244
59 3300005471 Ga0070698_100079102 Ga0070698_1000791022 244
60 3300005518 Ga0070699_100002826 Ga0070699_1000028269 244
61 3300005518 Ga0070699_100013038 Ga0070699_1000130387 244
62 3300005518 Ga0070699_100238296 Ga0070699_1002382963 244
63 3300005530 Ga0070679_100145625 Ga0070679_1001456252 244
64 3300005547 Ga0070693_100000402 Ga0070693_1000004027 244
65 3300005564 Ga0070664_100157169 Ga0070664_1001571693 244
66 3300005578 Ga0068854_100187328 Ga0068854_1001873282 244
67 3300005614 Ga0068856_100807426 Ga0068856_1008074261 244
68 3300005615 Ga0070702_100109460 Ga0070702_1001094602 244
69 3300005617 Ga0068859_100041310 Ga0068859_1000413105 244
70 3300005617 Ga0068859_100057602 Ga0068859_1000576023 244
71 3300005617 Ga0068859_100059419 Ga0068859_1000594192 244
72 3300005617 Ga0068859_100070970 Ga0068859_1000709702 244
73 3300005617 Ga0068859_100272047 Ga0068859_1002720472 244
74 3300005617 Ga0068859_100517625 Ga0068859_1005176251 244
75 3300005618 Ga0068864_100013842 Ga0068864_1000138425 244
76 3300005618 Ga0068864_100209229 Ga0068864_1002092292 244
77 3300005719 Ga0068861_100031108 Ga0068861_1000311083 244
78 3300005834 Ga0068851_10168100 Ga0068851_101681001 244
79 3300005840 Ga0068870_10015961 Ga0068870_100159612 244
80 3300005840 Ga0068870_10031416 Ga0068870_100314163 244
81 3300005841 Ga0068863_100050680 Ga0068863_1000506804 244
82 3300005841 Ga0068863_100207210 Ga0068863_1002072103 244
83 3300005841 Ga0068863_100461878 Ga0068863_1004618782 244
84 3300005842 Ga0068858_100074702 Ga0068858_1000747023 244
85 3300005842 Ga0068858_100229282 Ga0068858_1002292822 244
86 3300005842 Ga0068858_100939546 Ga0068858_1009395461 244
87 3300005843 Ga0068860_100524365 Ga0068860_1005243652 244
88 3300005843 Ga0068860_100528754 Ga0068860_1005287542 244
89 3300005843 Ga0068860_100550702 Ga0068860_1005507021 244
90 3300005844 Ga0068862_100122364 Ga0068862_1001223643 244
91 3300005844 Ga0068862_100647980 Ga0068862_1006479801 244
92 3300005985 Ga0081539_10000395 Ga0081539_1000039584 244
93 3300006194 Ga0075427_10014721 Ga0075427_100147212 244
94 3300006844 Ga0075428_100023016 Ga0075428_1000230167 244
95 3300006844 Ga0075428_100533438 Ga0075428_1005334382 244
96 3300006846 Ga0075430_100018829 Ga0075430_1000188295 244
97 3300006852 Ga0075433_10011090 Ga0075433_100110902 244
98 3300006852 Ga0075433_10227612 Ga0075433_102276122 244
99 3300006852 Ga0075433_10455828 Ga0075433_104558282 244
100 3300006931 Ga0097620_100041307 Ga0097620_1000413075 244
101 3300006931 Ga0097620_100057603 Ga0097620_1000576034 244
102 3300006931 Ga0097620_100059419 Ga0097620_1000594195 244
103 3300006931 Ga0097620_100070964 Ga0097620_1000709644 244
104 3300006931 Ga0097620_100272035 Ga0097620_1002720352 244
105 3300006931 Ga0097620_100517639 Ga0097620_1005176391 244
106 3300007076 Ga0075435_100095799 Ga0075435_1000957993 244
107 3300009011 Ga0105251_10092651 Ga0105251_100926511 244
108 3300009094 Ga0111539_10000296 Ga0111539_100002967 244
109 3300009094 Ga0111539_10081498 Ga0111539_100814985 244
110 3300009101 Ga0105247_10000635 Ga0105247_1000063514 244
111 3300009101 Ga0105247_10104789 Ga0105247_101047892 244
112 3300009101 Ga0105247_10169785 Ga0105247_101697852 244
113 3300009101 Ga0105247_10175818 Ga0105247_101758182 244
114 3300009147 Ga0114129_10471560 Ga0114129_104715602 244
115 3300009147 Ga0114129_10963575 Ga0114129_109635752 244
116 3300009174 Ga0105241_10030898 Ga0105241_100308983 244
117 3300009177 Ga0105248_10011331 Ga0105248_100113312 244
118 3300009177 Ga0105248_10030093 Ga0105248_100300933 244
119 3300009177 Ga0105248_10101139 Ga0105248_101011392 244
120 3300009177 Ga0105248_10329703 Ga0105248_103297032 244
121 3300009177 Ga0105248_10410793 Ga0105248_104107932 244
122 3300009545 Ga0105237_10003124 Ga0105237_1000312420 244
123 3300009545 Ga0105237_10228375 Ga0105237_102283752 244
124 3300009551 Ga0105238_10104245 Ga0105238_101042452 244
125 3300009553 Ga0105249_10019898 Ga0105249_100198986 244
126 3300010375 Ga0105239_10259891 Ga0105239_102598912 244
127 3300010375 Ga0105239_10409733 Ga0105239_104097332 244
128 3300010375 Ga0105239_10798242 Ga0105239_107982422 244
129 3300013306 Ga0163162_10148758 Ga0163162_101487583 244
130 3300013306 Ga0163162_10479234 Ga0163162_104792342 244
131 3300013308 Ga0157375_10032881 Ga0157375_100328814 244
132 3300014325 Ga0163163_10006156 Ga0163163_100061564 244
133 3300014968 Ga0157379_10167018 Ga0157379_101670181 244
134 3300025321 Ga0207656_10118881 Ga0207656_101188811 244
135 3300025885 Ga0207653_10007366 Ga0207653_100073662 244
136 3300025904 Ga0207647_10000445 Ga0207647_100004456 244
