F471861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 642 | 337 | 620 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10039751|Ga0163161_100397512 |
| Length | 306 |
| Sequence | MLFPEAPVATGAFFVSAAWLSLLKRLPHGVPLGPVGGRVLPFTVSTAPNRPMRIALGVEYDGTDFLGWQRLSHAKTVQGSLEQALSFVAHTPIEVTAAGRTDAGVHGRCQVVHFDTEVVRDLRGWILGACSNLPHAVAVTWAQPVPDDFHARFSARARRYRYRILPRFVRPALDARFVAWERRQIDAEAMNEAAQAIVGEHDFTAFRAISCQAAHARRNVRSIRVFREDIHVVVEIEANAFLHHMVRNIVGSLLRIGRGEEGVGWMAELLAGRDREVAGATAPAEGLTFLGPLYEAHWGLPPEVTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 6 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 7 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 8 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 9 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 10 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 11 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 12 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 13 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 14 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 15 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 16 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 17 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 18 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 19 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 20 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 21 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 22 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 23 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 24 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 27 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 230 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 231 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 232 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044662 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E | Metagenome | Unclassified |
| 236 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 297 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 304 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 306 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 313 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 318 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 331 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 332 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 335 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 336 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 337 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0.31 |
| Isolates | 3.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.61 |
| Nodule | 0 |
| Rhizoplane | 1.71 |
| Rhizosphere | 83.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003392 | 3300001904 | Bacteria | 2768 |
| 2 | JGI25156J39149_1003324 | 3300002705 | Bacteria | 5316 |
| 3 | JGI25154J39366_1004852 | 3300002738 | Bacteria | 2284 |
| 4 | JGI25157J39369_1001473 | 3300002741 | Bacteria | 8720 |
| 5 | JGI25157J39369_1003405 | 3300002741 | Bacteria | 3270 |
| 6 | JGI25164J39214_1000587 | 3300002772 | Bacteria | 16308 |
| 7 | JGI25406J46586_10014833 | 3300003203 | Unclassified | 3303 |
| 8 | JGI25165J46597_1001159 | 3300003214 | Bacteria | 16326 |
| 9 | Ga0055533_1006060 | 3300003756 | Bacteria | 1840 |
| 10 | Ga0055535_1000395 | 3300003761 | Bacteria | 41210 |
| 11 | Ga0055535_1001113 | 3300003761 | Bacteria | 16309 |
| 12 | Ga0055542_1000167 | 3300003762 | Bacteria | 83068 |
| 13 | Ga0055529_1000908 | 3300003763 | Bacteria | 16313 |
| 14 | Ga0065165_1000113 | 3300005262 | Bacteria | 135963 |
| 15 | Ga0065165_1006139 | 3300005262 | Bacteria | 6425 |
| 16 | Ga0065714_10064432 | 3300005288 | Bacteria | 133542 |
| 17 | Ga0065704_10234515 | 3300005289 | Bacteria | 1029 |
| 18 | Ga0065712_10067730 | 3300005290 | Bacteria | 133482 |
| 19 | Ga0065715_10121787 | 3300005293 | Unclassified | 2221 |
| 20 | Ga0065715_10411379 | 3300005293 | Unclassified | 869 |
| 21 | Ga0070658_10007718 | 3300005327 | Bacteria | 8668 |
| 22 | Ga0070658_10022952 | 3300005327 | Bacteria | 5009 |
| 23 | Ga0070658_10040995 | 3300005327 | Bacteria | 3735 |
| 24 | Ga0070683_100341668 | 3300005329 | Bacteria | 1425 |
| 25 | Ga0070670_100000324 | 3300005331 | Bacteria | 40556 |
| 26 | Ga0070670_100051251 | 3300005331 | Bacteria | 3545 |
| 27 | Ga0070670_100171689 | 3300005331 | Bacteria | 1881 |
| 28 | Ga0068869_100018668 | 3300005334 | Bacteria | 4725 |
| 29 | Ga0070666_10000007 | 3300005335 | Bacteria | 293732 |
| 30 | Ga0070682_100002049 | 3300005337 | Bacteria | 11249 |
| 31 | Ga0070682_100040957 | 3300005337 | Bacteria | 2853 |
| 32 | Ga0068868_100370875 | 3300005338 | Unclassified | 1230 |
| 33 | Ga0070660_100063451 | 3300005339 | Bacteria | 2872 |
| 34 | Ga0070689_100011673 | 3300005340 | Bacteria | 6301 |
| 35 | Ga0070689_100210824 | 3300005340 | Bacteria | 1590 |
| 36 | Ga0070661_100122142 | 3300005344 | Bacteria | 1952 |
| 37 | Ga0070692_10018538 | 3300005345 | Bacteria | 3349 |
| 38 | Ga0070692_10022138 | 3300005345 | Bacteria | 3102 |
| 39 | Ga0070668_100010998 | 3300005347 | Bacteria | 6737 |
| 40 | Ga0070675_100057996 | 3300005354 | Bacteria | 3193 |
| 41 | Ga0070675_100308208 | 3300005354 | Bacteria | 1396 |
| 42 | Ga0070671_100007584 | 3300005355 | Bacteria | 8675 |
| 43 | Ga0070671_100019383 | 3300005355 | Bacteria | 5536 |
| 44 | Ga0070674_100010419 | 3300005356 | Bacteria | 5622 |
| 45 | Ga0070688_100055843 | 3300005365 | Bacteria | 2478 |
| 46 | Ga0070659_100017308 | 3300005366 | Bacteria | 5420 |
| 47 | Ga0070659_100130734 | 3300005366 | Bacteria | 2039 |
| 48 | Ga0070659_100355356 | 3300005366 | Unclassified | 1230 |
| 49 | Ga0070659_100506015 | 3300005366 | Bacteria | 1030 |
| 50 | Ga0070667_100037500 | 3300005367 | Bacteria | 4063 |
| 51 | Ga0070703_10042242 | 3300005406 | Unclassified | 1425 |
| 52 | Ga0070709_10156858 | 3300005434 | Bacteria | 1579 |
| 53 | Ga0070714_100003249 | 3300005435 | Bacteria | 12096 |
| 54 | Ga0070714_100028051 | 3300005435 | Bacteria | 4667 |
| 55 | Ga0070711_100490752 | 3300005439 | Bacteria | 1011 |
| 56 | Ga0070705_100362117 | 3300005440 | Unclassified | 1061 |
| 57 | Ga0070705_100377643 | 3300005440 | Bacteria | 1042 |
| 58 | Ga0070700_100000042 | 3300005441 | Bacteria | 99515 |
| 59 | Ga0070700_100007847 | 3300005441 | Bacteria | 5788 |
| 60 | Ga0070700_100169994 | 3300005441 | Unclassified | 1509 |
| 61 | Ga0070694_100020752 | 3300005444 | Bacteria | 4191 |
| 62 | Ga0070694_100122443 | 3300005444 | Bacteria | 1868 |
| 63 | Ga0070694_100184655 | 3300005444 | Bacteria | 1544 |
| 64 | Ga0070694_100333824 | 3300005444 | Unclassified | 1170 |
| 65 | Ga0070663_100233621 | 3300005455 | Bacteria | 1449 |
| 66 | Ga0070678_100161452 | 3300005456 | Bacteria | 1816 |
| 67 | Ga0070678_100365835 | 3300005456 | Bacteria | 1244 |
| 68 | Ga0070662_100479855 | 3300005457 | Bacteria | 1035 |
| 69 | Ga0070681_10004241 | 3300005458 | Bacteria | 13592 |
| 70 | Ga0070681_10012618 | 3300005458 | Bacteria | 8383 |
| 71 | Ga0070681_10098046 | 3300005458 | Bacteria | 2877 |
| 72 | Ga0068867_100420511 | 3300005459 | Bacteria | 1132 |
| 73 | Ga0070706_100000480 | 3300005467 | Bacteria | 47075 |
| 74 | Ga0070698_100079102 | 3300005471 | Bacteria | 3285 |
| 75 | Ga0070699_100002826 | 3300005518 | Bacteria | 15494 |
| 76 | Ga0070699_100013038 | 3300005518 | Bacteria | 7163 |
| 77 | Ga0070699_100238296 | 3300005518 | Bacteria | 1623 |
| 78 | Ga0070679_100001229 | 3300005530 | Bacteria | 22504 |
| 79 | Ga0070679_100006483 | 3300005530 | Bacteria | 10908 |
| 80 | Ga0070679_100145625 | 3300005530 | Bacteria | 2347 |
| 81 | Ga0070679_100420621 | 3300005530 | Bacteria | 1282 |
| 82 | Ga0070684_100046220 | 3300005535 | Bacteria | 3772 |
| 83 | Ga0068853_100034519 | 3300005539 | Bacteria | 4294 |
| 84 | Ga0068853_100055834 | 3300005539 | Bacteria | 3404 |
| 85 | Ga0070672_100016560 | 3300005543 | Bacteria | 5280 |
| 86 | Ga0070672_100128033 | 3300005543 | Bacteria | 2084 |
| 87 | Ga0070695_100042586 | 3300005545 | Unclassified | 2883 |
| 88 | Ga0070693_100000402 | 3300005547 | Bacteria | 19643 |
| 89 | Ga0070693_100244316 | 3300005547 | Bacteria | 1187 |
| 90 | Ga0070665_100000817 | 3300005548 | Bacteria | 40729 |
| 91 | Ga0070704_100139640 | 3300005549 | Bacteria | 1890 |
| 92 | Ga0070704_100393916 | 3300005549 | Bacteria | 1180 |
| 93 | Ga0068855_100001822 | 3300005563 | Bacteria | 26575 |
| 94 | Ga0068855_100020227 | 3300005563 | Bacteria | 7990 |
| 95 | Ga0070664_100000284 | 3300005564 | Bacteria | 36685 |
| 96 | Ga0070664_100157169 | 3300005564 | Bacteria | 2009 |
| 97 | Ga0068857_100014323 | 3300005577 | Bacteria | 6912 |
| 98 | Ga0068857_100061456 | 3300005577 | Bacteria | 3337 |
| 99 | Ga0068857_100160021 | 3300005577 | Bacteria | 2043 |
| 100 | Ga0068857_100691664 | 3300005577 | Bacteria | 968 |
| 101 | Ga0068854_100001800 | 3300005578 | Bacteria | 13042 |
| 102 | Ga0068854_100012317 | 3300005578 | Bacteria | 5597 |
| 103 | Ga0068854_100097033 | 3300005578 | Bacteria | 2203 |
| 104 | Ga0068854_100145988 | 3300005578 | Bacteria | 1820 |
| 105 | Ga0068854_100187328 | 3300005578 | Bacteria | 1620 |
| 106 | Ga0068856_100000238 | 3300005614 | Bacteria | 59833 |
| 107 | Ga0068856_100055306 | 3300005614 | Bacteria | 3916 |
| 108 | Ga0068856_100097250 | 3300005614 | Bacteria | 2933 |
| 109 | Ga0068856_100807426 | 3300005614 | Unclassified | 958 |
| 110 | Ga0070702_100109460 | 3300005615 | Bacteria | 1710 |
| 111 | Ga0068852_100123517 | 3300005616 | Bacteria | 2374 |
| 112 | Ga0068859_100041310 | 3300005617 | Bacteria | 4632 |
| 113 | Ga0068859_100057602 | 3300005617 | Bacteria | 3914 |
| 114 | Ga0068859_100059419 | 3300005617 | Bacteria | 3851 |
| 115 | Ga0068859_100070970 | 3300005617 | Bacteria | 3518 |
| 116 | Ga0068859_100272047 | 3300005617 | Unclassified | 1786 |
| 117 | Ga0068859_100302356 | 3300005617 | Bacteria | 1693 |
| 118 | Ga0068859_100517625 | 3300005617 | Bacteria | 1288 |
| 119 | Ga0068859_101409112 | 3300005617 | Bacteria | 769 |
| 120 | Ga0068864_100013842 | 3300005618 | Bacteria | 6684 |
| 121 | Ga0068864_100209229 | 3300005618 | Bacteria | 1795 |
| 122 | Ga0068861_100031108 | 3300005719 | Bacteria | 3917 |
| 123 | Ga0068861_100281273 | 3300005719 | Bacteria | 1433 |
| 124 | Ga0068851_10014190 | 3300005834 | Bacteria | 3780 |
| 125 | Ga0068851_10168100 | 3300005834 | Bacteria | 1208 |
| 126 | Ga0068851_10174682 | 3300005834 | Bacteria | 1187 |
| 127 | Ga0068870_10015961 | 3300005840 | Bacteria | 3577 |
| 128 | Ga0068870_10031416 | 3300005840 | Bacteria | 2691 |
| 129 | Ga0068863_100050680 | 3300005841 | Bacteria | 3934 |
| 130 | Ga0068863_100207210 | 3300005841 | Bacteria | 1887 |
| 131 | Ga0068863_100461878 | 3300005841 | Bacteria | 1247 |
| 132 | Ga0068858_100014053 | 3300005842 | Bacteria | 7551 |
| 133 | Ga0068858_100044656 | 3300005842 | Bacteria | 4106 |
| 134 | Ga0068858_100074702 | 3300005842 | Bacteria | 3148 |
| 135 | Ga0068858_100084713 | 3300005842 | Bacteria | 2948 |
| 136 | Ga0068858_100229282 | 3300005842 | Bacteria | 1760 |