137 3300025908 Ga0207643_10013247 Ga0207643_100132475 244
138 3300025908 Ga0207643_10036221 Ga0207643_100362213 244
139 3300025910 Ga0207684_10000533 Ga0207684_1000053332 244
140 3300025913 Ga0207695_10058106 Ga0207695_100581063 244
141 3300025914 Ga0207671_10087816 Ga0207671_100878162 244
142 3300025914 Ga0207671_10209106 Ga0207671_102091062 244
143 3300025918 Ga0207662_10017703 Ga0207662_100177035 244
144 3300025918 Ga0207662_10117514 Ga0207662_101175143 244
145 3300025932 Ga0207690_10432294 Ga0207690_104322941 244
146 3300025934 Ga0207686_10058638 Ga0207686_100586383 244
147 3300025935 Ga0207709_10005963 Ga0207709_100059637 244
148 3300025936 Ga0207670_10000957 Ga0207670_1000095712 244
149 3300025936 Ga0207670_10302494 Ga0207670_103024942 244
150 3300025941 Ga0207711_10023901 Ga0207711_100239013 244
151 3300025941 Ga0207711_10063735 Ga0207711_100637354 244
152 3300025941 Ga0207711_10444669 Ga0207711_104446692 244
153 3300025942 Ga0207689_10064726 Ga0207689_100647264 244
154 3300025942 Ga0207689_10082829 Ga0207689_100828292 244
155 3300025942 Ga0207689_10267860 Ga0207689_102678603 244
156 3300025961 Ga0207712_10007304 Ga0207712_100073047 244
157 3300025981 Ga0207640_10268688 Ga0207640_102686882 244
158 3300026035 Ga0207703_10064235 Ga0207703_100642352 244
159 3300026035 Ga0207703_10634763 Ga0207703_106347632 244
160 3300026075 Ga0207708_10005201 Ga0207708_100052019 244
161 3300026075 Ga0207708_10030970 Ga0207708_100309703 244
162 3300026088 Ga0207641_10029218 Ga0207641_100292184 244
163 3300026088 Ga0207641_10104130 Ga0207641_101041302 244
164 3300026088 Ga0207641_10120209 Ga0207641_101202092 244
165 3300026088 Ga0207641_10217080 Ga0207641_102170803 244
166 3300026095 Ga0207676_10002522 Ga0207676_1000252211 244
167 3300026116 Ga0207674_10075626 Ga0207674_100756264 244
168 3300026118 Ga0207675_100098816 Ga0207675_1000988163 244
169 3300028381 Ga0268264_10129413 Ga0268264_101294133 244
170 3300028381 Ga0268264_10267572 Ga0268264_102675722 244
171 3300031548 Ga0307408_100459729 Ga0307408_1004597292 244
172 3300031548 Ga0307408_100725722 Ga0307408_1007257222 244
173 3300031824 Ga0307413_10144233 Ga0307413_101442332 244
174 3300031852 Ga0307410_10028486 Ga0307410_100284865 244
175 3300031901 Ga0307406_10003612 Ga0307406_100036126 244
176 3300032004 Ga0307414_10002715 Ga0307414_100027157 244
177 3300032005 Ga0307411_10008953 Ga0307411_100089533 244
178 3300032126 Ga0307415_100003868 Ga0307415_1000038685 244
179 3300035088 Ga0373940_0103440 Ga0373940_0103440_32_784 244
180 3300035207 Ga0373942_0057000 Ga0373942_0057000_181_933 244
181 3300038996 Ga0242420_001924 Ga0242420_001924_2025_2777 244
182 3300045051 Ga0451576_0881643 Ga0451576_0881643_56_808 244
183 3300048909 Ga0496106_0174461 Ga0496106_0174461_759_1511 244
184 3300048911 Ga0496108_0148653 Ga0496108_0148653_261_1013 244
185 3300048915 Ga0496112_0199481 Ga0496112_0199481_329_1081 244
186 3300048916 Ga0496113_0013168 Ga0496113_0013168_2158_2910 244
187 3300049515 Ga0501292_004593 Ga0501292_004593_1032_1784 244
188 3300049520 Ga0501297_013275 Ga0501297_013275_25_777 244
189 3300049649 Ga0501198_007283 Ga0501198_007283_562_1314 244
190 3300049656 Ga0501209_086214 Ga0501209_086214_49_801 244
191 3300049661 Ga0501217_000392 Ga0501217_000392_4056_4808 244
192 3300049663 Ga0501223_002306 Ga0501223_002306_3243_3995 244
193 3300049665 Ga0501227_000419 Ga0501227_000419_2474_3226 244
194 3300049668 Ga0501233_003913 Ga0501233_003913_211_963 244
195 3300049669 Ga0501235_006699 Ga0501235_006699_272_1024 244
196 3300049673 Ga0501240_003036 Ga0501240_003036_829_1581 244
197 3300049679 Ga0501249_040329 Ga0501249_040329_35_787 244
198 3300049686 Ga0501257_060683 Ga0501257_060683_151_903 244
199 3300049705 Ga0501225_0002302 Ga0501225_0002302_3006_3758 244
200 3300049705 Ga0501225_0023550 Ga0501225_0023550_80_832 244
201 3300049705 Ga0501225_0043422 Ga0501225_0043422_13_765 244
202 3300049707 Ga0501234_001008 Ga0501234_001008_578_1330 244
203 3300049760 Ga0501263_009137 Ga0501263_009137_30_782 244
204 3300049853 Ga0501226_007012 Ga0501226_007012_171_923 244
205 3300050507 nmdc:mga05p37_82913_c1 nmdc:mga05p37_82913_c1_3040_3792 244
206 3300050507 nmdc:mga05p37_895598_c1 nmdc:mga05p37_895598_c1_24_776 244
207 3300050508 nmdc:mga09592_269791_c1 nmdc:mga09592_269791_c1_577_1329 244
208 3300050509 nmdc:mga0qj67_348786_c1 nmdc:mga0qj67_348786_c1_15_767 244
209 3300050509 nmdc:mga0qj67_47167_c1 nmdc:mga0qj67_47167_c1_2492_3244 244
210 3300050511 nmdc:mga08y16_17931_c1 nmdc:mga08y16_17931_c1_3797_4549 244
211 3300050511 nmdc:mga08y16_244383_c1 nmdc:mga08y16_244383_c1_344_1096 244
212 3300050512 nmdc:mga0n895_601073_c1 nmdc:mga0n895_601073_c1_125_877 244
213 3300050513 nmdc:mga0rr50_72054_c1 nmdc:mga0rr50_72054_c1_31_783 244
214 3300050515 nmdc:mga0a205_177982_c1 nmdc:mga0a205_177982_c1_143_895 244
215 3300050515 nmdc:mga0a205_198289_c1 nmdc:mga0a205_198289_c1_549_1301 244
216 3300050515 nmdc:mga0a205_44105_c1 nmdc:mga0a205_44105_c1_2368_3120 244
217 3300042144 Ga0450889_003766 Ga0450889_003766_463_1221 246
218 3300042157 Ga0439458_0002859 Ga0439458_0002859_88_846 246
219 3300005440 Ga0070705_100362117 Ga0070705_1003621171 248
220 iso_pu_bacteria 2919534386 2919537716 248
221 iso_pu_bacteria 2739367655 2739613150 249
222 iso_pu_bacteria 8002392321 8002394550 249
223 iso_pu_bacteria 8048746797 8048749572 249
224 3300037466 Ga0395898_0053030 Ga0395898_0053030_2594_3391 250
225 iso_pu_bacteria 2537561836 2538832412 250
226 iso_pu_bacteria 2643221562 2643830433 250
227 iso_pu_bacteria 2687453130 2687582456 250
228 3300005458 Ga0070681_10012618 Ga0070681_100126187 251
229 3300005549 Ga0070704_100393916 Ga0070704_1003939162 251
230 3300025912 Ga0207707_10023298 Ga0207707_100232984 251
231 3300042876 Ga0451577_0062915 Ga0451577_0062915_510_1268 251
232 3300045051 Ga0451576_0000490 Ga0451576_0000490_80095_80853 251
233 iso_pu_bacteria 2593339238 2595445748 251
234 iso_pu_bacteria 2593339239 2595449399 251
235 iso_pu_bacteria 2738543009 2739227417 251
236 iso_pu_bacteria 2818991440 2819563884 251
237 iso_pu_bacteria 2842914999 2842915599 251
238 iso_pu_bacteria 2842918807 2842919572 251
239 iso_pu_bacteria 2884338543 2884340125 251
240 iso_pu_bacteria 2904463128 2904464520 251
241 iso_pu_bacteria 2919085039 2919085790 251
242 iso_pu_bacteria 2919404418 2919405915 251
243 iso_pu_bacteria 2941471342 2941474609 251
244 iso_pu_bacteria 2953994433 2953997963 251
245 iso_pu_bacteria 8002869464 8002872542 251
246 3300005327 Ga0070658_10040995 Ga0070658_100409954 252
247 3300005329 Ga0070683_100341668 Ga0070683_1003416682 252
248 3300005331 Ga0070670_100171689 Ga0070670_1001716892 252
249 3300005337 Ga0070682_100040957 Ga0070682_1000409573 252
250 3300005338 Ga0068868_100370875 Ga0068868_1003708751 252
251 3300005339 Ga0070660_100063451 Ga0070660_1000634512 252
252 3300005347 Ga0070668_100010998 Ga0070668_1000109984 252
253 3300005354 Ga0070675_100057996 Ga0070675_1000579962 252
254 3300005355 Ga0070671_100007584 Ga0070671_1000075842 252
255 3300005355 Ga0070671_100019383 Ga0070671_1000193833 252
256 3300005356 Ga0070674_100010419 Ga0070674_1000104192 252
257 3300005366 Ga0070659_100017308 Ga0070659_1000173082 252
258 3300005434 Ga0070709_10156858 Ga0070709_101568582 252
259 3300005435 Ga0070714_100028051 Ga0070714_1000280515 252
260 3300005455 Ga0070663_100233621 Ga0070663_1002336212 252
261 3300005456 Ga0070678_100161452 Ga0070678_1001614522 252
262 3300005456 Ga0070678_100365835 Ga0070678_1003658352 252
263 3300005457 Ga0070662_100479855 Ga0070662_1004798552 252
264 3300005458 Ga0070681_10004241 Ga0070681_100042416 252
265 3300005530 Ga0070679_100006483 Ga0070679_1000064833 252
266 3300005530 Ga0070679_100420621 Ga0070679_1004206212 252
267 3300005535 Ga0070684_100046220 Ga0070684_1000462202 252
268 3300005539 Ga0068853_100034519 Ga0068853_1000345194 252
269 3300005539 Ga0068853_100055834 Ga0068853_1000558342 252
270 3300005543 Ga0070672_100016560 Ga0070672_1000165602 252
271 3300005547 Ga0070693_100244316 Ga0070693_1002443161 252
272 3300005563 Ga0068855_100001822 Ga0068855_10000182227 252
273 3300005564 Ga0070664_100000284 Ga0070664_10000028440 252
274 3300005577 Ga0068857_100160021 Ga0068857_1001600212 252
275 3300005577 Ga0068857_100691664 Ga0068857_1006916642 252
276 3300005578 Ga0068854_100012317 Ga0068854_1000123174 252
277 3300005578 Ga0068854_100145988 Ga0068854_1001459882 252
278 3300005614 Ga0068856_100000238 Ga0068856_10000023856 252
279 3300005614 Ga0068856_100055306 Ga0068856_1000553064 252
280 3300005614 Ga0068856_100097250 Ga0068856_1000972502 252
281 3300005834 Ga0068851_10014190 Ga0068851_100141903 252
282 3300005842 Ga0068858_100084713 Ga0068858_1000847133 252
283 3300006175 Ga0070712_100500079 Ga0070712_1005000791 252
284 3300006844 Ga0075428_100035074 Ga0075428_1000350743 252
285 3300009147 Ga0114129_10038447 Ga0114129_100384473 252
286 3300009174 Ga0105241_10036968 Ga0105241_100369684 252
287 3300009545 Ga0105237_10034954 Ga0105237_100349544 252
288 3300009551 Ga0105238_10117867 Ga0105238_101178672 252
289 3300010375 Ga0105239_10218897 Ga0105239_102188972 252
290 3300011119 Ga0105246_10398285 Ga0105246_103982852 252
291 3300013100 Ga0157373_10000145 Ga0157373_100001452 252