| 137 | Ga0068858_100939546 | 3300005842 | Unclassified | 846 |
| 138 | Ga0068860_100004070 | 3300005843 | Bacteria | 15007 |
| 139 | Ga0068860_100084274 | 3300005843 | Bacteria | 3024 |
| 140 | Ga0068860_100130963 | 3300005843 | Bacteria | 2407 |
| 141 | Ga0068860_100524365 | 3300005843 | Bacteria | 1185 |
| 142 | Ga0068860_100528754 | 3300005843 | Bacteria | 1180 |
| 143 | Ga0068860_100550702 | 3300005843 | Unclassified | 1156 |
| 144 | Ga0068862_100063373 | 3300005844 | Bacteria | 3181 |
| 145 | Ga0068862_100122364 | 3300005844 | Bacteria | 2295 |
| 146 | Ga0068862_100647980 | 3300005844 | Unclassified | 1019 |
| 147 | Ga0081539_10000395 | 3300005985 | Bacteria | 93818 |
| 148 | Ga0070712_100500079 | 3300006175 | Bacteria | 1019 |
| 149 | Ga0075369_10022335 | 3300006186 | Bacteria | 2609 |
| 150 | Ga0075427_10014721 | 3300006194 | Unclassified | 1202 |
| 151 | Ga0075428_100002002 | 3300006844 | Bacteria | 21951 |
| 152 | Ga0075428_100023016 | 3300006844 | Bacteria | 6895 |
| 153 | Ga0075428_100035074 | 3300006844 | Bacteria | 5530 |
| 154 | Ga0075428_100054022 | 3300006844 | Bacteria | 4402 |
| 155 | Ga0075428_100533438 | 3300006844 | Bacteria | 1255 |
| 156 | Ga0075430_100018829 | 3300006846 | Bacteria | 5873 |
| 157 | Ga0075430_100253210 | 3300006846 | Bacteria | 1459 |
| 158 | Ga0075433_10011090 | 3300006852 | Bacteria | 7248 |
| 159 | Ga0075433_10055957 | 3300006852 | Bacteria | 3445 |
| 160 | Ga0075433_10227612 | 3300006852 | Bacteria | 1656 |
| 161 | Ga0075433_10455828 | 3300006852 | Bacteria | 1127 |
| 162 | Ga0075429_100143689 | 3300006880 | Bacteria | 2088 |
| 163 | Ga0068865_100059439 | 3300006881 | Bacteria | 2673 |
| 164 | Ga0097620_100041307 | 3300006931 | Bacteria | 4632 |
| 165 | Ga0097620_100057603 | 3300006931 | Bacteria | 3914 |
| 166 | Ga0097620_100059419 | 3300006931 | Bacteria | 3851 |
| 167 | Ga0097620_100070964 | 3300006931 | Bacteria | 3518 |
| 168 | Ga0097620_100272035 | 3300006931 | Unclassified | 1786 |
| 169 | Ga0097620_100302356 | 3300006931 | Bacteria | 1693 |
| 170 | Ga0097620_100517639 | 3300006931 | Bacteria | 1288 |
| 171 | Ga0097620_101409041 | 3300006931 | Bacteria | 769 |
| 172 | Ga0075435_100095799 | 3300007076 | Bacteria | 2455 |
| 173 | Ga0105251_10092651 | 3300009011 | Bacteria | 1387 |
| 174 | Ga0105240_10083667 | 3300009093 | Bacteria | 3915 |
| 175 | Ga0111539_10000296 | 3300009094 | Bacteria | 60206 |
| 176 | Ga0111539_10001653 | 3300009094 | Bacteria | 29768 |
| 177 | Ga0111539_10081498 | 3300009094 | Unclassified | 3806 |
| 178 | Ga0105247_10000635 | 3300009101 | Bacteria | 28087 |
| 179 | Ga0105247_10007410 | 3300009101 | Bacteria | 6735 |
| 180 | Ga0105247_10104789 | 3300009101 | Bacteria | 1812 |
| 181 | Ga0105247_10169785 | 3300009101 | Unclassified | 1449 |
| 182 | Ga0105247_10175818 | 3300009101 | Bacteria | 1426 |
| 183 | Ga0114129_10038447 | 3300009147 | Bacteria | 6750 |
| 184 | Ga0114129_10471560 | 3300009147 | Bacteria | 1644 |
| 185 | Ga0114129_10963575 | 3300009147 | Bacteria | 1077 |
| 186 | Ga0105241_10026775 | 3300009174 | Bacteria | 4292 |
| 187 | Ga0105241_10030898 | 3300009174 | Bacteria | 4006 |
| 188 | Ga0105241_10036968 | 3300009174 | Bacteria | 3676 |
| 189 | Ga0105242_10090605 | 3300009176 | Bacteria | 2573 |
| 190 | Ga0105248_10011331 | 3300009177 | Bacteria | 9830 |
| 191 | Ga0105248_10030093 | 3300009177 | Bacteria | 6059 |
| 192 | Ga0105248_10101139 | 3300009177 | Bacteria | 3249 |
| 193 | Ga0105248_10329703 | 3300009177 | Bacteria | 1719 |
| 194 | Ga0105248_10410793 | 3300009177 | Bacteria | 1524 |
| 195 | Ga0105237_10003124 | 3300009545 | Bacteria | 19932 |
| 196 | Ga0105237_10034954 | 3300009545 | Bacteria | 5086 |
| 197 | Ga0105237_10228375 | 3300009545 | Bacteria | 1862 |
| 198 | Ga0105238_10001931 | 3300009551 | Bacteria | 20819 |
| 199 | Ga0105238_10104245 | 3300009551 | Bacteria | 2817 |
| 200 | Ga0105238_10117867 | 3300009551 | Bacteria | 2635 |
| 201 | Ga0105238_10164265 | 3300009551 | Bacteria | 2196 |
| 202 | Ga0105238_10370323 | 3300009551 | Bacteria | 1423 |
| 203 | Ga0105238_10708059 | 3300009551 | Bacteria | 1019 |
| 204 | Ga0105249_10019898 | 3300009553 | Bacteria | 5995 |
| 205 | Ga0105249_10332951 | 3300009553 | Bacteria | 1532 |
| 206 | Ga0105239_10065981 | 3300010375 | Bacteria | 3977 |
| 207 | Ga0105239_10218897 | 3300010375 | Bacteria | 2135 |
| 208 | Ga0105239_10259891 | 3300010375 | Bacteria | 1951 |
| 209 | Ga0105239_10409733 | 3300010375 | Bacteria | 1535 |
| 210 | Ga0105239_10798242 | 3300010375 | Bacteria | 1081 |
| 211 | Ga0105246_10020847 | 3300011119 | Bacteria | 4210 |
| 212 | Ga0105246_10398285 | 3300011119 | Unclassified | 1142 |
| 213 | Ga0157373_10000145 | 3300013100 | Bacteria | 56614 |
| 214 | Ga0157373_10013447 | 3300013100 | Bacteria | 6004 |
| 215 | Ga0157373_10013721 | 3300013100 | Bacteria | 5940 |
| 216 | Ga0157371_10000174 | 3300013102 | Bacteria | 93381 |
| 217 | Ga0157370_10000033 | 3300013104 | Bacteria | 138137 |
| 218 | Ga0157370_10003047 | 3300013104 | Bacteria | 19875 |
| 219 | Ga0157370_10009303 | 3300013104 | Bacteria | 10520 |
| 220 | Ga0157370_10042286 | 3300013104 | Bacteria | 4392 |
| 221 | Ga0157370_10065207 | 3300013104 | Bacteria | 3446 |
| 222 | Ga0157370_10436109 | 3300013104 | Bacteria | 1205 |
| 223 | Ga0157369_10000107 | 3300013105 | Bacteria | 117307 |
| 224 | Ga0157369_10067705 | 3300013105 | Bacteria | 3837 |
| 225 | Ga0157369_10241690 | 3300013105 | Bacteria | 1886 |
| 226 | Ga0157369_10244558 | 3300013105 | Bacteria | 1873 |
| 227 | Ga0157378_10035172 | 3300013297 | Bacteria | 4430 |
| 228 | Ga0163162_10001668 | 3300013306 | Bacteria | 20833 |
| 229 | Ga0163162_10139478 | 3300013306 | Bacteria | 2537 |
| 230 | Ga0163162_10148758 | 3300013306 | Bacteria | 2459 |
| 231 | Ga0163162_10479234 | 3300013306 | Unclassified | 1376 |
| 232 | Ga0157372_10020695 | 3300013307 | Bacteria | 7100 |
| 233 | Ga0157372_10033705 | 3300013307 | Bacteria | 5627 |
| 234 | Ga0157372_10048007 | 3300013307 | Bacteria | 4746 |
| 235 | Ga0157372_10109277 | 3300013307 | Bacteria | 3166 |
| 236 | Ga0157375_10032881 | 3300013308 | Bacteria | 4923 |
| 237 | Ga0157375_10712952 | 3300013308 | Bacteria | 1156 |
| 238 | Ga0163163_10002165 | 3300014325 | Bacteria | 16602 |
| 239 | Ga0163163_10006156 | 3300014325 | Bacteria | 10458 |
| 240 | Ga0157380_10360913 | 3300014326 | Bacteria | 1363 |
| 241 | Ga0182008_10006502 | 3300014497 | Bacteria | 6526 |
| 242 | Ga0182008_10049075 | 3300014497 | Bacteria | 2095 |
| 243 | Ga0157377_10294520 | 3300014745 | Bacteria | 1069 |
| 244 | Ga0157379_10024068 | 3300014968 | Bacteria | 5404 |
| 245 | Ga0157379_10167018 | 3300014968 | Bacteria | 1986 |
| 246 | Ga0182006_1000027 | 3300015261 | Bacteria | 252946 |
| 247 | Ga0182007_10024281 | 3300015262 | Bacteria | 2122 |
| 248 | Ga0182005_1000054 | 3300015265 | Bacteria | 112885 |
| 249 | Ga0182005_1013044 | 3300015265 | Bacteria | 2340 |
| 250 | Ga0182005_1024884 | 3300015265 | Bacteria | 1634 |
| 251 | Ga0163161_10039751 | 3300017792 | Bacteria | 3378 |
| 252 | Ga0206356_11228936 | 3300020070 | Bacteria | 2725 |
| 253 | Ga0206353_10991319 | 3300020082 | Bacteria | 4713 |
| 254 | Ga0209674_100711 | 3300025226 | Bacteria | 11455 |
| 255 | Ga0209672_100198 | 3300025228 | Bacteria | 47906 |
| 256 | Ga0209672_100599 | 3300025228 | Bacteria | 18942 |
| 257 | Ga0209147_108415 | 3300025229 | Bacteria | 1282 |
| 258 | Ga0207427_100036 | 3300025231 | Bacteria | 309540 |
| 259 | Ga0209437_101013 | 3300025233 | Bacteria | 9710 |
| 260 | Ga0209437_101381 | 3300025233 | Bacteria | 6152 |
| 261 | Ga0209258_100035 | 3300025242 | Bacteria | 430864 |
| 262 | Ga0209258_100379 | 3300025242 | Bacteria | 57256 |
| 263 | Ga0209258_103102 | 3300025242 | Bacteria | 3784 |
| 264 | Ga0209646_1005067 | 3300025246 | Bacteria | 2335 |
| 265 | Ga0209026_1000056 | 3300025250 | Bacteria | 236450 |
| 266 | Ga0209026_1000513 | 3300025250 | Bacteria | 27282 |
| 267 | Ga0209026_1010953 | 3300025250 | Bacteria | 1661 |
| 268 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 269 | Ga0209148_1000048 | 3300025254 | Bacteria | 430913 |
| 270 | Ga0209148_1003490 | 3300025254 | Bacteria | 4315 |
| 271 | Ga0209759_1000166 | 3300025256 | Bacteria | 113080 |
| 272 | Ga0209759_1000670 | 3300025256 | Bacteria | 31566 |
| 273 | Ga0209233_1000101 | 3300025261 | Bacteria | 286063 |
| 274 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 275 | Ga0209455_1009763 | 3300025272 | Bacteria | 2494 |
| 276 | Ga0209676_1002569 | 3300025292 | Bacteria | 12546 |
| 277 | Ga0209758_1025347 | 3300025297 | Bacteria | 2606 |
| 278 | Ga0209257_1050858 | 3300025304 | Bacteria | 1171 |
| 279 | Ga0207656_10094643 | 3300025321 | Bacteria | 1361 |
| 280 | Ga0207656_10118881 | 3300025321 | Bacteria | 1228 |
| 281 | Ga0207656_10208490 | 3300025321 | Bacteria | 946 |
| 282 | Ga0207653_10007366 | 3300025885 | Bacteria | 3429 |
| 283 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 284 | Ga0207680_10073532 | 3300025903 | Bacteria | 2126 |
| 285 | Ga0207647_10000445 | 3300025904 | Bacteria | 33611 |
| 286 | Ga0207647_10000548 | 3300025904 | Bacteria | 29903 |
| 287 | Ga0207647_10019324 | 3300025904 | Bacteria | 4584 |
| 288 | Ga0207643_10013247 | 3300025908 | Bacteria | 4463 |
| 289 | Ga0207643_10036221 | 3300025908 | Bacteria | 2766 |
| 290 | Ga0207705_10022212 | 3300025909 | Bacteria | 4526 |
| 291 | Ga0207705_10032332 | 3300025909 | Bacteria | 3738 |
| 292 | Ga0207705_10123931 | 3300025909 | Bacteria | 1919 |
| 293 | Ga0207684_10000533 | 3300025910 | Bacteria | 47088 |
| 294 | Ga0207654_10049534 | 3300025911 | Bacteria | 2410 |
| 295 | Ga0207654_10098110 | 3300025911 | Bacteria | 1800 |
| 296 | Ga0207707_10000044 | 3300025912 | Bacteria | 122847 |
| 297 | Ga0207707_10006527 | 3300025912 | Bacteria | 10184 |
| 298 | Ga0207707_10009412 | 3300025912 | Bacteria | 8474 |
| 299 | Ga0207707_10023298 | 3300025912 | Bacteria | 5418 |
| 300 | Ga0207695_10038674 | 3300025913 | Bacteria | 5133 |
| 301 | Ga0207695_10058106 | 3300025913 | Bacteria | 4016 |
| 302 | Ga0207695_10092009 | 3300025913 | Bacteria | 3045 |
| 303 | Ga0207695_10103134 | 3300025913 | Bacteria | 2844 |
| 304 | Ga0207671_10087119 | 3300025914 | Bacteria | 2348 |
| 305 | Ga0207671_10087816 | 3300025914 | Bacteria | 2339 |
| 306 | Ga0207671_10209106 | 3300025914 | Bacteria | 1526 |
| 307 | Ga0207693_10404518 | 3300025915 | Bacteria | 1067 |
| 308 | Ga0207660_10010225 | 3300025917 | Bacteria | 6082 |
| 309 | Ga0207660_10018985 | 3300025917 | Bacteria | 4592 |
| 310 | Ga0207660_10072519 | 3300025917 | Bacteria | 2508 |
| 311 | Ga0207662_10017703 | 3300025918 | Bacteria | 4033 |
| 312 | Ga0207662_10117514 | 3300025918 | Bacteria | 1664 |
| 313 | Ga0207662_10122369 | 3300025918 | Bacteria | 1633 |
| 314 | Ga0207657_10000193 | 3300025919 | Bacteria | 63264 |
| 315 | Ga0207657_10000234 | 3300025919 | Bacteria | 58447 |
| 316 | Ga0207657_10001113 | 3300025919 | Bacteria | 28509 |
| 317 | Ga0207649_10015990 | 3300025920 | Bacteria | 4223 |
| 318 | Ga0207649_10016120 | 3300025920 | Bacteria | 4209 |
| 319 | Ga0207652_10000462 | 3300025921 | Bacteria | 41666 |