292 3300013100 Ga0157373_10013447 Ga0157373_100134472 252
293 3300013100 Ga0157373_10013721 Ga0157373_100137215 252
294 3300013102 Ga0157371_10000174 Ga0157371_1000017438 252
295 3300013104 Ga0157370_10003047 Ga0157370_100030472 252
296 3300013104 Ga0157370_10042286 Ga0157370_100422862 252
297 3300013104 Ga0157370_10436109 Ga0157370_104361092 252
298 3300013105 Ga0157369_10244558 Ga0157369_102445583 252
299 3300013297 Ga0157378_10035172 Ga0157378_100351721 252
300 3300013307 Ga0157372_10020695 Ga0157372_100206954 252
301 3300013307 Ga0157372_10048007 Ga0157372_100480072 252
302 3300013307 Ga0157372_10109277 Ga0157372_101092772 252
303 3300014968 Ga0157379_10024068 Ga0157379_100240685 252
304 3300020070 Ga0206356_11228936 Ga0206356_112289363 252
305 3300020082 Ga0206353_10991319 Ga0206353_109913192 252
306 3300025321 Ga0207656_10208490 Ga0207656_102084901 252
307 3300025903 Ga0207680_10073532 Ga0207680_100735321 252
308 3300025909 Ga0207705_10123931 Ga0207705_101239312 252
309 3300025911 Ga0207654_10049534 Ga0207654_100495342 252
310 3300025912 Ga0207707_10006527 Ga0207707_100065274 252
311 3300025912 Ga0207707_10009412 Ga0207707_100094128 252
312 3300025913 Ga0207695_10092009 Ga0207695_100920092 252
313 3300025915 Ga0207693_10404518 Ga0207693_104045182 252
314 3300025917 Ga0207660_10018985 Ga0207660_100189852 252
315 3300025917 Ga0207660_10072519 Ga0207660_100725192 252
316 3300025919 Ga0207657_10000193 Ga0207657_1000019350 252
317 3300025919 Ga0207657_10000234 Ga0207657_1000023416 252
318 3300025920 Ga0207649_10015990 Ga0207649_100159902 252
319 3300025920 Ga0207649_10016120 Ga0207649_100161202 252
320 3300025921 Ga0207652_10005477 Ga0207652_100054779 252
321 3300025921 Ga0207652_10060943 Ga0207652_100609432 252
322 3300025921 Ga0207652_10180709 Ga0207652_101807093 252
323 3300025923 Ga0207681_10017812 Ga0207681_100178122 252
324 3300025924 Ga0207694_10147102 Ga0207694_101471022 252
325 3300025924 Ga0207694_10297168 Ga0207694_102971681 252
326 3300025925 Ga0207650_10160890 Ga0207650_101608903 252
327 3300025926 Ga0207659_10071561 Ga0207659_100715612 252
328 3300025929 Ga0207664_10078072 Ga0207664_100780722 252
329 3300025931 Ga0207644_10002052 Ga0207644_1000205210 252
330 3300025931 Ga0207644_10084074 Ga0207644_100840743 252
331 3300025932 Ga0207690_10000627 Ga0207690_1000062715 252
332 3300025932 Ga0207690_10276183 Ga0207690_102761832 252
333 3300025933 Ga0207706_10000097 Ga0207706_100000978 252
334 3300025933 Ga0207706_10464704 Ga0207706_104647042 252
335 3300025945 Ga0207679_10023530 Ga0207679_100235301 252
336 3300025949 Ga0207667_10028287 Ga0207667_100282872 252
337 3300025960 Ga0207651_10004426 Ga0207651_100044262 252
338 3300025961 Ga0207712_10465107 Ga0207712_104651072 252
339 3300025972 Ga0207668_10009323 Ga0207668_100093234 252
340 3300025981 Ga0207640_10059818 Ga0207640_100598183 252
341 3300025981 Ga0207640_10071559 Ga0207640_100715593 252
342 3300025986 Ga0207658_10133975 Ga0207658_101339752 252
343 3300026023 Ga0207677_10385048 Ga0207677_103850482 252
344 3300026041 Ga0207639_10009456 Ga0207639_100094567 252
345 3300026041 Ga0207639_10326535 Ga0207639_103265352 252
346 3300026067 Ga0207678_10015018 Ga0207678_100150182 252
347 3300026067 Ga0207678_10042523 Ga0207678_100425233 252
348 3300026078 Ga0207702_10021190 Ga0207702_100211903 252
349 3300026078 Ga0207702_10533868 Ga0207702_105338681 252
350 3300026088 Ga0207641_10059659 Ga0207641_100596592 252
351 3300026116 Ga0207674_10043503 Ga0207674_100435032 252
352 3300026116 Ga0207674_10062147 Ga0207674_100621475 252
353 3300026121 Ga0207683_10131010 Ga0207683_101310102 252
354 3300026142 Ga0207698_10043169 Ga0207698_100431692 252
355 3300028381 Ga0268264_10173582 Ga0268264_101735822 252
356 3300031548 Ga0307408_100001522 Ga0307408_10000152216 252
357 3300031824 Ga0307413_10001172 Ga0307413_100011724 252
358 3300031901 Ga0307406_10316047 Ga0307406_103160472 252
359 3300031903 Ga0307407_10009948 Ga0307407_100099482 252
360 3300031903 Ga0307407_10374759 Ga0307407_103747592 252
361 3300031911 Ga0307412_10082467 Ga0307412_100824672 252
362 3300031911 Ga0307412_10117655 Ga0307412_101176552 252
363 3300032002 Ga0307416_100008950 Ga0307416_1000089502 252
364 3300032004 Ga0307414_10051296 Ga0307414_100512963 252
365 3300032005 Ga0307411_10019968 Ga0307411_100199684 252
366 3300032005 Ga0307411_10028717 Ga0307411_100287172 252
367 3300035090 Ga0373949_0059215 Ga0373949_0059215_142_927 252
368 3300035691 Ga0373931_0020639 Ga0373931_0020639_2246_3031 252
369 3300037418 Ga0395900_0008421 Ga0395900_0008421_8975_9790 252