| 320 | Ga0207652_10005477 | 3300025921 | Bacteria | 10301 |
| 321 | Ga0207652_10060943 | 3300025921 | Bacteria | 3257 |
| 322 | Ga0207652_10180709 | 3300025921 | Bacteria | 1896 |
| 323 | Ga0207681_10017812 | 3300025923 | Bacteria | 4466 |
| 324 | Ga0207694_10000177 | 3300025924 | Bacteria | 65875 |
| 325 | Ga0207694_10147102 | 3300025924 | Bacteria | 1897 |
| 326 | Ga0207694_10297168 | 3300025924 | Bacteria | 1329 |
| 327 | Ga0207694_10312147 | 3300025924 | Bacteria | 1296 |
| 328 | Ga0207650_10000112 | 3300025925 | Bacteria | 106714 |
| 329 | Ga0207650_10160890 | 3300025925 | Bacteria | 1779 |
| 330 | Ga0207659_10071561 | 3300025926 | Bacteria | 2532 |
| 331 | Ga0207659_10106640 | 3300025926 | Bacteria | 2122 |
| 332 | Ga0207664_10000884 | 3300025929 | Bacteria | 20225 |
| 333 | Ga0207664_10078072 | 3300025929 | Bacteria | 2684 |
| 334 | Ga0207644_10002052 | 3300025931 | Bacteria | 13049 |
| 335 | Ga0207644_10084074 | 3300025931 | Bacteria | 2358 |
| 336 | Ga0207690_10000627 | 3300025932 | Bacteria | 22858 |
| 337 | Ga0207690_10276183 | 3300025932 | Bacteria | 1307 |
| 338 | Ga0207690_10432294 | 3300025932 | Bacteria | 1055 |
| 339 | Ga0207706_10000097 | 3300025933 | Bacteria | 91923 |
| 340 | Ga0207706_10464704 | 3300025933 | Bacteria | 1094 |
| 341 | Ga0207706_10671388 | 3300025933 | Unclassified | 887 |
| 342 | Ga0207686_10058638 | 3300025934 | Bacteria | 2428 |
| 343 | Ga0207709_10005963 | 3300025935 | Bacteria | 6871 |
| 344 | Ga0207670_10000957 | 3300025936 | Bacteria | 15223 |
| 345 | Ga0207670_10302494 | 3300025936 | Bacteria | 1253 |
| 346 | Ga0207704_10081187 | 3300025938 | Bacteria | 2096 |
| 347 | Ga0207711_10023901 | 3300025941 | Bacteria | 5115 |
| 348 | Ga0207711_10063735 | 3300025941 | Bacteria | 3183 |
| 349 | Ga0207711_10444669 | 3300025941 | Bacteria | 1206 |
| 350 | Ga0207689_10048353 | 3300025942 | Bacteria | 3508 |
| 351 | Ga0207689_10064726 | 3300025942 | Bacteria | 3007 |
| 352 | Ga0207689_10082829 | 3300025942 | Bacteria | 2638 |
| 353 | Ga0207689_10267860 | 3300025942 | Bacteria | 1414 |
| 354 | Ga0207679_10023530 | 3300025945 | Bacteria | 4214 |
| 355 | Ga0207667_10004853 | 3300025949 | Bacteria | 16441 |
| 356 | Ga0207667_10028287 | 3300025949 | Bacteria | 6090 |
| 357 | Ga0207667_10044577 | 3300025949 | Bacteria | 4699 |
| 358 | Ga0207651_10004426 | 3300025960 | Bacteria | 7076 |
| 359 | Ga0207651_10204540 | 3300025960 | Bacteria | 1585 |
| 360 | Ga0207712_10007304 | 3300025961 | Bacteria | 6971 |
| 361 | Ga0207712_10465107 | 3300025961 | Bacteria | 1075 |
| 362 | Ga0207668_10009323 | 3300025972 | Bacteria | 5877 |
| 363 | Ga0207640_10000572 | 3300025981 | Bacteria | 21945 |
| 364 | Ga0207640_10059818 | 3300025981 | Bacteria | 2516 |
| 365 | Ga0207640_10071559 | 3300025981 | Bacteria | 2336 |
| 366 | Ga0207640_10112231 | 3300025981 | Bacteria | 1935 |
| 367 | Ga0207640_10268688 | 3300025981 | Bacteria | 1333 |
| 368 | Ga0207658_10133975 | 3300025986 | Bacteria | 1995 |
| 369 | Ga0207677_10385048 | 3300026023 | Bacteria | 1185 |
| 370 | Ga0207703_10064235 | 3300026035 | Bacteria | 3012 |
| 371 | Ga0207703_10375362 | 3300026035 | Bacteria | 1314 |
| 372 | Ga0207703_10634763 | 3300026035 | Bacteria | 1012 |
| 373 | Ga0207639_10009456 | 3300026041 | Bacteria | 6728 |
| 374 | Ga0207639_10326535 | 3300026041 | Bacteria | 1364 |
| 375 | Ga0207678_10015018 | 3300026067 | Bacteria | 6814 |
| 376 | Ga0207678_10042523 | 3300026067 | Bacteria | 3935 |
| 377 | Ga0207708_10000074 | 3300026075 | Bacteria | 79215 |
| 378 | Ga0207708_10005201 | 3300026075 | Bacteria | 9594 |
| 379 | Ga0207708_10030970 | 3300026075 | Bacteria | 4060 |
| 380 | Ga0207708_10112728 | 3300026075 | Bacteria | 2112 |
| 381 | Ga0207702_10021190 | 3300026078 | Bacteria | 5379 |
| 382 | Ga0207702_10524949 | 3300026078 | Bacteria | 1156 |
| 383 | Ga0207702_10533868 | 3300026078 | Bacteria | 1146 |
| 384 | Ga0207641_10029218 | 3300026088 | Bacteria | 4558 |
| 385 | Ga0207641_10059659 | 3300026088 | Bacteria | 3250 |
| 386 | Ga0207641_10104130 | 3300026088 | Bacteria | 2505 |
| 387 | Ga0207641_10120209 | 3300026088 | Bacteria | 2343 |
| 388 | Ga0207641_10217080 | 3300026088 | Bacteria | 1772 |
| 389 | Ga0207676_10002522 | 3300026095 | Bacteria | 13053 |
| 390 | Ga0207674_10008517 | 3300026116 | Bacteria | 11840 |
| 391 | Ga0207674_10016443 | 3300026116 | Bacteria | 8098 |
| 392 | Ga0207674_10025639 | 3300026116 | Bacteria | 6280 |
| 393 | Ga0207674_10043503 | 3300026116 | Bacteria | 4631 |
| 394 | Ga0207674_10062147 | 3300026116 | Bacteria | 3772 |
| 395 | Ga0207674_10075626 | 3300026116 | Bacteria | 3377 |
| 396 | Ga0207675_100098816 | 3300026118 | Bacteria | 2749 |
| 397 | Ga0207683_10131010 | 3300026121 | Bacteria | 2256 |
| 398 | Ga0207698_10043169 | 3300026142 | Bacteria | 3376 |
| 399 | Ga0207428_10015306 | 3300027907 | Bacteria | 6639 |
| 400 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 401 | Ga0268265_10055139 | 3300028380 | Bacteria | 3019 |
| 402 | Ga0268264_10016780 | 3300028381 | Bacteria | 5992 |
| 403 | Ga0268264_10074513 | 3300028381 | Bacteria | 2883 |
| 404 | Ga0268264_10129413 | 3300028381 | Bacteria | 2236 |
| 405 | Ga0268264_10173582 | 3300028381 | Bacteria | 1952 |
| 406 | Ga0268264_10267572 | 3300028381 | Bacteria | 1595 |
| 407 | Ga0307511_10000291 | 3300030521 | Bacteria | 52887 |
| 408 | Ga0307408_100001522 | 3300031548 | Bacteria | 17223 |
| 409 | Ga0307408_100337899 | 3300031548 | Bacteria | 1274 |
| 410 | Ga0307408_100459729 | 3300031548 | Bacteria | 1106 |
| 411 | Ga0307408_100725722 | 3300031548 | Unclassified | 895 |
| 412 | Ga0307413_10001172 | 3300031824 | Bacteria | 9644 |
| 413 | Ga0307413_10144233 | 3300031824 | Bacteria | 1650 |
| 414 | Ga0307413_10387086 | 3300031824 | Bacteria | 1091 |
| 415 | Ga0307410_10028486 | 3300031852 | Bacteria | 3544 |
| 416 | Ga0307406_10003612 | 3300031901 | Bacteria | 8426 |
| 417 | Ga0307406_10316047 | 3300031901 | Bacteria | 1206 |
| 418 | Ga0307407_10009948 | 3300031903 | Bacteria | 4456 |
| 419 | Ga0307407_10374759 | 3300031903 | Bacteria | 1014 |
| 420 | Ga0307412_10082467 | 3300031911 | Bacteria | 2227 |
| 421 | Ga0307412_10117655 | 3300031911 | Bacteria | 1908 |
| 422 | Ga0307416_100008950 | 3300032002 | Bacteria | 6510 |
| 423 | Ga0307416_100125391 | 3300032002 | Bacteria | 2299 |
| 424 | Ga0307414_10002715 | 3300032004 | Bacteria | 9314 |
| 425 | Ga0307414_10006856 | 3300032004 | Bacteria | 6374 |
| 426 | Ga0307414_10051296 | 3300032004 | Bacteria | 2863 |
| 427 | Ga0307414_10188432 | 3300032004 | Bacteria | 1667 |
| 428 | Ga0307411_10008953 | 3300032005 | Bacteria | 5226 |
| 429 | Ga0307411_10019968 | 3300032005 | Bacteria | 3884 |
| 430 | Ga0307411_10028717 | 3300032005 | Bacteria | 3387 |
| 431 | Ga0307415_100003868 | 3300032126 | Bacteria | 7682 |
| 432 | Ga0307507_10114012 | 3300033179 | Bacteria | 2194 |
| 433 | Ga0307510_10001742 | 3300033180 | Bacteria | 24237 |
| 434 | Ga0307510_10102827 | 3300033180 | Bacteria | 2637 |
| 435 | Ga0373940_0103440 | 3300035088 | Unclassified | 867 |
| 436 | Ga0373949_0059215 | 3300035090 | Bacteria | 982 |
| 437 | Ga0373942_0057000 | 3300035207 | Bacteria | 1110 |
| 438 | Ga0373931_0020639 | 3300035691 | Bacteria | 3298 |
| 439 | Ga0395899_0010991 | 3300037312 | Bacteria | 6934 |
| 440 | Ga0395899_0011924 | 3300037312 | Bacteria | 6657 |
| 441 | Ga0395900_0000107 | 3300037418 | Bacteria | 149024 |
| 442 | Ga0395900_0008421 | 3300037418 | Bacteria | 10610 |
| 443 | Ga0395900_0115104 | 3300037418 | Bacteria | 2759 |
| 444 | Ga0395898_0000078 | 3300037466 | Bacteria | 244514 |
| 445 | Ga0395898_0053030 | 3300037466 | Bacteria | 3961 |
| 446 | Ga0395898_0101704 | 3300037466 | Bacteria | 2759 |
| 447 | Ga0395898_0181060 | 3300037466 | Bacteria | 2014 |
| 448 | Ga0395901_0002361 | 3300038443 | Bacteria | 19197 |
| 449 | Ga0395901_0978061 | 3300038443 | Bacteria | 823 |
| 450 | Ga0242420_001924 | 3300038996 | Bacteria | 2879 |
| 451 | Ga0439436_0000026 | 3300041404 | Bacteria | 55607 |
| 452 | Ga0439465_0000172 | 3300041413 | Bacteria | 16547 |
| 453 | Ga0451833_1420711 | 3300041491 | Bacteria | 1396 |
| 454 | Ga0450889_003766 | 3300042144 | Bacteria | 1495 |
| 455 | Ga0439458_0002859 | 3300042157 | Bacteria | 4150 |
| 456 | Ga0450908_002562 | 3300042184 | Bacteria | 3565 |
| 457 | Ga0451577_0062915 | 3300042876 | Bacteria | 3309 |
| 458 | Ga0466969_0002513 | 3300044656 | Bacteria | 9807 |
| 459 | Ga0466969_0024094 | 3300044656 | Bacteria | 3130 |
| 460 | Ga0466976_0269238 | 3300044662 | Bacteria | 978 |
| 461 | Ga0466982_0007854 | 3300044672 | Bacteria | 5306 |
| 462 | Ga0466961_0000906 | 3300044693 | Bacteria | 18402 |
| 463 | Ga0466961_0002884 | 3300044693 | Bacteria | 10664 |
| 464 | Ga0466961_0008386 | 3300044693 | Bacteria | 6582 |
| 465 | Ga0466963_0210316 | 3300044694 | Bacteria | 1361 |
| 466 | Ga0466964_0008393 | 3300044706 | Bacteria | 3881 |
| 467 | Ga0466971_0014434 | 3300044719 | Bacteria | 3475 |
| 468 | Ga0466971_0072250 | 3300044719 | Bacteria | 1567 |
| 469 | Ga0466968_0003694 | 3300044735 | Bacteria | 5679 |
| 470 | Ga0466970_0005775 | 3300044765 | Bacteria | 6151 |
| 471 | Ga0466957_0062767 | 3300044842 | Bacteria | 2282 |
| 472 | Ga0466957_0489570 | 3300044842 | Bacteria | 851 |
| 473 | Ga0466959_0002734 | 3300045049 | Bacteria | 11352 |
| 474 | Ga0451576_0000490 | 3300045051 | Bacteria | 87626 |
| 475 | Ga0451576_0547136 | 3300045051 | Bacteria | 1216 |
| 476 | Ga0451576_0881643 | 3300045051 | Bacteria | 939 |
| 477 | Ga0466958_0081242 | 3300045836 | Bacteria | 1994 |
| 478 | Ga0466967_0011210 | 3300045976 | Bacteria | 6776 |
| 479 | Ga0495617_000321 | 3300046452 | Bacteria | 26962 |
| 480 | Ga0495617_000583 | 3300046452 | Bacteria | 18579 |
| 481 | Ga0495638_0000873 | 3300046460 | Bacteria | 31227 |
| 482 | Ga0495650_0000250 | 3300046471 | Bacteria | 105746 |
| 483 | Ga0495650_0001452 | 3300046471 | Bacteria | 22732 |
| 484 | Ga0495650_0050865 | 3300046471 | Bacteria | 1710 |
| 485 | Ga0495585_0000019 | 3300046492 | Bacteria | 156966 |
| 486 | Ga0495585_0009413 | 3300046492 | Bacteria | 5859 |
| 487 | Ga0495607_0000250 | 3300046501 | Bacteria | 57693 |
| 488 | Ga0495607_0000538 | 3300046501 | Bacteria | 37198 |
| 489 | Ga0495607_0021990 | 3300046501 | Bacteria | 4010 |
| 490 | Ga0495606_0000665 | 3300046507 | Bacteria | 53891 |
| 491 | Ga0495606_0000888 | 3300046507 | Bacteria | 44688 |
| 492 | Ga0495606_0010914 | 3300046507 | Bacteria | 7475 |
| 493 | Ga0495606_0027722 | 3300046507 | Bacteria | 4009 |
| 494 | Ga0495606_0070583 | 3300046507 | Bacteria | 2202 |
| 495 | Ga0495610_0007835 | 3300046512 | Bacteria | 7033 |
| 496 | Ga0495616_0000047 | 3300046513 | Bacteria | 110592 |
| 497 | Ga0495620_0001659 | 3300046515 | Bacteria | 13165 |
| 498 | Ga0495620_0009649 | 3300046515 | Bacteria | 5123 |
| 499 | Ga0495631_0001326 | 3300046518 | Bacteria | 15169 |
| 500 | Ga0495631_0003442 | 3300046518 | Bacteria | 8667 |
| 501 | Ga0495632_0000080 | 3300046519 | Bacteria | 99523 |
| 502 | Ga0495632_0016870 | 3300046519 | Bacteria | 4048 |
| 503 | Ga0495632_0071241 | 3300046519 | Bacteria | 1670 |