370 3300037466 Ga0395898_0181060 Ga0395898_0181060_326_1141 252
371 3300048904 Ga0496101_0085001 Ga0496101_0085001_182_967 252
372 3300048905 Ga0496102_0007152 Ga0496102_0007152_1771_2556 252
373 3300048910 Ga0496107_0008205 Ga0496107_0008205_6218_7003 252
374 3300050507 nmdc:mga05p37_280222_c1 nmdc:mga05p37_280222_c1_705_1490 252
375 3300005327 Ga0070658_10007718 Ga0070658_100077186 253
376 3300005340 Ga0070689_100210824 Ga0070689_1002108242 253
377 3300005365 Ga0070688_100055843 Ga0070688_1000558431 253
378 3300005543 Ga0070672_100128033 Ga0070672_1001280332 253
379 3300005549 Ga0070704_100139640 Ga0070704_1001396402 253
380 3300005719 Ga0068861_100281273 Ga0068861_1002812732 253
381 3300009551 Ga0105238_10708059 Ga0105238_107080591 253
382 3300009553 Ga0105249_10332951 Ga0105249_103329512 253
383 3300013306 Ga0163162_10139478 Ga0163162_101394782 253
384 3300025909 Ga0207705_10022212 Ga0207705_100222123 253
385 3300025960 Ga0207651_10204540 Ga0207651_102045401 253
386 3300026116 Ga0207674_10016443 Ga0207674_1001644310 253
387 3300030521 Ga0307511_10000291 Ga0307511_100002916 253
388 3300032002 Ga0307416_100125391 Ga0307416_1001253913 253
389 3300033179 Ga0307507_10114012 Ga0307507_101140122 253
390 3300002705 JGI25156J39149_1003324 JGI25156J39149_10033242 254
391 3300002738 JGI25154J39366_1004852 JGI25154J39366_10048522 254
392 3300002741 JGI25157J39369_1001473 JGI25157J39369_10014733 254
393 3300002741 JGI25157J39369_1003405 JGI25157J39369_10034054 254
394 3300002772 JGI25164J39214_1000587 JGI25164J39214_10005874 254
395 3300003214 JGI25165J46597_1001159 JGI25165J46597_10011594 254
396 3300003756 Ga0055533_1006060 Ga0055533_10060603 254
397 3300003761 Ga0055535_1000395 Ga0055535_10003954 254
398 3300003761 Ga0055535_1001113 Ga0055535_100111313 254
399 3300003762 Ga0055542_1000167 Ga0055542_100016740 254
400 3300003763 Ga0055529_1000908 Ga0055529_10009083 254
401 3300005262 Ga0065165_1006139 Ga0065165_10061396 254
402 3300005563 Ga0068855_100020227 Ga0068855_1000202274 254
403 3300005577 Ga0068857_100014323 Ga0068857_1000143236 254
404 3300005578 Ga0068854_100001800 Ga0068854_1000018006 254
405 3300005617 Ga0068859_100302356 Ga0068859_1003023561 254
406 3300005843 Ga0068860_100130963 Ga0068860_1001309632 254
407 3300005844 Ga0068862_100063373 Ga0068862_1000633733 254
408 3300006844 Ga0075428_100054022 Ga0075428_1000540223 254
409 3300006846 Ga0075430_100253210 Ga0075430_1002532102 254
410 3300006931 Ga0097620_100302356 Ga0097620_1003023561 254
411 3300009093 Ga0105240_10083667 Ga0105240_100836672 254
412 3300013105 Ga0157369_10241690 Ga0157369_102416902 254
413 3300025228 Ga0209672_100198 Ga0209672_10019841 254
414 3300025228 Ga0209672_100599 Ga0209672_10059921 254
415 3300025231 Ga0207427_100036 Ga0207427_100036247 254
416 3300025233 Ga0209437_101013 Ga0209437_1010137 254
417 3300025242 Ga0209258_100035 Ga0209258_100035196 254
418 3300025242 Ga0209258_100379 Ga0209258_10037913 254
419 3300025242 Ga0209258_103102 Ga0209258_1031022 254
420 3300025246 Ga0209646_1005067 Ga0209646_10050673 254
421 3300025250 Ga0209026_1000056 Ga0209026_1000056155 254
422 3300025250 Ga0209026_1000513 Ga0209026_100051316 254
423 3300025250 Ga0209026_1010953 Ga0209026_10109532 254
424 3300025254 Ga0209148_1000045 Ga0209148_100004543 254
425 3300025254 Ga0209148_1000048 Ga0209148_1000048166 254
426 3300025256 Ga0209759_1000166 Ga0209759_100016636 254
427 3300025256 Ga0209759_1000670 Ga0209759_10006704 254
428 3300025261 Ga0209233_1000101 Ga0209233_1000101247 254
429 3300025272 Ga0209455_1000035 Ga0209455_100003543 254
430 3300025272 Ga0209455_1009763 Ga0209455_10097632 254
431 3300025913 Ga0207695_10038674 Ga0207695_100386742 254
432 3300025913 Ga0207695_10103134 Ga0207695_101031342 254
433 3300025949 Ga0207667_10004853 Ga0207667_100048539 254
434 3300025981 Ga0207640_10000572 Ga0207640_100005729 254
435 3300026116 Ga0207674_10025639 Ga0207674_100256394 254
436 3300028380 Ga0268265_10055139 Ga0268265_100551393 254
437 3300037312 Ga0395899_0010991 Ga0395899_0010991_2817_3584 254
438 3300037312 Ga0395899_0011924 Ga0395899_0011924_4749_5516 254
439 3300037418 Ga0395900_0000107 Ga0395900_0000107_77600_78367 254
440 3300037418 Ga0395900_0115104 Ga0395900_0115104_1169_1936 254
441 3300037466 Ga0395898_0000078 Ga0395898_0000078_42901_43668 254
442 3300037466 Ga0395898_0101704 Ga0395898_0101704_824_1591 254
443 3300038443 Ga0395901_0978061 Ga0395901_0978061_32_799 254
444 3300044656 Ga0466969_0002513 Ga0466969_0002513_1097_1864 254
445 3300044656 Ga0466969_0024094 Ga0466969_0024094_238_1005 254
446 3300044662 Ga0466976_0269238 Ga0466976_0269238_14_781 254