| 504 | Ga0495637_0018732 | 3300046520 | Bacteria | 3208 |
| 505 | Ga0495648_0000424 | 3300046524 | Bacteria | 46425 |
| 506 | Ga0495609_0026527 | 3300046538 | Bacteria | 2652 |
| 507 | Ga0495668_0012653 | 3300046616 | Bacteria | 5000 |
| 508 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 509 | Ga0495611_0000955 | 3300046648 | Bacteria | 15433 |
| 510 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 511 | Ga0495625_0018610 | 3300046660 | Bacteria | 5415 |
| 512 | Ga0495625_0022138 | 3300046660 | Bacteria | 4878 |
| 513 | Ga0495625_0027249 | 3300046660 | Bacteria | 4305 |
| 514 | Ga0495661_0001772 | 3300046665 | Bacteria | 17368 |
| 515 | Ga0495661_0063471 | 3300046665 | Bacteria | 2183 |
| 516 | Ga0495670_0002102 | 3300046691 | Bacteria | 9827 |
| 517 | Ga0495670_0057167 | 3300046691 | Bacteria | 1958 |
| 518 | Ga0495670_0062949 | 3300046691 | Bacteria | 1867 |
| 519 | Ga0495671_0000552 | 3300046692 | Bacteria | 28021 |
| 520 | Ga0495589_0000272 | 3300046794 | Bacteria | 42126 |
| 521 | Ga0495660_0000746 | 3300046810 | Bacteria | 24565 |
| 522 | Ga0495660_0001683 | 3300046810 | Bacteria | 14811 |
| 523 | Ga0495683_0002438 | 3300047323 | Bacteria | 11243 |
| 524 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 525 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 526 | Ga0495673_0000099 | 3300047469 | Bacteria | 179978 |
| 527 | Ga0495673_0002188 | 3300047469 | Bacteria | 14190 |
| 528 | Ga0495681_0033967 | 3300047470 | Bacteria | 2547 |
| 529 | Ga0495686_0000255 | 3300047472 | Bacteria | 95600 |
| 530 | Ga0495686_0000276 | 3300047472 | Bacteria | 91066 |
| 531 | Ga0495686_0202759 | 3300047472 | Bacteria | 1137 |
| 532 | Ga0496100_0168472 | 3300048903 | Bacteria | 1575 |
| 533 | Ga0496101_0000936 | 3300048904 | Bacteria | 17238 |
| 534 | Ga0496101_0085001 | 3300048904 | Bacteria | 2344 |
| 535 | Ga0496102_0007152 | 3300048905 | Bacteria | 9527 |
| 536 | Ga0496102_0211519 | 3300048905 | Bacteria | 1828 |
| 537 | Ga0496106_0000153 | 3300048909 | Bacteria | 51161 |
| 538 | Ga0496106_0174461 | 3300048909 | Bacteria | 1705 |
| 539 | Ga0496107_0008205 | 3300048910 | Bacteria | 7222 |
| 540 | Ga0496108_0148653 | 3300048911 | Bacteria | 2021 |
| 541 | Ga0496112_0199481 | 3300048915 | Bacteria | 1961 |
| 542 | Ga0496113_0013168 | 3300048916 | Bacteria | 5590 |
| 543 | Ga0496116_0137687 | 3300048919 | Bacteria | 1379 |
| 544 | Ga0496116_0139433 | 3300048919 | Bacteria | 1367 |
| 545 | Ga0496116_0178578 | 3300048919 | Bacteria | 1140 |
| 546 | Ga0496117_0108213 | 3300048920 | Bacteria | 1739 |
| 547 | Ga0496117_0193852 | 3300048920 | Bacteria | 1154 |
| 548 | Ga0496118_0000749 | 3300048921 | Bacteria | 52548 |
| 549 | Ga0496118_0006551 | 3300048921 | Bacteria | 12736 |
| 550 | Ga0496119_0031754 | 3300048922 | Bacteria | 3533 |
| 551 | Ga0496119_0120649 | 3300048922 | Bacteria | 1441 |
| 552 | Ga0496120_0002521 | 3300048923 | Bacteria | 18302 |
| 553 | Ga0496121_0000210 | 3300048924 | Bacteria | 128287 |
| 554 | Ga0496121_0003580 | 3300048924 | Bacteria | 21935 |
| 555 | Ga0496122_0026085 | 3300048925 | Bacteria | 5054 |
| 556 | Ga0496122_0029343 | 3300048925 | Bacteria | 4642 |
| 557 | Ga0496123_0003137 | 3300048926 | Bacteria | 18959 |
| 558 | Ga0496123_0024748 | 3300048926 | Bacteria | 4551 |
| 559 | Ga0496123_0090032 | 3300048926 | Bacteria | 1826 |
| 560 | Ga0496124_0000582 | 3300048927 | Bacteria | 61634 |
| 561 | Ga0496124_0005258 | 3300048927 | Bacteria | 14649 |
| 562 | Ga0496124_0133656 | 3300048927 | Bacteria | 1967 |
| 563 | Ga0496125_0003846 | 3300048928 | Bacteria | 17813 |
| 564 | Ga0496126_0025112 | 3300048929 | Bacteria | 5740 |
| 565 | Ga0496126_0031117 | 3300048929 | Bacteria | 5047 |
| 566 | Ga0496126_0122272 | 3300048929 | Bacteria | 2256 |
| 567 | Ga0495678_000207 | 3300049459 | Bacteria | 68441 |
| 568 | Ga0495682_0002356 | 3300049460 | Bacteria | 8981 |
| 569 | Ga0501292_004593 | 3300049515 | Bacteria | 1895 |
| 570 | Ga0501297_013275 | 3300049520 | Bacteria | 965 |
| 571 | Ga0501034_0187478 | 3300049571 | Bacteria | 2031 |
| 572 | Ga0501067_0113537 | 3300049583 | Bacteria | 1506 |
| 573 | Ga0501070_0012849 | 3300049586 | Bacteria | 7056 |
| 574 | Ga0501070_0045118 | 3300049586 | Bacteria | 3666 |
| 575 | Ga0501073_0007135 | 3300049589 | Bacteria | 8323 |
| 576 | Ga0501074_0135993 | 3300049590 | Bacteria | 1758 |
| 577 | Ga0501198_007283 | 3300049649 | Bacteria | 1589 |
| 578 | Ga0501209_086214 | 3300049656 | Bacteria | 909 |
| 579 | Ga0501217_000392 | 3300049661 | Bacteria | 7053 |
| 580 | Ga0501223_002306 | 3300049663 | Bacteria | 4257 |
| 581 | Ga0501227_000419 | 3300049665 | Bacteria | 9050 |
| 582 | Ga0501233_003913 | 3300049668 | Bacteria | 2700 |
| 583 | Ga0501235_006699 | 3300049669 | Bacteria | 2507 |
| 584 | Ga0501240_003036 | 3300049673 | Bacteria | 1838 |
| 585 | Ga0501249_040329 | 3300049679 | Bacteria | 1057 |
| 586 | Ga0501257_060683 | 3300049686 | Bacteria | 955 |
| 587 | Ga0501225_0002302 | 3300049705 | Bacteria | 5901 |
| 588 | Ga0501225_0023550 | 3300049705 | Bacteria | 1697 |
| 589 | Ga0501225_0043422 | 3300049705 | Bacteria | 1242 |
| 590 | Ga0501234_001008 | 3300049707 | Bacteria | 4471 |
| 591 | Ga0501080_0150206 | 3300049742 | Bacteria | 2154 |
| 592 | Ga0501080_0271423 | 3300049742 | Bacteria | 1543 |
| 593 | Ga0501083_0025015 | 3300049744 | Bacteria | 4135 |
| 594 | Ga0501263_009137 | 3300049760 | Unclassified | 1196 |
| 595 | Ga0501226_007012 | 3300049853 | Bacteria | 1268 |
| 596 | nmdc:mga05p37_280222_c1 | 3300050507 | Bacteria | 1988 |
| 597 | nmdc:mga05p37_82913_c1 | 3300050507 | Unclassified | 3951 |
| 598 | nmdc:mga05p37_895598_c1 | 3300050507 | Bacteria | 957 |
| 599 | nmdc:mga09592_119509_c1 | 3300050508 | Bacteria | 2263 |
| 600 | nmdc:mga09592_269791_c1 | 3300050508 | Bacteria | 1476 |
| 601 | nmdc:mga0qj67_348786_c1 | 3300050509 | Bacteria | 1197 |
| 602 | nmdc:mga0qj67_47167_c1 | 3300050509 | Bacteria | 3403 |
| 603 | nmdc:mga06r32_271040_c1 | 3300050510 | Bacteria | 1685 |
| 604 | nmdc:mga08y16_17931_c1 | 3300050511 | Bacteria | 7459 |
| 605 | nmdc:mga08y16_244383_c1 | 3300050511 | Unclassified | 1855 |
| 606 | nmdc:mga08y16_4046_c1 | 3300050511 | Bacteria | 15302 |
| 607 | nmdc:mga0n895_601073_c1 | 3300050512 | Unclassified | 1102 |
| 608 | nmdc:mga0rr50_72054_c1 | 3300050513 | Bacteria | 2638 |
| 609 | nmdc:mga0a205_177982_c1 | 3300050515 | Bacteria | 2022 |
| 610 | nmdc:mga0a205_198289_c1 | 3300050515 | Bacteria | 1898 |
| 611 | nmdc:mga0a205_44105_c1 | 3300050515 | Bacteria | 4298 |
| 612 | nmdc:mga0sz30_21548_c1 | 3300050516 | Bacteria | 2609 |
| 613 | nmdc:mga0sz30_74707_c1 | 3300050516 | Bacteria | 1462 |
| 614 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 615 | Ga0500555_001433 | 3300053103 | Bacteria | 7310 |
| 616 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 617 | Ga0500633_0027065 | 3300053160 | Bacteria | 1811 |
| 618 | Ga0500645_000733 | 3300053730 | Bacteria | 20211 |
| 619 | Ga0501082_0066014 | 3300060353 | Bacteria | 3116 |
| 620 | Ga0466962_0002526 | 3300061719 | Bacteria | 8691 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100337899 | Ga0307408_1003378992 | 228 |
| 2 | 3300005842 | Ga0068858_100044656 | Ga0068858_1000446562 | 237 |
| 3 | 3300005843 | Ga0068860_100004070 | Ga0068860_10000407014 | 237 |
| 4 | 3300006881 | Ga0068865_100059439 | Ga0068865_1000594393 | 237 |
| 5 | 3300014326 | Ga0157380_10360913 | Ga0157380_103609132 | 237 |
| 6 | 3300025938 | Ga0207704_10081187 | Ga0207704_100811872 | 237 |
| 7 | 3300028381 | Ga0268264_10016780 | Ga0268264_100167803 | 237 |
| 8 | 3300032004 | Ga0307414_10006856 | Ga0307414_100068565 | 237 |
| 9 | 3300005331 | Ga0070670_100000324 | Ga0070670_10000032430 | 240 |
| 10 | 3300005354 | Ga0070675_100308208 | Ga0070675_1003082082 | 240 |
| 11 | 3300005617 | Ga0068859_101409112 | Ga0068859_1014091121 | 240 |
| 12 | 3300006931 | Ga0097620_101409041 | Ga0097620_1014090411 | 240 |
| 13 | 3300014325 | Ga0163163_10002165 | Ga0163163_1000216511 | 240 |
| 14 | 3300014745 | Ga0157377_10294520 | Ga0157377_102945202 | 240 |
| 15 | 3300025925 | Ga0207650_10000112 | Ga0207650_1000011232 | 240 |
| 16 | 3300025926 | Ga0207659_10106640 | Ga0207659_101066403 | 240 |
| 17 | 3300026075 | Ga0207708_10112728 | Ga0207708_101127283 | 240 |
| 18 | 3300009176 | Ga0105242_10090605 | Ga0105242_100906054 | 241 |
| 19 | 3300025933 | Ga0207706_10671388 | Ga0207706_106713882 | 241 |
| 20 | 3300025918 | Ga0207662_10122369 | Ga0207662_101223692 | 242 |
| 21 | 3300026035 | Ga0207703_10375362 | Ga0207703_103753622 | 242 |
| 22 | 3300005441 | Ga0070700_100000042 | Ga0070700_10000004268 | 243 |
| 23 | 3300006852 | Ga0075433_10055957 | Ga0075433_100559572 | 243 |
| 24 | 3300006880 | Ga0075429_100143689 | Ga0075429_1001436892 | 243 |
| 25 | 3300013308 | Ga0157375_10712952 | Ga0157375_107129522 | 243 |
| 26 | 3300026075 | Ga0207708_10000074 | Ga0207708_1000007448 | 243 |
| 27 | 3300049571 | Ga0501034_0187478 | Ga0501034_0187478_352_1134 | 243 |
| 28 | 3300049583 | Ga0501067_0113537 | Ga0501067_0113537_472_1254 | 243 |
| 29 | 3300049586 | Ga0501070_0045118 | Ga0501070_0045118_532_1314 | 243 |
| 30 | 3300049589 | Ga0501073_0007135 | Ga0501073_0007135_679_1461 | 243 |
| 31 | 3300049590 | Ga0501074_0135993 | Ga0501074_0135993_585_1367 | 243 |
| 32 | 3300049742 | Ga0501080_0271423 | Ga0501080_0271423_424_1206 | 243 |
| 33 | 3300049744 | Ga0501083_0025015 | Ga0501083_0025015_3064_3846 | 243 |
| 34 | 3300050508 | nmdc:mga09592_119509_c1 | nmdc:mga09592_119509_c1_1092_1841 | 243 |
| 35 | 3300050510 | nmdc:mga06r32_271040_c1 | nmdc:mga06r32_271040_c1_162_911 | 243 |
| 36 | 3300060353 | Ga0501082_0066014 | Ga0501082_0066014_2213_2995 | 243 |
| 37 | 3300003203 | JGI25406J46586_10014833 | JGI25406J46586_100148333 | 244 |
| 38 | 3300005288 | Ga0065714_10064432 | Ga0065714_10064432107 | 244 |
| 39 | 3300005289 | Ga0065704_10234515 | Ga0065704_102345151 | 244 |
| 40 | 3300005290 | Ga0065712_10067730 | Ga0065712_10067730107 | 244 |
| 41 | 3300005293 | Ga0065715_10121787 | Ga0065715_101217873 | 244 |
| 42 | 3300005293 | Ga0065715_10411379 | Ga0065715_104113791 | 244 |
| 43 | 3300005334 | Ga0068869_100018668 | Ga0068869_1000186682 | 244 |
| 44 | 3300005337 | Ga0070682_100002049 | Ga0070682_1000020492 | 244 |
| 45 | 3300005340 | Ga0070689_100011673 | Ga0070689_1000116737 | 244 |
| 46 | 3300005345 | Ga0070692_10018538 | Ga0070692_100185382 | 244 |
| 47 | 3300005345 | Ga0070692_10022138 | Ga0070692_100221384 | 244 |
| 48 | 3300005366 | Ga0070659_100355356 | Ga0070659_1003553561 | 244 |
| 49 | 3300005366 | Ga0070659_100506015 | Ga0070659_1005060151 | 244 |
| 50 | 3300005406 | Ga0070703_10042242 | Ga0070703_100422422 | 244 |
| 51 | 3300005440 | Ga0070705_100377643 | Ga0070705_1003776432 | 244 |
| 52 | 3300005441 | Ga0070700_100007847 | Ga0070700_1000078473 | 244 |
| 53 | 3300005441 | Ga0070700_100169994 | Ga0070700_1001699942 | 244 |
| 54 | 3300005444 | Ga0070694_100122443 | Ga0070694_1001224432 | 244 |
| 55 | 3300005444 | Ga0070694_100184655 | Ga0070694_1001846552 | 244 |
| 56 | 3300005444 | Ga0070694_100333824 | Ga0070694_1003338242 | 244 |
| 57 | 3300005459 | Ga0068867_100420511 | Ga0068867_1004205112 | 244 |
| 58 | 3300005467 | Ga0070706_100000480 | Ga0070706_10000048018 | 244 |
| 59 | 3300005471 | Ga0070698_100079102 | Ga0070698_1000791022 | 244 |
| 60 | 3300005518 | Ga0070699_100002826 | Ga0070699_1000028269 | 244 |
| 61 | 3300005518 | Ga0070699_100013038 | Ga0070699_1000130387 | 244 |
| 62 | 3300005518 | Ga0070699_100238296 | Ga0070699_1002382963 | 244 |
| 63 | 3300005530 | Ga0070679_100145625 | Ga0070679_1001456252 | 244 |
| 64 | 3300005547 | Ga0070693_100000402 | Ga0070693_1000004027 | 244 |
| 65 | 3300005564 | Ga0070664_100157169 | Ga0070664_1001571693 | 244 |
| 66 | 3300005578 | Ga0068854_100187328 | Ga0068854_1001873282 | 244 |
| 67 | 3300005614 | Ga0068856_100807426 | Ga0068856_1008074261 | 244 |
| 68 | 3300005615 | Ga0070702_100109460 | Ga0070702_1001094602 | 244 |
| 69 | 3300005617 | Ga0068859_100041310 | Ga0068859_1000413105 | 244 |
| 70 | 3300005617 | Ga0068859_100057602 | Ga0068859_1000576023 | 244 |
| 71 | 3300005617 | Ga0068859_100059419 | Ga0068859_1000594192 | 244 |
| 72 | 3300005617 | Ga0068859_100070970 | Ga0068859_1000709702 | 244 |
| 73 | 3300005617 | Ga0068859_100272047 | Ga0068859_1002720472 | 244 |
| 74 | 3300005617 | Ga0068859_100517625 | Ga0068859_1005176251 | 244 |
| 75 | 3300005618 | Ga0068864_100013842 | Ga0068864_1000138425 | 244 |
| 76 | 3300005618 | Ga0068864_100209229 | Ga0068864_1002092292 | 244 |
| 77 | 3300005719 | Ga0068861_100031108 | Ga0068861_1000311083 | 244 |
| 78 | 3300005834 | Ga0068851_10168100 | Ga0068851_101681001 | 244 |
| 79 | 3300005840 | Ga0068870_10015961 | Ga0068870_100159612 | 244 |
| 80 | 3300005840 | Ga0068870_10031416 | Ga0068870_100314163 | 244 |
| 81 | 3300005841 | Ga0068863_100050680 | Ga0068863_1000506804 | 244 |
| 82 | 3300005841 | Ga0068863_100207210 | Ga0068863_1002072103 | 244 |
| 83 | 3300005841 | Ga0068863_100461878 | Ga0068863_1004618782 | 244 |
| 84 | 3300005842 | Ga0068858_100074702 | Ga0068858_1000747023 | 244 |
| 85 | 3300005842 | Ga0068858_100229282 | Ga0068858_1002292822 | 244 |
| 86 | 3300005842 | Ga0068858_100939546 | Ga0068858_1009395461 | 244 |
| 87 | 3300005843 | Ga0068860_100524365 | Ga0068860_1005243652 | 244 |
| 88 | 3300005843 | Ga0068860_100528754 | Ga0068860_1005287542 | 244 |
| 89 | 3300005843 | Ga0068860_100550702 | Ga0068860_1005507021 | 244 |
| 90 | 3300005844 | Ga0068862_100122364 | Ga0068862_1001223643 | 244 |
| 91 | 3300005844 | Ga0068862_100647980 | Ga0068862_1006479801 | 244 |
| 92 | 3300005985 | Ga0081539_10000395 | Ga0081539_1000039584 | 244 |
| 93 | 3300006194 | Ga0075427_10014721 | Ga0075427_100147212 | 244 |
| 94 | 3300006844 | Ga0075428_100023016 | Ga0075428_1000230167 | 244 |
| 95 | 3300006844 | Ga0075428_100533438 | Ga0075428_1005334382 | 244 |
| 96 | 3300006846 | Ga0075430_100018829 | Ga0075430_1000188295 | 244 |
| 97 | 3300006852 | Ga0075433_10011090 | Ga0075433_100110902 | 244 |
| 98 | 3300006852 | Ga0075433_10227612 | Ga0075433_102276122 | 244 |
| 99 | 3300006852 | Ga0075433_10455828 | Ga0075433_104558282 | 244 |
| 100 | 3300006931 | Ga0097620_100041307 | Ga0097620_1000413075 | 244 |
| 101 | 3300006931 | Ga0097620_100057603 | Ga0097620_1000576034 | 244 |
| 102 | 3300006931 | Ga0097620_100059419 | Ga0097620_1000594195 | 244 |
| 103 | 3300006931 | Ga0097620_100070964 | Ga0097620_1000709644 | 244 |
| 104 | 3300006931 | Ga0097620_100272035 | Ga0097620_1002720352 | 244 |
| 105 | 3300006931 | Ga0097620_100517639 | Ga0097620_1005176391 | 244 |
| 106 | 3300007076 | Ga0075435_100095799 | Ga0075435_1000957993 | 244 |
| 107 | 3300009011 | Ga0105251_10092651 | Ga0105251_100926511 | 244 |
| 108 | 3300009094 | Ga0111539_10000296 | Ga0111539_100002967 | 244 |
| 109 | 3300009094 | Ga0111539_10081498 | Ga0111539_100814985 | 244 |
| 110 | 3300009101 | Ga0105247_10000635 | Ga0105247_1000063514 | 244 |
| 111 | 3300009101 | Ga0105247_10104789 | Ga0105247_101047892 | 244 |
| 112 | 3300009101 | Ga0105247_10169785 | Ga0105247_101697852 | 244 |
| 113 | 3300009101 | Ga0105247_10175818 | Ga0105247_101758182 | 244 |
| 114 | 3300009147 | Ga0114129_10471560 | Ga0114129_104715602 | 244 |
| 115 | 3300009147 | Ga0114129_10963575 | Ga0114129_109635752 | 244 |
| 116 | 3300009174 | Ga0105241_10030898 | Ga0105241_100308983 | 244 |
| 117 | 3300009177 | Ga0105248_10011331 | Ga0105248_100113312 | 244 |
| 118 | 3300009177 | Ga0105248_10030093 | Ga0105248_100300933 | 244 |
| 119 | 3300009177 | Ga0105248_10101139 | Ga0105248_101011392 | 244 |
| 120 | 3300009177 | Ga0105248_10329703 | Ga0105248_103297032 | 244 |
| 121 | 3300009177 | Ga0105248_10410793 | Ga0105248_104107932 | 244 |
| 122 | 3300009545 | Ga0105237_10003124 | Ga0105237_1000312420 | 244 |
| 123 | 3300009545 | Ga0105237_10228375 | Ga0105237_102283752 | 244 |
| 124 | 3300009551 | Ga0105238_10104245 | Ga0105238_101042452 | 244 |
| 125 | 3300009553 | Ga0105249_10019898 | Ga0105249_100198986 | 244 |
| 126 | 3300010375 | Ga0105239_10259891 | Ga0105239_102598912 | 244 |
| 127 | 3300010375 | Ga0105239_10409733 | Ga0105239_104097332 | 244 |
| 128 | 3300010375 | Ga0105239_10798242 | Ga0105239_107982422 | 244 |
| 129 | 3300013306 | Ga0163162_10148758 | Ga0163162_101487583 | 244 |
| 130 | 3300013306 | Ga0163162_10479234 | Ga0163162_104792342 | 244 |
| 131 | 3300013308 | Ga0157375_10032881 | Ga0157375_100328814 | 244 |
| 132 | 3300014325 | Ga0163163_10006156 | Ga0163163_100061564 | 244 |
| 133 | 3300014968 | Ga0157379_10167018 | Ga0157379_101670181 | 244 |
| 134 | 3300025321 | Ga0207656_10118881 | Ga0207656_101188811 | 244 |
| 135 | 3300025885 | Ga0207653_10007366 | Ga0207653_100073662 | 244 |
| 136 | 3300025904 | Ga0207647_10000445 | Ga0207647_100004456 | 244 |
| 137 | 3300025908 | Ga0207643_10013247 | Ga0207643_100132475 | 244 |
| 138 | 3300025908 | Ga0207643_10036221 | Ga0207643_100362213 | 244 |
| 139 | 3300025910 | Ga0207684_10000533 | Ga0207684_1000053332 | 244 |
| 140 | 3300025913 | Ga0207695_10058106 | Ga0207695_100581063 | 244 |
| 141 | 3300025914 | Ga0207671_10087816 | Ga0207671_100878162 | 244 |
| 142 | 3300025914 | Ga0207671_10209106 | Ga0207671_102091062 | 244 |
| 143 | 3300025918 | Ga0207662_10017703 | Ga0207662_100177035 | 244 |
| 144 | 3300025918 | Ga0207662_10117514 | Ga0207662_101175143 | 244 |
| 145 | 3300025932 | Ga0207690_10432294 | Ga0207690_104322941 | 244 |
| 146 | 3300025934 | Ga0207686_10058638 | Ga0207686_100586383 | 244 |
| 147 | 3300025935 | Ga0207709_10005963 | Ga0207709_100059637 | 244 |
| 148 | 3300025936 | Ga0207670_10000957 | Ga0207670_1000095712 | 244 |
| 149 | 3300025936 | Ga0207670_10302494 | Ga0207670_103024942 | 244 |
| 150 | 3300025941 | Ga0207711_10023901 | Ga0207711_100239013 | 244 |
| 151 | 3300025941 | Ga0207711_10063735 | Ga0207711_100637354 | 244 |
| 152 | 3300025941 | Ga0207711_10444669 | Ga0207711_104446692 | 244 |
| 153 | 3300025942 | Ga0207689_10064726 | Ga0207689_100647264 | 244 |
| 154 | 3300025942 | Ga0207689_10082829 | Ga0207689_100828292 | 244 |
| 155 | 3300025942 | Ga0207689_10267860 | Ga0207689_102678603 | 244 |
| 156 | 3300025961 | Ga0207712_10007304 | Ga0207712_100073047 | 244 |
| 157 | 3300025981 | Ga0207640_10268688 | Ga0207640_102686882 | 244 |
| 158 | 3300026035 | Ga0207703_10064235 | Ga0207703_100642352 | 244 |
| 159 | 3300026035 | Ga0207703_10634763 | Ga0207703_106347632 | 244 |
| 160 | 3300026075 | Ga0207708_10005201 | Ga0207708_100052019 | 244 |
| 161 | 3300026075 | Ga0207708_10030970 | Ga0207708_100309703 | 244 |
| 162 | 3300026088 | Ga0207641_10029218 | Ga0207641_100292184 | 244 |
| 163 | 3300026088 | Ga0207641_10104130 | Ga0207641_101041302 | 244 |
| 164 | 3300026088 | Ga0207641_10120209 | Ga0207641_101202092 | 244 |
| 165 | 3300026088 | Ga0207641_10217080 | Ga0207641_102170803 | 244 |
| 166 | 3300026095 | Ga0207676_10002522 | Ga0207676_1000252211 | 244 |
| 167 | 3300026116 | Ga0207674_10075626 | Ga0207674_100756264 | 244 |
| 168 | 3300026118 | Ga0207675_100098816 | Ga0207675_1000988163 | 244 |
| 169 | 3300028381 | Ga0268264_10129413 | Ga0268264_101294133 | 244 |
| 170 | 3300028381 | Ga0268264_10267572 | Ga0268264_102675722 | 244 |
| 171 | 3300031548 | Ga0307408_100459729 | Ga0307408_1004597292 | 244 |
| 172 | 3300031548 | Ga0307408_100725722 | Ga0307408_1007257222 | 244 |
| 173 | 3300031824 | Ga0307413_10144233 | Ga0307413_101442332 | 244 |
| 174 | 3300031852 | Ga0307410_10028486 | Ga0307410_100284865 | 244 |
| 175 | 3300031901 | Ga0307406_10003612 | Ga0307406_100036126 | 244 |
| 176 | 3300032004 | Ga0307414_10002715 | Ga0307414_100027157 | 244 |
| 177 | 3300032005 | Ga0307411_10008953 | Ga0307411_100089533 | 244 |
| 178 | 3300032126 | Ga0307415_100003868 | Ga0307415_1000038685 | 244 |
| 179 | 3300035088 | Ga0373940_0103440 | Ga0373940_0103440_32_784 | 244 |
| 180 | 3300035207 | Ga0373942_0057000 | Ga0373942_0057000_181_933 | 244 |
| 181 | 3300038996 | Ga0242420_001924 | Ga0242420_001924_2025_2777 | 244 |
| 182 | 3300045051 | Ga0451576_0881643 | Ga0451576_0881643_56_808 | 244 |
| 183 | 3300048909 | Ga0496106_0174461 | Ga0496106_0174461_759_1511 | 244 |
| 184 | 3300048911 | Ga0496108_0148653 | Ga0496108_0148653_261_1013 | 244 |
| 185 | 3300048915 | Ga0496112_0199481 | Ga0496112_0199481_329_1081 | 244 |
| 186 | 3300048916 | Ga0496113_0013168 | Ga0496113_0013168_2158_2910 | 244 |
| 187 | 3300049515 | Ga0501292_004593 | Ga0501292_004593_1032_1784 | 244 |
| 188 | 3300049520 | Ga0501297_013275 | Ga0501297_013275_25_777 | 244 |
| 189 | 3300049649 | Ga0501198_007283 | Ga0501198_007283_562_1314 | 244 |
| 190 | 3300049656 | Ga0501209_086214 | Ga0501209_086214_49_801 | 244 |
| 191 | 3300049661 | Ga0501217_000392 | Ga0501217_000392_4056_4808 | 244 |
| 192 | 3300049663 | Ga0501223_002306 | Ga0501223_002306_3243_3995 | 244 |
| 193 | 3300049665 | Ga0501227_000419 | Ga0501227_000419_2474_3226 | 244 |
| 194 | 3300049668 | Ga0501233_003913 | Ga0501233_003913_211_963 | 244 |
| 195 | 3300049669 | Ga0501235_006699 | Ga0501235_006699_272_1024 | 244 |
| 196 | 3300049673 | Ga0501240_003036 | Ga0501240_003036_829_1581 | 244 |
| 197 | 3300049679 | Ga0501249_040329 | Ga0501249_040329_35_787 | 244 |
| 198 | 3300049686 | Ga0501257_060683 | Ga0501257_060683_151_903 | 244 |
| 199 | 3300049705 | Ga0501225_0002302 | Ga0501225_0002302_3006_3758 | 244 |
| 200 | 3300049705 | Ga0501225_0023550 | Ga0501225_0023550_80_832 | 244 |
| 201 | 3300049705 | Ga0501225_0043422 | Ga0501225_0043422_13_765 | 244 |
| 202 | 3300049707 | Ga0501234_001008 | Ga0501234_001008_578_1330 | 244 |
| 203 | 3300049760 | Ga0501263_009137 | Ga0501263_009137_30_782 | 244 |
| 204 | 3300049853 | Ga0501226_007012 | Ga0501226_007012_171_923 | 244 |
| 205 | 3300050507 | nmdc:mga05p37_82913_c1 | nmdc:mga05p37_82913_c1_3040_3792 | 244 |
| 206 | 3300050507 | nmdc:mga05p37_895598_c1 | nmdc:mga05p37_895598_c1_24_776 | 244 |
| 207 | 3300050508 | nmdc:mga09592_269791_c1 | nmdc:mga09592_269791_c1_577_1329 | 244 |
| 208 | 3300050509 | nmdc:mga0qj67_348786_c1 | nmdc:mga0qj67_348786_c1_15_767 | 244 |
| 209 | 3300050509 | nmdc:mga0qj67_47167_c1 | nmdc:mga0qj67_47167_c1_2492_3244 | 244 |
| 210 | 3300050511 | nmdc:mga08y16_17931_c1 | nmdc:mga08y16_17931_c1_3797_4549 | 244 |