447 3300044693 Ga0466961_0000906 Ga0466961_0000906_10034_10801 254
448 3300044693 Ga0466961_0002884 Ga0466961_0002884_5915_6682 254
449 3300044693 Ga0466961_0008386 Ga0466961_0008386_2137_2904 254
450 3300044694 Ga0466963_0210316 Ga0466963_0210316_28_795 254
451 3300044706 Ga0466964_0008393 Ga0466964_0008393_2860_3627 254
452 3300044719 Ga0466971_0014434 Ga0466971_0014434_1185_1952 254
453 3300044719 Ga0466971_0072250 Ga0466971_0072250_345_1112 254
454 3300044765 Ga0466970_0005775 Ga0466970_0005775_3983_4750 254
455 3300044842 Ga0466957_0062767 Ga0466957_0062767_808_1575 254
456 3300045049 Ga0466959_0002734 Ga0466959_0002734_7198_7965 254
457 3300045836 Ga0466958_0081242 Ga0466958_0081242_762_1529 254
458 3300045976 Ga0466967_0011210 Ga0466967_0011210_5337_6104 254
459 3300048922 Ga0496119_0031754 Ga0496119_0031754_871_1641 254
460 3300048923 Ga0496120_0002521 Ga0496120_0002521_2458_3228 254
461 3300048929 Ga0496126_0031117 Ga0496126_0031117_2467_3237 254
462 3300053156 Ga0500622_0000001 Ga0500622_0000001_553701_554483 254
463 3300061719 Ga0466962_0002526 Ga0466962_0002526_3203_3970 254
464 3300001904 JGI24736J21556_1003392 JGI24736J21556_10033923 255
465 3300005262 Ga0065165_1000113 Ga0065165_10001139 255
466 3300005327 Ga0070658_10022952 Ga0070658_100229522 255
467 3300005331 Ga0070670_100051251 Ga0070670_1000512513 255
468 3300005335 Ga0070666_10000007 Ga0070666_10000007193 255
469 3300005344 Ga0070661_100122142 Ga0070661_1001221422 255
470 3300005366 Ga0070659_100130734 Ga0070659_1001307342 255
471 3300005367 Ga0070667_100037500 Ga0070667_1000375003 255
472 3300005435 Ga0070714_100003249 Ga0070714_1000032492 255
473 3300005439 Ga0070711_100490752 Ga0070711_1004907521 255
474 3300005444 Ga0070694_100020752 Ga0070694_1000207523 255
475 3300005458 Ga0070681_10098046 Ga0070681_100980463 255
476 3300005530 Ga0070679_100001229 Ga0070679_10000122911 255
477 3300005545 Ga0070695_100042586 Ga0070695_1000425863 255
478 3300005548 Ga0070665_100000817 Ga0070665_10000081724 255
479 3300005577 Ga0068857_100061456 Ga0068857_1000614562 255
480 3300005578 Ga0068854_100097033 Ga0068854_1000970332 255
481 3300005616 Ga0068852_100123517 Ga0068852_1001235173 255
482 3300005834 Ga0068851_10174682 Ga0068851_101746822 255
483 3300005842 Ga0068858_100014053 Ga0068858_1000140533 255
484 3300005843 Ga0068860_100084274 Ga0068860_1000842743 255
485 3300006186 Ga0075369_10022335 Ga0075369_100223353 255
486 3300006844 Ga0075428_100002002 Ga0075428_1000020029 255
487 3300009094 Ga0111539_10001653 Ga0111539_1000165313 255
488 3300009101 Ga0105247_10007410 Ga0105247_100074102 255
489 3300009174 Ga0105241_10026775 Ga0105241_100267753 255
490 3300009551 Ga0105238_10001931 Ga0105238_1000193118 255
491 3300009551 Ga0105238_10164265 Ga0105238_101642653 255
492 3300009551 Ga0105238_10370323 Ga0105238_103703232 255
493 3300010375 Ga0105239_10065981 Ga0105239_100659815 255
494 3300011119 Ga0105246_10020847 Ga0105246_100208472 255
495 3300013104 Ga0157370_10000033 Ga0157370_1000003369 255
496 3300013104 Ga0157370_10009303 Ga0157370_100093038 255
497 3300013104 Ga0157370_10065207 Ga0157370_100652072 255
498 3300013105 Ga0157369_10000107 Ga0157369_1000010749 255
499 3300013105 Ga0157369_10067705 Ga0157369_100677052 255
500 3300013306 Ga0163162_10001668 Ga0163162_100016684 255
501 3300013307 Ga0157372_10033705 Ga0157372_100337053 255
502 3300014497 Ga0182008_10006502 Ga0182008_100065027 255
503 3300014497 Ga0182008_10049075 Ga0182008_100490752 255
504 3300015261 Ga0182006_1000027 Ga0182006_100002738 255
505 3300015262 Ga0182007_10024281 Ga0182007_100242812 255
506 3300015265 Ga0182005_1000054 Ga0182005_100005446 255
507 3300015265 Ga0182005_1013044 Ga0182005_10130441 255
508 3300015265 Ga0182005_1024884 Ga0182005_10248842 255
509 3300017792 Ga0163161_10039751 Ga0163161_100397512 255
510 3300025226 Ga0209674_100711 Ga0209674_1007113 255
511 3300025229 Ga0209147_108415 Ga0209147_1084152 255
512 3300025233 Ga0209437_101381 Ga0209437_1013811 255
513 3300025254 Ga0209148_1003490 Ga0209148_10034905 255
514 3300025292 Ga0209676_1002569 Ga0209676_10025692 255
515 3300025297 Ga0209758_1025347 Ga0209758_10253473 255
516 3300025304 Ga0209257_1050858 Ga0209257_10508582 255
517 3300025321 Ga0207656_10094643 Ga0207656_100946432 255
518 3300025903 Ga0207680_10000002 Ga0207680_10000002633 255
519 3300025904 Ga0207647_10000548 Ga0207647_1000054822 255
520 3300025904 Ga0207647_10019324 Ga0207647_100193243 255
521 3300025909 Ga0207705_10032332 Ga0207705_100323322 255
522 3300025911 Ga0207654_10098110 Ga0207654_100981102 255
523 3300025912 Ga0207707_10000044 Ga0207707_1000004435 255