| 211 | 3300050511 | nmdc:mga08y16_244383_c1 | nmdc:mga08y16_244383_c1_344_1096 | 244 |
| 212 | 3300050512 | nmdc:mga0n895_601073_c1 | nmdc:mga0n895_601073_c1_125_877 | 244 |
| 213 | 3300050513 | nmdc:mga0rr50_72054_c1 | nmdc:mga0rr50_72054_c1_31_783 | 244 |
| 214 | 3300050515 | nmdc:mga0a205_177982_c1 | nmdc:mga0a205_177982_c1_143_895 | 244 |
| 215 | 3300050515 | nmdc:mga0a205_198289_c1 | nmdc:mga0a205_198289_c1_549_1301 | 244 |
| 216 | 3300050515 | nmdc:mga0a205_44105_c1 | nmdc:mga0a205_44105_c1_2368_3120 | 244 |
| 217 | 3300042144 | Ga0450889_003766 | Ga0450889_003766_463_1221 | 246 |
| 218 | 3300042157 | Ga0439458_0002859 | Ga0439458_0002859_88_846 | 246 |
| 219 | 3300005440 | Ga0070705_100362117 | Ga0070705_1003621171 | 248 |
| 220 | iso_pu_bacteria | 2919534386 | 2919537716 | 248 |
| 221 | iso_pu_bacteria | 2739367655 | 2739613150 | 249 |
| 222 | iso_pu_bacteria | 8002392321 | 8002394550 | 249 |
| 223 | iso_pu_bacteria | 8048746797 | 8048749572 | 249 |
| 224 | 3300037466 | Ga0395898_0053030 | Ga0395898_0053030_2594_3391 | 250 |
| 225 | iso_pu_bacteria | 2537561836 | 2538832412 | 250 |
| 226 | iso_pu_bacteria | 2643221562 | 2643830433 | 250 |
| 227 | iso_pu_bacteria | 2687453130 | 2687582456 | 250 |
| 228 | 3300005458 | Ga0070681_10012618 | Ga0070681_100126187 | 251 |
| 229 | 3300005549 | Ga0070704_100393916 | Ga0070704_1003939162 | 251 |
| 230 | 3300025912 | Ga0207707_10023298 | Ga0207707_100232984 | 251 |
| 231 | 3300042876 | Ga0451577_0062915 | Ga0451577_0062915_510_1268 | 251 |
| 232 | 3300045051 | Ga0451576_0000490 | Ga0451576_0000490_80095_80853 | 251 |
| 233 | iso_pu_bacteria | 2593339238 | 2595445748 | 251 |
| 234 | iso_pu_bacteria | 2593339239 | 2595449399 | 251 |
| 235 | iso_pu_bacteria | 2738543009 | 2739227417 | 251 |
| 236 | iso_pu_bacteria | 2818991440 | 2819563884 | 251 |
| 237 | iso_pu_bacteria | 2842914999 | 2842915599 | 251 |
| 238 | iso_pu_bacteria | 2842918807 | 2842919572 | 251 |
| 239 | iso_pu_bacteria | 2884338543 | 2884340125 | 251 |
| 240 | iso_pu_bacteria | 2904463128 | 2904464520 | 251 |
| 241 | iso_pu_bacteria | 2919085039 | 2919085790 | 251 |
| 242 | iso_pu_bacteria | 2919404418 | 2919405915 | 251 |
| 243 | iso_pu_bacteria | 2941471342 | 2941474609 | 251 |
| 244 | iso_pu_bacteria | 2953994433 | 2953997963 | 251 |
| 245 | iso_pu_bacteria | 8002869464 | 8002872542 | 251 |
| 246 | 3300005327 | Ga0070658_10040995 | Ga0070658_100409954 | 252 |
| 247 | 3300005329 | Ga0070683_100341668 | Ga0070683_1003416682 | 252 |
| 248 | 3300005331 | Ga0070670_100171689 | Ga0070670_1001716892 | 252 |
| 249 | 3300005337 | Ga0070682_100040957 | Ga0070682_1000409573 | 252 |
| 250 | 3300005338 | Ga0068868_100370875 | Ga0068868_1003708751 | 252 |
| 251 | 3300005339 | Ga0070660_100063451 | Ga0070660_1000634512 | 252 |
| 252 | 3300005347 | Ga0070668_100010998 | Ga0070668_1000109984 | 252 |
| 253 | 3300005354 | Ga0070675_100057996 | Ga0070675_1000579962 | 252 |
| 254 | 3300005355 | Ga0070671_100007584 | Ga0070671_1000075842 | 252 |
| 255 | 3300005355 | Ga0070671_100019383 | Ga0070671_1000193833 | 252 |
| 256 | 3300005356 | Ga0070674_100010419 | Ga0070674_1000104192 | 252 |
| 257 | 3300005366 | Ga0070659_100017308 | Ga0070659_1000173082 | 252 |
| 258 | 3300005434 | Ga0070709_10156858 | Ga0070709_101568582 | 252 |
| 259 | 3300005435 | Ga0070714_100028051 | Ga0070714_1000280515 | 252 |
| 260 | 3300005455 | Ga0070663_100233621 | Ga0070663_1002336212 | 252 |
| 261 | 3300005456 | Ga0070678_100161452 | Ga0070678_1001614522 | 252 |
| 262 | 3300005456 | Ga0070678_100365835 | Ga0070678_1003658352 | 252 |
| 263 | 3300005457 | Ga0070662_100479855 | Ga0070662_1004798552 | 252 |
| 264 | 3300005458 | Ga0070681_10004241 | Ga0070681_100042416 | 252 |
| 265 | 3300005530 | Ga0070679_100006483 | Ga0070679_1000064833 | 252 |
| 266 | 3300005530 | Ga0070679_100420621 | Ga0070679_1004206212 | 252 |
| 267 | 3300005535 | Ga0070684_100046220 | Ga0070684_1000462202 | 252 |
| 268 | 3300005539 | Ga0068853_100034519 | Ga0068853_1000345194 | 252 |
| 269 | 3300005539 | Ga0068853_100055834 | Ga0068853_1000558342 | 252 |
| 270 | 3300005543 | Ga0070672_100016560 | Ga0070672_1000165602 | 252 |
| 271 | 3300005547 | Ga0070693_100244316 | Ga0070693_1002443161 | 252 |
| 272 | 3300005563 | Ga0068855_100001822 | Ga0068855_10000182227 | 252 |
| 273 | 3300005564 | Ga0070664_100000284 | Ga0070664_10000028440 | 252 |
| 274 | 3300005577 | Ga0068857_100160021 | Ga0068857_1001600212 | 252 |
| 275 | 3300005577 | Ga0068857_100691664 | Ga0068857_1006916642 | 252 |
| 276 | 3300005578 | Ga0068854_100012317 | Ga0068854_1000123174 | 252 |
| 277 | 3300005578 | Ga0068854_100145988 | Ga0068854_1001459882 | 252 |
| 278 | 3300005614 | Ga0068856_100000238 | Ga0068856_10000023856 | 252 |
| 279 | 3300005614 | Ga0068856_100055306 | Ga0068856_1000553064 | 252 |
| 280 | 3300005614 | Ga0068856_100097250 | Ga0068856_1000972502 | 252 |
| 281 | 3300005834 | Ga0068851_10014190 | Ga0068851_100141903 | 252 |
| 282 | 3300005842 | Ga0068858_100084713 | Ga0068858_1000847133 | 252 |
| 283 | 3300006175 | Ga0070712_100500079 | Ga0070712_1005000791 | 252 |
| 284 | 3300006844 | Ga0075428_100035074 | Ga0075428_1000350743 | 252 |
| 285 | 3300009147 | Ga0114129_10038447 | Ga0114129_100384473 | 252 |
| 286 | 3300009174 | Ga0105241_10036968 | Ga0105241_100369684 | 252 |
| 287 | 3300009545 | Ga0105237_10034954 | Ga0105237_100349544 | 252 |
| 288 | 3300009551 | Ga0105238_10117867 | Ga0105238_101178672 | 252 |
| 289 | 3300010375 | Ga0105239_10218897 | Ga0105239_102188972 | 252 |
| 290 | 3300011119 | Ga0105246_10398285 | Ga0105246_103982852 | 252 |
| 291 | 3300013100 | Ga0157373_10000145 | Ga0157373_100001452 | 252 |
| 292 | 3300013100 | Ga0157373_10013447 | Ga0157373_100134472 | 252 |
| 293 | 3300013100 | Ga0157373_10013721 | Ga0157373_100137215 | 252 |
| 294 | 3300013102 | Ga0157371_10000174 | Ga0157371_1000017438 | 252 |
| 295 | 3300013104 | Ga0157370_10003047 | Ga0157370_100030472 | 252 |
| 296 | 3300013104 | Ga0157370_10042286 | Ga0157370_100422862 | 252 |
| 297 | 3300013104 | Ga0157370_10436109 | Ga0157370_104361092 | 252 |
| 298 | 3300013105 | Ga0157369_10244558 | Ga0157369_102445583 | 252 |
| 299 | 3300013297 | Ga0157378_10035172 | Ga0157378_100351721 | 252 |
| 300 | 3300013307 | Ga0157372_10020695 | Ga0157372_100206954 | 252 |
| 301 | 3300013307 | Ga0157372_10048007 | Ga0157372_100480072 | 252 |
| 302 | 3300013307 | Ga0157372_10109277 | Ga0157372_101092772 | 252 |
| 303 | 3300014968 | Ga0157379_10024068 | Ga0157379_100240685 | 252 |
| 304 | 3300020070 | Ga0206356_11228936 | Ga0206356_112289363 | 252 |
| 305 | 3300020082 | Ga0206353_10991319 | Ga0206353_109913192 | 252 |
| 306 | 3300025321 | Ga0207656_10208490 | Ga0207656_102084901 | 252 |
| 307 | 3300025903 | Ga0207680_10073532 | Ga0207680_100735321 | 252 |
| 308 | 3300025909 | Ga0207705_10123931 | Ga0207705_101239312 | 252 |
| 309 | 3300025911 | Ga0207654_10049534 | Ga0207654_100495342 | 252 |
| 310 | 3300025912 | Ga0207707_10006527 | Ga0207707_100065274 | 252 |
| 311 | 3300025912 | Ga0207707_10009412 | Ga0207707_100094128 | 252 |
| 312 | 3300025913 | Ga0207695_10092009 | Ga0207695_100920092 | 252 |
| 313 | 3300025915 | Ga0207693_10404518 | Ga0207693_104045182 | 252 |
| 314 | 3300025917 | Ga0207660_10018985 | Ga0207660_100189852 | 252 |
| 315 | 3300025917 | Ga0207660_10072519 | Ga0207660_100725192 | 252 |
| 316 | 3300025919 | Ga0207657_10000193 | Ga0207657_1000019350 | 252 |
| 317 | 3300025919 | Ga0207657_10000234 | Ga0207657_1000023416 | 252 |
| 318 | 3300025920 | Ga0207649_10015990 | Ga0207649_100159902 | 252 |
| 319 | 3300025920 | Ga0207649_10016120 | Ga0207649_100161202 | 252 |
| 320 | 3300025921 | Ga0207652_10005477 | Ga0207652_100054779 | 252 |
| 321 | 3300025921 | Ga0207652_10060943 | Ga0207652_100609432 | 252 |
| 322 | 3300025921 | Ga0207652_10180709 | Ga0207652_101807093 | 252 |
| 323 | 3300025923 | Ga0207681_10017812 | Ga0207681_100178122 | 252 |
| 324 | 3300025924 | Ga0207694_10147102 | Ga0207694_101471022 | 252 |
| 325 | 3300025924 | Ga0207694_10297168 | Ga0207694_102971681 | 252 |
| 326 | 3300025925 | Ga0207650_10160890 | Ga0207650_101608903 | 252 |
| 327 | 3300025926 | Ga0207659_10071561 | Ga0207659_100715612 | 252 |
| 328 | 3300025929 | Ga0207664_10078072 | Ga0207664_100780722 | 252 |
| 329 | 3300025931 | Ga0207644_10002052 | Ga0207644_1000205210 | 252 |
| 330 | 3300025931 | Ga0207644_10084074 | Ga0207644_100840743 | 252 |
| 331 | 3300025932 | Ga0207690_10000627 | Ga0207690_1000062715 | 252 |
| 332 | 3300025932 | Ga0207690_10276183 | Ga0207690_102761832 | 252 |
| 333 | 3300025933 | Ga0207706_10000097 | Ga0207706_100000978 | 252 |
| 334 | 3300025933 | Ga0207706_10464704 | Ga0207706_104647042 | 252 |
| 335 | 3300025945 | Ga0207679_10023530 | Ga0207679_100235301 | 252 |
| 336 | 3300025949 | Ga0207667_10028287 | Ga0207667_100282872 | 252 |
| 337 | 3300025960 | Ga0207651_10004426 | Ga0207651_100044262 | 252 |
| 338 | 3300025961 | Ga0207712_10465107 | Ga0207712_104651072 | 252 |
| 339 | 3300025972 | Ga0207668_10009323 | Ga0207668_100093234 | 252 |
| 340 | 3300025981 | Ga0207640_10059818 | Ga0207640_100598183 | 252 |
| 341 | 3300025981 | Ga0207640_10071559 | Ga0207640_100715593 | 252 |
| 342 | 3300025986 | Ga0207658_10133975 | Ga0207658_101339752 | 252 |
| 343 | 3300026023 | Ga0207677_10385048 | Ga0207677_103850482 | 252 |
| 344 | 3300026041 | Ga0207639_10009456 | Ga0207639_100094567 | 252 |
| 345 | 3300026041 | Ga0207639_10326535 | Ga0207639_103265352 | 252 |
| 346 | 3300026067 | Ga0207678_10015018 | Ga0207678_100150182 | 252 |
| 347 | 3300026067 | Ga0207678_10042523 | Ga0207678_100425233 | 252 |
| 348 | 3300026078 | Ga0207702_10021190 | Ga0207702_100211903 | 252 |
| 349 | 3300026078 | Ga0207702_10533868 | Ga0207702_105338681 | 252 |
| 350 | 3300026088 | Ga0207641_10059659 | Ga0207641_100596592 | 252 |
| 351 | 3300026116 | Ga0207674_10043503 | Ga0207674_100435032 | 252 |
| 352 | 3300026116 | Ga0207674_10062147 | Ga0207674_100621475 | 252 |
| 353 | 3300026121 | Ga0207683_10131010 | Ga0207683_101310102 | 252 |
| 354 | 3300026142 | Ga0207698_10043169 | Ga0207698_100431692 | 252 |
| 355 | 3300028381 | Ga0268264_10173582 | Ga0268264_101735822 | 252 |
| 356 | 3300031548 | Ga0307408_100001522 | Ga0307408_10000152216 | 252 |
| 357 | 3300031824 | Ga0307413_10001172 | Ga0307413_100011724 | 252 |
| 358 | 3300031901 | Ga0307406_10316047 | Ga0307406_103160472 | 252 |
| 359 | 3300031903 | Ga0307407_10009948 | Ga0307407_100099482 | 252 |
| 360 | 3300031903 | Ga0307407_10374759 | Ga0307407_103747592 | 252 |
| 361 | 3300031911 | Ga0307412_10082467 | Ga0307412_100824672 | 252 |
| 362 | 3300031911 | Ga0307412_10117655 | Ga0307412_101176552 | 252 |
| 363 | 3300032002 | Ga0307416_100008950 | Ga0307416_1000089502 | 252 |
| 364 | 3300032004 | Ga0307414_10051296 | Ga0307414_100512963 | 252 |
| 365 | 3300032005 | Ga0307411_10019968 | Ga0307411_100199684 | 252 |
| 366 | 3300032005 | Ga0307411_10028717 | Ga0307411_100287172 | 252 |
| 367 | 3300035090 | Ga0373949_0059215 | Ga0373949_0059215_142_927 | 252 |