524 3300025914 Ga0207671_10087119 Ga0207671_100871192 255
525 3300025917 Ga0207660_10010225 Ga0207660_100102252 255
526 3300025919 Ga0207657_10001113 Ga0207657_100011135 255
527 3300025921 Ga0207652_10000462 Ga0207652_1000046235 255
528 3300025924 Ga0207694_10000177 Ga0207694_1000017723 255
529 3300025924 Ga0207694_10312147 Ga0207694_103121472 255
530 3300025929 Ga0207664_10000884 Ga0207664_1000088410 255
531 3300025942 Ga0207689_10048353 Ga0207689_100483532 255
532 3300025949 Ga0207667_10044577 Ga0207667_100445774 255
533 3300025981 Ga0207640_10112231 Ga0207640_101122312 255
534 3300026078 Ga0207702_10524949 Ga0207702_105249492 255
535 3300026116 Ga0207674_10008517 Ga0207674_100085175 255
536 3300027907 Ga0207428_10015306 Ga0207428_100153063 255
537 3300028379 Ga0268266_10000004 Ga0268266_10000004629 255
538 3300028381 Ga0268264_10074513 Ga0268264_100745133 255
539 3300031824 Ga0307413_10387086 Ga0307413_103870862 255
540 3300032004 Ga0307414_10188432 Ga0307414_101884322 255
541 3300033180 Ga0307510_10001742 Ga0307510_100017428 255
542 3300033180 Ga0307510_10102827 Ga0307510_101028272 255
543 3300038443 Ga0395901_0002361 Ga0395901_0002361_10631_11458 255
544 3300041404 Ga0439436_0000026 Ga0439436_0000026_6561_7328 255
545 3300041413 Ga0439465_0000172 Ga0439465_0000172_14790_15557 255
546 3300041491 Ga0451833_1420711 Ga0451833_1420711_482_1249 255
547 3300042184 Ga0450908_002562 Ga0450908_002562_1165_1932 255
548 3300044672 Ga0466982_0007854 Ga0466982_0007854_3353_4120 255
549 3300044735 Ga0466968_0003694 Ga0466968_0003694_1196_1963 255
550 3300044842 Ga0466957_0489570 Ga0466957_0489570_33_800 255
551 3300045051 Ga0451576_0547136 Ga0451576_0547136_404_1204 255
552 3300046452 Ga0495617_000321 Ga0495617_000321_4202_4969 255
553 3300046452 Ga0495617_000583 Ga0495617_000583_10374_11141 255
554 3300046460 Ga0495638_0000873 Ga0495638_0000873_10819_11586 255
555 3300046471 Ga0495650_0000250 Ga0495650_0000250_47794_48564 255
556 3300046471 Ga0495650_0001452 Ga0495650_0001452_3713_4480 255
557 3300046471 Ga0495650_0050865 Ga0495650_0050865_261_1028 255
558 3300046492 Ga0495585_0000019 Ga0495585_0000019_70496_71263 255
559 3300046492 Ga0495585_0009413 Ga0495585_0009413_4064_4831 255
560 3300046501 Ga0495607_0000250 Ga0495607_0000250_56756_57523 255
561 3300046501 Ga0495607_0000538 Ga0495607_0000538_7281_8048 255
562 3300046501 Ga0495607_0021990 Ga0495607_0021990_3011_3778 255
563 3300046507 Ga0495606_0000665 Ga0495606_0000665_49740_50507 255
564 3300046507 Ga0495606_0000888 Ga0495606_0000888_25603_26370 255
565 3300046507 Ga0495606_0010914 Ga0495606_0010914_3661_4428 255
566 3300046507 Ga0495606_0027722 Ga0495606_0027722_1660_2427 255
567 3300046507 Ga0495606_0070583 Ga0495606_0070583_767_1534 255
568 3300046512 Ga0495610_0007835 Ga0495610_0007835_5172_5939 255
569 3300046513 Ga0495616_0000047 Ga0495616_0000047_24255_25022 255
570 3300046515 Ga0495620_0001659 Ga0495620_0001659_2690_3457 255
571 3300046515 Ga0495620_0009649 Ga0495620_0009649_645_1412 255
572 3300046518 Ga0495631_0001326 Ga0495631_0001326_10061_10828 255
573 3300046518 Ga0495631_0003442 Ga0495631_0003442_3639_4406 255
574 3300046519 Ga0495632_0000080 Ga0495632_0000080_64602_65384 255
575 3300046519 Ga0495632_0016870 Ga0495632_0016870_1738_2505 255
576 3300046519 Ga0495632_0071241 Ga0495632_0071241_460_1227 255
577 3300046520 Ga0495637_0018732 Ga0495637_0018732_1585_2352 255
578 3300046524 Ga0495648_0000424 Ga0495648_0000424_35478_36245 255
579 3300046538 Ga0495609_0026527 Ga0495609_0026527_1695_2462 255
580 3300046616 Ga0495668_0012653 Ga0495668_0012653_3625_4392 255
581 3300046648 Ga0495611_0000001 Ga0495611_0000001_605121_605888 255
582 3300046648 Ga0495611_0000955 Ga0495611_0000955_10421_11188 255
583 3300046660 Ga0495625_0000001 Ga0495625_0000001_1310159_1310926 255
584 3300046660 Ga0495625_0018610 Ga0495625_0018610_1403_2170 255
585 3300046660 Ga0495625_0022138 Ga0495625_0022138_2885_3652 255
586 3300046660 Ga0495625_0027249 Ga0495625_0027249_3165_3932 255
587 3300046665 Ga0495661_0001772 Ga0495661_0001772_6353_7120 255
588 3300046665 Ga0495661_0063471 Ga0495661_0063471_661_1428 255
589 3300046691 Ga0495670_0002102 Ga0495670_0002102_3771_4538 255
590 3300046691 Ga0495670_0057167 Ga0495670_0057167_152_919 255
591 3300046691 Ga0495670_0062949 Ga0495670_0062949_140_907 255
592 3300046692 Ga0495671_0000552 Ga0495671_0000552_16567_17334 255
593 3300046794 Ga0495589_0000272 Ga0495589_0000272_10993_11760 255
594 3300046810 Ga0495660_0000746 Ga0495660_0000746_21120_21887 255
595 3300046810 Ga0495660_0001683 Ga0495660_0001683_2652_3419 255