| 368 | 3300035691 | Ga0373931_0020639 | Ga0373931_0020639_2246_3031 | 252 |
| 369 | 3300037418 | Ga0395900_0008421 | Ga0395900_0008421_8975_9790 | 252 |
| 370 | 3300037466 | Ga0395898_0181060 | Ga0395898_0181060_326_1141 | 252 |
| 371 | 3300048904 | Ga0496101_0085001 | Ga0496101_0085001_182_967 | 252 |
| 372 | 3300048905 | Ga0496102_0007152 | Ga0496102_0007152_1771_2556 | 252 |
| 373 | 3300048910 | Ga0496107_0008205 | Ga0496107_0008205_6218_7003 | 252 |
| 374 | 3300050507 | nmdc:mga05p37_280222_c1 | nmdc:mga05p37_280222_c1_705_1490 | 252 |
| 375 | 3300005327 | Ga0070658_10007718 | Ga0070658_100077186 | 253 |
| 376 | 3300005340 | Ga0070689_100210824 | Ga0070689_1002108242 | 253 |
| 377 | 3300005365 | Ga0070688_100055843 | Ga0070688_1000558431 | 253 |
| 378 | 3300005543 | Ga0070672_100128033 | Ga0070672_1001280332 | 253 |
| 379 | 3300005549 | Ga0070704_100139640 | Ga0070704_1001396402 | 253 |
| 380 | 3300005719 | Ga0068861_100281273 | Ga0068861_1002812732 | 253 |
| 381 | 3300009551 | Ga0105238_10708059 | Ga0105238_107080591 | 253 |
| 382 | 3300009553 | Ga0105249_10332951 | Ga0105249_103329512 | 253 |
| 383 | 3300013306 | Ga0163162_10139478 | Ga0163162_101394782 | 253 |
| 384 | 3300025909 | Ga0207705_10022212 | Ga0207705_100222123 | 253 |
| 385 | 3300025960 | Ga0207651_10204540 | Ga0207651_102045401 | 253 |
| 386 | 3300026116 | Ga0207674_10016443 | Ga0207674_1001644310 | 253 |
| 387 | 3300030521 | Ga0307511_10000291 | Ga0307511_100002916 | 253 |
| 388 | 3300032002 | Ga0307416_100125391 | Ga0307416_1001253913 | 253 |
| 389 | 3300033179 | Ga0307507_10114012 | Ga0307507_101140122 | 253 |
| 390 | 3300002705 | JGI25156J39149_1003324 | JGI25156J39149_10033242 | 254 |
| 391 | 3300002738 | JGI25154J39366_1004852 | JGI25154J39366_10048522 | 254 |
| 392 | 3300002741 | JGI25157J39369_1001473 | JGI25157J39369_10014733 | 254 |
| 393 | 3300002741 | JGI25157J39369_1003405 | JGI25157J39369_10034054 | 254 |
| 394 | 3300002772 | JGI25164J39214_1000587 | JGI25164J39214_10005874 | 254 |
| 395 | 3300003214 | JGI25165J46597_1001159 | JGI25165J46597_10011594 | 254 |
| 396 | 3300003756 | Ga0055533_1006060 | Ga0055533_10060603 | 254 |
| 397 | 3300003761 | Ga0055535_1000395 | Ga0055535_10003954 | 254 |
| 398 | 3300003761 | Ga0055535_1001113 | Ga0055535_100111313 | 254 |
| 399 | 3300003762 | Ga0055542_1000167 | Ga0055542_100016740 | 254 |
| 400 | 3300003763 | Ga0055529_1000908 | Ga0055529_10009083 | 254 |
| 401 | 3300005262 | Ga0065165_1006139 | Ga0065165_10061396 | 254 |
| 402 | 3300005563 | Ga0068855_100020227 | Ga0068855_1000202274 | 254 |
| 403 | 3300005577 | Ga0068857_100014323 | Ga0068857_1000143236 | 254 |
| 404 | 3300005578 | Ga0068854_100001800 | Ga0068854_1000018006 | 254 |
| 405 | 3300005617 | Ga0068859_100302356 | Ga0068859_1003023561 | 254 |
| 406 | 3300005843 | Ga0068860_100130963 | Ga0068860_1001309632 | 254 |
| 407 | 3300005844 | Ga0068862_100063373 | Ga0068862_1000633733 | 254 |
| 408 | 3300006844 | Ga0075428_100054022 | Ga0075428_1000540223 | 254 |
| 409 | 3300006846 | Ga0075430_100253210 | Ga0075430_1002532102 | 254 |
| 410 | 3300006931 | Ga0097620_100302356 | Ga0097620_1003023561 | 254 |
| 411 | 3300009093 | Ga0105240_10083667 | Ga0105240_100836672 | 254 |
| 412 | 3300013105 | Ga0157369_10241690 | Ga0157369_102416902 | 254 |
| 413 | 3300025228 | Ga0209672_100198 | Ga0209672_10019841 | 254 |
| 414 | 3300025228 | Ga0209672_100599 | Ga0209672_10059921 | 254 |
| 415 | 3300025231 | Ga0207427_100036 | Ga0207427_100036247 | 254 |
| 416 | 3300025233 | Ga0209437_101013 | Ga0209437_1010137 | 254 |
| 417 | 3300025242 | Ga0209258_100035 | Ga0209258_100035196 | 254 |
| 418 | 3300025242 | Ga0209258_100379 | Ga0209258_10037913 | 254 |
| 419 | 3300025242 | Ga0209258_103102 | Ga0209258_1031022 | 254 |
| 420 | 3300025246 | Ga0209646_1005067 | Ga0209646_10050673 | 254 |
| 421 | 3300025250 | Ga0209026_1000056 | Ga0209026_1000056155 | 254 |
| 422 | 3300025250 | Ga0209026_1000513 | Ga0209026_100051316 | 254 |
| 423 | 3300025250 | Ga0209026_1010953 | Ga0209026_10109532 | 254 |
| 424 | 3300025254 | Ga0209148_1000045 | Ga0209148_100004543 | 254 |
| 425 | 3300025254 | Ga0209148_1000048 | Ga0209148_1000048166 | 254 |
| 426 | 3300025256 | Ga0209759_1000166 | Ga0209759_100016636 | 254 |
| 427 | 3300025256 | Ga0209759_1000670 | Ga0209759_10006704 | 254 |
| 428 | 3300025261 | Ga0209233_1000101 | Ga0209233_1000101247 | 254 |
| 429 | 3300025272 | Ga0209455_1000035 | Ga0209455_100003543 | 254 |
| 430 | 3300025272 | Ga0209455_1009763 | Ga0209455_10097632 | 254 |
| 431 | 3300025913 | Ga0207695_10038674 | Ga0207695_100386742 | 254 |
| 432 | 3300025913 | Ga0207695_10103134 | Ga0207695_101031342 | 254 |
| 433 | 3300025949 | Ga0207667_10004853 | Ga0207667_100048539 | 254 |
| 434 | 3300025981 | Ga0207640_10000572 | Ga0207640_100005729 | 254 |
| 435 | 3300026116 | Ga0207674_10025639 | Ga0207674_100256394 | 254 |
| 436 | 3300028380 | Ga0268265_10055139 | Ga0268265_100551393 | 254 |
| 437 | 3300037312 | Ga0395899_0010991 | Ga0395899_0010991_2817_3584 | 254 |
| 438 | 3300037312 | Ga0395899_0011924 | Ga0395899_0011924_4749_5516 | 254 |
| 439 | 3300037418 | Ga0395900_0000107 | Ga0395900_0000107_77600_78367 | 254 |
| 440 | 3300037418 | Ga0395900_0115104 | Ga0395900_0115104_1169_1936 | 254 |
| 441 | 3300037466 | Ga0395898_0000078 | Ga0395898_0000078_42901_43668 | 254 |
| 442 | 3300037466 | Ga0395898_0101704 | Ga0395898_0101704_824_1591 | 254 |
| 443 | 3300038443 | Ga0395901_0978061 | Ga0395901_0978061_32_799 | 254 |
| 444 | 3300044656 | Ga0466969_0002513 | Ga0466969_0002513_1097_1864 | 254 |
| 445 | 3300044656 | Ga0466969_0024094 | Ga0466969_0024094_238_1005 | 254 |
| 446 | 3300044662 | Ga0466976_0269238 | Ga0466976_0269238_14_781 | 254 |
| 447 | 3300044693 | Ga0466961_0000906 | Ga0466961_0000906_10034_10801 | 254 |
| 448 | 3300044693 | Ga0466961_0002884 | Ga0466961_0002884_5915_6682 | 254 |
| 449 | 3300044693 | Ga0466961_0008386 | Ga0466961_0008386_2137_2904 | 254 |
| 450 | 3300044694 | Ga0466963_0210316 | Ga0466963_0210316_28_795 | 254 |
| 451 | 3300044706 | Ga0466964_0008393 | Ga0466964_0008393_2860_3627 | 254 |
| 452 | 3300044719 | Ga0466971_0014434 | Ga0466971_0014434_1185_1952 | 254 |
| 453 | 3300044719 | Ga0466971_0072250 | Ga0466971_0072250_345_1112 | 254 |
| 454 | 3300044765 | Ga0466970_0005775 | Ga0466970_0005775_3983_4750 | 254 |
| 455 | 3300044842 | Ga0466957_0062767 | Ga0466957_0062767_808_1575 | 254 |
| 456 | 3300045049 | Ga0466959_0002734 | Ga0466959_0002734_7198_7965 | 254 |
| 457 | 3300045836 | Ga0466958_0081242 | Ga0466958_0081242_762_1529 | 254 |
| 458 | 3300045976 | Ga0466967_0011210 | Ga0466967_0011210_5337_6104 | 254 |
| 459 | 3300048922 | Ga0496119_0031754 | Ga0496119_0031754_871_1641 | 254 |
| 460 | 3300048923 | Ga0496120_0002521 | Ga0496120_0002521_2458_3228 | 254 |
| 461 | 3300048929 | Ga0496126_0031117 | Ga0496126_0031117_2467_3237 | 254 |
| 462 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_553701_554483 | 254 |
| 463 | 3300061719 | Ga0466962_0002526 | Ga0466962_0002526_3203_3970 | 254 |
| 464 | 3300001904 | JGI24736J21556_1003392 | JGI24736J21556_10033923 | 255 |
| 465 | 3300005262 | Ga0065165_1000113 | Ga0065165_10001139 | 255 |
| 466 | 3300005327 | Ga0070658_10022952 | Ga0070658_100229522 | 255 |
| 467 | 3300005331 | Ga0070670_100051251 | Ga0070670_1000512513 | 255 |
| 468 | 3300005335 | Ga0070666_10000007 | Ga0070666_10000007193 | 255 |
| 469 | 3300005344 | Ga0070661_100122142 | Ga0070661_1001221422 | 255 |
| 470 | 3300005366 | Ga0070659_100130734 | Ga0070659_1001307342 | 255 |
| 471 | 3300005367 | Ga0070667_100037500 | Ga0070667_1000375003 | 255 |
| 472 | 3300005435 | Ga0070714_100003249 | Ga0070714_1000032492 | 255 |
| 473 | 3300005439 | Ga0070711_100490752 | Ga0070711_1004907521 | 255 |
| 474 | 3300005444 | Ga0070694_100020752 | Ga0070694_1000207523 | 255 |
| 475 | 3300005458 | Ga0070681_10098046 | Ga0070681_100980463 | 255 |
| 476 | 3300005530 | Ga0070679_100001229 | Ga0070679_10000122911 | 255 |
| 477 | 3300005545 | Ga0070695_100042586 | Ga0070695_1000425863 | 255 |
| 478 | 3300005548 | Ga0070665_100000817 | Ga0070665_10000081724 | 255 |
| 479 | 3300005577 | Ga0068857_100061456 | Ga0068857_1000614562 | 255 |
| 480 | 3300005578 | Ga0068854_100097033 | Ga0068854_1000970332 | 255 |
| 481 | 3300005616 | Ga0068852_100123517 | Ga0068852_1001235173 | 255 |
| 482 | 3300005834 | Ga0068851_10174682 | Ga0068851_101746822 | 255 |
| 483 | 3300005842 | Ga0068858_100014053 | Ga0068858_1000140533 | 255 |
| 484 | 3300005843 | Ga0068860_100084274 | Ga0068860_1000842743 | 255 |
| 485 | 3300006186 | Ga0075369_10022335 | Ga0075369_100223353 | 255 |
| 486 | 3300006844 | Ga0075428_100002002 | Ga0075428_1000020029 | 255 |
| 487 | 3300009094 | Ga0111539_10001653 | Ga0111539_1000165313 | 255 |
| 488 | 3300009101 | Ga0105247_10007410 | Ga0105247_100074102 | 255 |
| 489 | 3300009174 | Ga0105241_10026775 | Ga0105241_100267753 | 255 |
| 490 | 3300009551 | Ga0105238_10001931 | Ga0105238_1000193118 | 255 |
| 491 | 3300009551 | Ga0105238_10164265 | Ga0105238_101642653 | 255 |
| 492 | 3300009551 | Ga0105238_10370323 | Ga0105238_103703232 | 255 |
| 493 | 3300010375 | Ga0105239_10065981 | Ga0105239_100659815 | 255 |
| 494 | 3300011119 | Ga0105246_10020847 | Ga0105246_100208472 | 255 |
| 495 | 3300013104 | Ga0157370_10000033 | Ga0157370_1000003369 | 255 |
| 496 | 3300013104 | Ga0157370_10009303 | Ga0157370_100093038 | 255 |
| 497 | 3300013104 | Ga0157370_10065207 | Ga0157370_100652072 | 255 |
| 498 | 3300013105 | Ga0157369_10000107 | Ga0157369_1000010749 | 255 |
| 499 | 3300013105 | Ga0157369_10067705 | Ga0157369_100677052 | 255 |
| 500 | 3300013306 | Ga0163162_10001668 | Ga0163162_100016684 | 255 |
| 501 | 3300013307 | Ga0157372_10033705 | Ga0157372_100337053 | 255 |
| 502 | 3300014497 | Ga0182008_10006502 | Ga0182008_100065027 | 255 |
| 503 | 3300014497 | Ga0182008_10049075 | Ga0182008_100490752 | 255 |
| 504 | 3300015261 | Ga0182006_1000027 | Ga0182006_100002738 | 255 |
| 505 | 3300015262 | Ga0182007_10024281 | Ga0182007_100242812 | 255 |
| 506 | 3300015265 | Ga0182005_1000054 | Ga0182005_100005446 | 255 |
| 507 | 3300015265 | Ga0182005_1013044 | Ga0182005_10130441 | 255 |
| 508 | 3300015265 | Ga0182005_1024884 | Ga0182005_10248842 | 255 |
| 509 | 3300017792 | Ga0163161_10039751 | Ga0163161_100397512 | 255 |
| 510 | 3300025226 | Ga0209674_100711 | Ga0209674_1007113 | 255 |
| 511 | 3300025229 | Ga0209147_108415 | Ga0209147_1084152 | 255 |
| 512 | 3300025233 | Ga0209437_101381 | Ga0209437_1013811 | 255 |
| 513 | 3300025254 | Ga0209148_1003490 | Ga0209148_10034905 | 255 |
| 514 | 3300025292 | Ga0209676_1002569 | Ga0209676_10025692 | 255 |
| 515 | 3300025297 | Ga0209758_1025347 | Ga0209758_10253473 | 255 |
| 516 | 3300025304 | Ga0209257_1050858 | Ga0209257_10508582 | 255 |
| 517 | 3300025321 | Ga0207656_10094643 | Ga0207656_100946432 | 255 |
| 518 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002633 | 255 |
| 519 | 3300025904 | Ga0207647_10000548 | Ga0207647_1000054822 | 255 |
| 520 | 3300025904 | Ga0207647_10019324 | Ga0207647_100193243 | 255 |
| 521 | 3300025909 | Ga0207705_10032332 | Ga0207705_100323322 | 255 |