596 3300047323 Ga0495683_0002438 Ga0495683_0002438_4656_5423 255
597 3300047446 Ga0495679_000001 Ga0495679_000001_982708_983475 255
598 3300047469 Ga0495673_0000001 Ga0495673_0000001_1380508_1381275 255
599 3300047469 Ga0495673_0000099 Ga0495673_0000099_8003_8770 255
600 3300047469 Ga0495673_0002188 Ga0495673_0002188_11157_12050 255
601 3300047470 Ga0495681_0033967 Ga0495681_0033967_395_1162 255
602 3300047472 Ga0495686_0000255 Ga0495686_0000255_45746_46513 255
603 3300047472 Ga0495686_0000276 Ga0495686_0000276_68295_69062 255
604 3300047472 Ga0495686_0202759 Ga0495686_0202759_346_1113 255
605 3300048903 Ga0496100_0168472 Ga0496100_0168472_719_1486 255
606 3300048904 Ga0496101_0000936 Ga0496101_0000936_440_1207 255
607 3300048905 Ga0496102_0211519 Ga0496102_0211519_744_1511 255
608 3300048909 Ga0496106_0000153 Ga0496106_0000153_29845_30612 255
609 3300048919 Ga0496116_0137687 Ga0496116_0137687_446_1213 255
610 3300048919 Ga0496116_0139433 Ga0496116_0139433_211_978 255
611 3300048919 Ga0496116_0178578 Ga0496116_0178578_289_1056 255
612 3300048920 Ga0496117_0108213 Ga0496117_0108213_658_1425 255
613 3300048920 Ga0496117_0193852 Ga0496117_0193852_293_1060 255
614 3300048921 Ga0496118_0000749 Ga0496118_0000749_8952_9719 255
615 3300048921 Ga0496118_0006551 Ga0496118_0006551_1686_2453 255
616 3300048922 Ga0496119_0120649 Ga0496119_0120649_194_961 255
617 3300048924 Ga0496121_0000210 Ga0496121_0000210_55230_55997 255
618 3300048924 Ga0496121_0003580 Ga0496121_0003580_21_788 255
619 3300048925 Ga0496122_0026085 Ga0496122_0026085_634_1401 255
620 3300048925 Ga0496122_0029343 Ga0496122_0029343_102_869 255
621 3300048926 Ga0496123_0003137 Ga0496123_0003137_12057_12824 255
622 3300048926 Ga0496123_0024748 Ga0496123_0024748_607_1374 255
623 3300048926 Ga0496123_0090032 Ga0496123_0090032_938_1705 255
624 3300048927 Ga0496124_0000582 Ga0496124_0000582_53813_54580 255
625 3300048927 Ga0496124_0005258 Ga0496124_0005258_7688_8455 255
626 3300048927 Ga0496124_0133656 Ga0496124_0133656_1132_1899 255
627 3300048928 Ga0496125_0003846 Ga0496125_0003846_11694_12461 255
628 3300048929 Ga0496126_0025112 Ga0496126_0025112_894_1661 255
629 3300048929 Ga0496126_0122272 Ga0496126_0122272_36_806 255
630 3300049459 Ga0495678_000207 Ga0495678_000207_10661_11428 255
631 3300049460 Ga0495682_0002356 Ga0495682_0002356_2753_3520 255
632 3300049586 Ga0501070_0012849 Ga0501070_0012849_611_1396 255
633 3300049742 Ga0501080_0150206 Ga0501080_0150206_390_1175 255
634 3300050511 nmdc:mga08y16_4046_c1 nmdc:mga08y16_4046_c1_10722_11519 255
635 3300050516 nmdc:mga0sz30_21548_c1 nmdc:mga0sz30_21548_c1_1591_2358 255
636 3300050516 nmdc:mga0sz30_74707_c1 nmdc:mga0sz30_74707_c1_424_1191 255
637 3300053087 Ga0500643_000002 Ga0500643_000002_1218564_1219331 255
638 3300053103 Ga0500555_001433 Ga0500555_001433_6525_7292 255
639 3300053160 Ga0500633_0027065 Ga0500633_0027065_958_1725 255
640 3300053730 Ga0500645_000733 Ga0500645_000733_18407_19174 255
641 iso_pu_bacteria 2718218334 2721027944 255
642 iso_pu_bacteria 2734482264 2735836484 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

193

295

0.94

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

57

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9746 2 250
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9671 2 250
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9484 2 250
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9359 2 244
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9227 2 250
ID Description Score Start End Superfamily
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.991 2 104 3.30.70.580
af_A0A0R0F7R0_40_148_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9616 2 104 3.30.70.580
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9584 1 102 3.30.70.580
2nreA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9583 106 241 3.30.70.660
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9552 107 236 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A091BI02-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.994 1 255 GO:0003723
GO:0031119
GO:0160147
AF-A0A432ERJ4-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.994 1 190 GO:0003723
GO:0031119
GO:0160147
AF-A0A1G3ZU20-F1-model_v4 deleted 0.9939 1 255
AF-A0A098GI34-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9932 1 250 GO:0003723
GO:0031119
GO:0160147
AF-A0A1N6VTK7-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9924 2 255 GO:0003723
GO:0031119
GO:0160147

Feature Viewer

pLDDT pTM Quality
94.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map