| 522 | 3300025911 | Ga0207654_10098110 | Ga0207654_100981102 | 255 |
| 523 | 3300025912 | Ga0207707_10000044 | Ga0207707_1000004435 | 255 |
| 524 | 3300025914 | Ga0207671_10087119 | Ga0207671_100871192 | 255 |
| 525 | 3300025917 | Ga0207660_10010225 | Ga0207660_100102252 | 255 |
| 526 | 3300025919 | Ga0207657_10001113 | Ga0207657_100011135 | 255 |
| 527 | 3300025921 | Ga0207652_10000462 | Ga0207652_1000046235 | 255 |
| 528 | 3300025924 | Ga0207694_10000177 | Ga0207694_1000017723 | 255 |
| 529 | 3300025924 | Ga0207694_10312147 | Ga0207694_103121472 | 255 |
| 530 | 3300025929 | Ga0207664_10000884 | Ga0207664_1000088410 | 255 |
| 531 | 3300025942 | Ga0207689_10048353 | Ga0207689_100483532 | 255 |
| 532 | 3300025949 | Ga0207667_10044577 | Ga0207667_100445774 | 255 |
| 533 | 3300025981 | Ga0207640_10112231 | Ga0207640_101122312 | 255 |
| 534 | 3300026078 | Ga0207702_10524949 | Ga0207702_105249492 | 255 |
| 535 | 3300026116 | Ga0207674_10008517 | Ga0207674_100085175 | 255 |
| 536 | 3300027907 | Ga0207428_10015306 | Ga0207428_100153063 | 255 |
| 537 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004629 | 255 |
| 538 | 3300028381 | Ga0268264_10074513 | Ga0268264_100745133 | 255 |
| 539 | 3300031824 | Ga0307413_10387086 | Ga0307413_103870862 | 255 |
| 540 | 3300032004 | Ga0307414_10188432 | Ga0307414_101884322 | 255 |
| 541 | 3300033180 | Ga0307510_10001742 | Ga0307510_100017428 | 255 |
| 542 | 3300033180 | Ga0307510_10102827 | Ga0307510_101028272 | 255 |
| 543 | 3300038443 | Ga0395901_0002361 | Ga0395901_0002361_10631_11458 | 255 |
| 544 | 3300041404 | Ga0439436_0000026 | Ga0439436_0000026_6561_7328 | 255 |
| 545 | 3300041413 | Ga0439465_0000172 | Ga0439465_0000172_14790_15557 | 255 |
| 546 | 3300041491 | Ga0451833_1420711 | Ga0451833_1420711_482_1249 | 255 |
| 547 | 3300042184 | Ga0450908_002562 | Ga0450908_002562_1165_1932 | 255 |
| 548 | 3300044672 | Ga0466982_0007854 | Ga0466982_0007854_3353_4120 | 255 |
| 549 | 3300044735 | Ga0466968_0003694 | Ga0466968_0003694_1196_1963 | 255 |
| 550 | 3300044842 | Ga0466957_0489570 | Ga0466957_0489570_33_800 | 255 |
| 551 | 3300045051 | Ga0451576_0547136 | Ga0451576_0547136_404_1204 | 255 |
| 552 | 3300046452 | Ga0495617_000321 | Ga0495617_000321_4202_4969 | 255 |
| 553 | 3300046452 | Ga0495617_000583 | Ga0495617_000583_10374_11141 | 255 |
| 554 | 3300046460 | Ga0495638_0000873 | Ga0495638_0000873_10819_11586 | 255 |
| 555 | 3300046471 | Ga0495650_0000250 | Ga0495650_0000250_47794_48564 | 255 |
| 556 | 3300046471 | Ga0495650_0001452 | Ga0495650_0001452_3713_4480 | 255 |
| 557 | 3300046471 | Ga0495650_0050865 | Ga0495650_0050865_261_1028 | 255 |
| 558 | 3300046492 | Ga0495585_0000019 | Ga0495585_0000019_70496_71263 | 255 |
| 559 | 3300046492 | Ga0495585_0009413 | Ga0495585_0009413_4064_4831 | 255 |
| 560 | 3300046501 | Ga0495607_0000250 | Ga0495607_0000250_56756_57523 | 255 |
| 561 | 3300046501 | Ga0495607_0000538 | Ga0495607_0000538_7281_8048 | 255 |
| 562 | 3300046501 | Ga0495607_0021990 | Ga0495607_0021990_3011_3778 | 255 |
| 563 | 3300046507 | Ga0495606_0000665 | Ga0495606_0000665_49740_50507 | 255 |
| 564 | 3300046507 | Ga0495606_0000888 | Ga0495606_0000888_25603_26370 | 255 |
| 565 | 3300046507 | Ga0495606_0010914 | Ga0495606_0010914_3661_4428 | 255 |
| 566 | 3300046507 | Ga0495606_0027722 | Ga0495606_0027722_1660_2427 | 255 |
| 567 | 3300046507 | Ga0495606_0070583 | Ga0495606_0070583_767_1534 | 255 |
| 568 | 3300046512 | Ga0495610_0007835 | Ga0495610_0007835_5172_5939 | 255 |
| 569 | 3300046513 | Ga0495616_0000047 | Ga0495616_0000047_24255_25022 | 255 |
| 570 | 3300046515 | Ga0495620_0001659 | Ga0495620_0001659_2690_3457 | 255 |
| 571 | 3300046515 | Ga0495620_0009649 | Ga0495620_0009649_645_1412 | 255 |
| 572 | 3300046518 | Ga0495631_0001326 | Ga0495631_0001326_10061_10828 | 255 |
| 573 | 3300046518 | Ga0495631_0003442 | Ga0495631_0003442_3639_4406 | 255 |
| 574 | 3300046519 | Ga0495632_0000080 | Ga0495632_0000080_64602_65384 | 255 |
| 575 | 3300046519 | Ga0495632_0016870 | Ga0495632_0016870_1738_2505 | 255 |
| 576 | 3300046519 | Ga0495632_0071241 | Ga0495632_0071241_460_1227 | 255 |
| 577 | 3300046520 | Ga0495637_0018732 | Ga0495637_0018732_1585_2352 | 255 |
| 578 | 3300046524 | Ga0495648_0000424 | Ga0495648_0000424_35478_36245 | 255 |
| 579 | 3300046538 | Ga0495609_0026527 | Ga0495609_0026527_1695_2462 | 255 |
| 580 | 3300046616 | Ga0495668_0012653 | Ga0495668_0012653_3625_4392 | 255 |
| 581 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_605121_605888 | 255 |
| 582 | 3300046648 | Ga0495611_0000955 | Ga0495611_0000955_10421_11188 | 255 |
| 583 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_1310159_1310926 | 255 |
| 584 | 3300046660 | Ga0495625_0018610 | Ga0495625_0018610_1403_2170 | 255 |
| 585 | 3300046660 | Ga0495625_0022138 | Ga0495625_0022138_2885_3652 | 255 |
| 586 | 3300046660 | Ga0495625_0027249 | Ga0495625_0027249_3165_3932 | 255 |
| 587 | 3300046665 | Ga0495661_0001772 | Ga0495661_0001772_6353_7120 | 255 |
| 588 | 3300046665 | Ga0495661_0063471 | Ga0495661_0063471_661_1428 | 255 |
| 589 | 3300046691 | Ga0495670_0002102 | Ga0495670_0002102_3771_4538 | 255 |
| 590 | 3300046691 | Ga0495670_0057167 | Ga0495670_0057167_152_919 | 255 |
| 591 | 3300046691 | Ga0495670_0062949 | Ga0495670_0062949_140_907 | 255 |
| 592 | 3300046692 | Ga0495671_0000552 | Ga0495671_0000552_16567_17334 | 255 |
| 593 | 3300046794 | Ga0495589_0000272 | Ga0495589_0000272_10993_11760 | 255 |
| 594 | 3300046810 | Ga0495660_0000746 | Ga0495660_0000746_21120_21887 | 255 |
| 595 | 3300046810 | Ga0495660_0001683 | Ga0495660_0001683_2652_3419 | 255 |
| 596 | 3300047323 | Ga0495683_0002438 | Ga0495683_0002438_4656_5423 | 255 |
| 597 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_982708_983475 | 255 |
| 598 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_1380508_1381275 | 255 |
| 599 | 3300047469 | Ga0495673_0000099 | Ga0495673_0000099_8003_8770 | 255 |
| 600 | 3300047469 | Ga0495673_0002188 | Ga0495673_0002188_11157_12050 | 255 |
| 601 | 3300047470 | Ga0495681_0033967 | Ga0495681_0033967_395_1162 | 255 |
| 602 | 3300047472 | Ga0495686_0000255 | Ga0495686_0000255_45746_46513 | 255 |
| 603 | 3300047472 | Ga0495686_0000276 | Ga0495686_0000276_68295_69062 | 255 |
| 604 | 3300047472 | Ga0495686_0202759 | Ga0495686_0202759_346_1113 | 255 |
| 605 | 3300048903 | Ga0496100_0168472 | Ga0496100_0168472_719_1486 | 255 |
| 606 | 3300048904 | Ga0496101_0000936 | Ga0496101_0000936_440_1207 | 255 |
| 607 | 3300048905 | Ga0496102_0211519 | Ga0496102_0211519_744_1511 | 255 |
| 608 | 3300048909 | Ga0496106_0000153 | Ga0496106_0000153_29845_30612 | 255 |
| 609 | 3300048919 | Ga0496116_0137687 | Ga0496116_0137687_446_1213 | 255 |
| 610 | 3300048919 | Ga0496116_0139433 | Ga0496116_0139433_211_978 | 255 |
| 611 | 3300048919 | Ga0496116_0178578 | Ga0496116_0178578_289_1056 | 255 |
| 612 | 3300048920 | Ga0496117_0108213 | Ga0496117_0108213_658_1425 | 255 |
| 613 | 3300048920 | Ga0496117_0193852 | Ga0496117_0193852_293_1060 | 255 |
| 614 | 3300048921 | Ga0496118_0000749 | Ga0496118_0000749_8952_9719 | 255 |
| 615 | 3300048921 | Ga0496118_0006551 | Ga0496118_0006551_1686_2453 | 255 |
| 616 | 3300048922 | Ga0496119_0120649 | Ga0496119_0120649_194_961 | 255 |
| 617 | 3300048924 | Ga0496121_0000210 | Ga0496121_0000210_55230_55997 | 255 |
| 618 | 3300048924 | Ga0496121_0003580 | Ga0496121_0003580_21_788 | 255 |
| 619 | 3300048925 | Ga0496122_0026085 | Ga0496122_0026085_634_1401 | 255 |
| 620 | 3300048925 | Ga0496122_0029343 | Ga0496122_0029343_102_869 | 255 |
| 621 | 3300048926 | Ga0496123_0003137 | Ga0496123_0003137_12057_12824 | 255 |
| 622 | 3300048926 | Ga0496123_0024748 | Ga0496123_0024748_607_1374 | 255 |
| 623 | 3300048926 | Ga0496123_0090032 | Ga0496123_0090032_938_1705 | 255 |
| 624 | 3300048927 | Ga0496124_0000582 | Ga0496124_0000582_53813_54580 | 255 |
| 625 | 3300048927 | Ga0496124_0005258 | Ga0496124_0005258_7688_8455 | 255 |
| 626 | 3300048927 | Ga0496124_0133656 | Ga0496124_0133656_1132_1899 | 255 |
| 627 | 3300048928 | Ga0496125_0003846 | Ga0496125_0003846_11694_12461 | 255 |
| 628 | 3300048929 | Ga0496126_0025112 | Ga0496126_0025112_894_1661 | 255 |
| 629 | 3300048929 | Ga0496126_0122272 | Ga0496126_0122272_36_806 | 255 |
| 630 | 3300049459 | Ga0495678_000207 | Ga0495678_000207_10661_11428 | 255 |
| 631 | 3300049460 | Ga0495682_0002356 | Ga0495682_0002356_2753_3520 | 255 |
| 632 | 3300049586 | Ga0501070_0012849 | Ga0501070_0012849_611_1396 | 255 |
| 633 | 3300049742 | Ga0501080_0150206 | Ga0501080_0150206_390_1175 | 255 |
| 634 | 3300050511 | nmdc:mga08y16_4046_c1 | nmdc:mga08y16_4046_c1_10722_11519 | 255 |
| 635 | 3300050516 | nmdc:mga0sz30_21548_c1 | nmdc:mga0sz30_21548_c1_1591_2358 | 255 |
| 636 | 3300050516 | nmdc:mga0sz30_74707_c1 | nmdc:mga0sz30_74707_c1_424_1191 | 255 |
| 637 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_1218564_1219331 | 255 |
| 638 | 3300053103 | Ga0500555_001433 | Ga0500555_001433_6525_7292 | 255 |
| 639 | 3300053160 | Ga0500633_0027065 | Ga0500633_0027065_958_1725 | 255 |
| 640 | 3300053730 | Ga0500645_000733 | Ga0500645_000733_18407_19174 | 255 |
| 641 | iso_pu_bacteria | 2718218334 | 2721027944 | 255 |
| 642 | iso_pu_bacteria | 2734482264 | 2735836484 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nr0-assembly1.cif.gz_B | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9746 | 2 | 250 |
| 2nre-assembly1.cif.gz_A-2 | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9671 | 2 | 250 |
| 2nr0-assembly1.cif.gz_B | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9484 | 2 | 250 |
| 1vs3-assembly1.cif.gz_B | crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 | 0.9359 | 2 | 244 |
| 2nre-assembly1.cif.gz_A-2 | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9227 | 2 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nqpB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.991 | 2 | 104 | 3.30.70.580 |
| af_A0A0R0F7R0_40_148_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9616 | 2 | 104 | 3.30.70.580 |
| af_Q2FW37_1_104_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9584 | 1 | 102 | 3.30.70.580 |
| 2nreA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain | 0.9583 | 106 | 241 | 3.30.70.660 |
| af_Q2FW37_106_241_3.30.70.660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain | 0.9552 | 107 | 236 | 3.30.70.660 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A091BI02-F1-model_v4 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | 0.994 | 1 | 255 |
GO:0003723
GO:0031119 GO:0160147 |
| AF-A0A432ERJ4-F1-model_v4 | tRNA pseudouridine synthase (EC 5.4.99.12) | 0.994 | 1 | 190 |
GO:0003723
GO:0031119 GO:0160147 |
| AF-A0A1G3ZU20-F1-model_v4 | deleted | 0.9939 | 1 | 255 |
|
| AF-A0A098GI34-F1-model_v4 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | 0.9932 | 1 | 250 |
GO:0003723
GO:0031119 GO:0160147 |
| AF-A0A1N6VTK7-F1-model_v4 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | 0.9924 | 2 | 255 |
GO:0003723
GO:0031119 GO:0160147 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar