F471860
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 642 | 309 | 616 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10001996|Ga0163161_100019964 |
| Length | 280 |
| Sequence | MFKPVQELPGEDQTMLAPAERTRDCIDTTARFQEADAVRLNRMFRGTETIEMLETLLREQMAGDVAIVSSFGAESAVLLHLVSRIDPNVPVLFLDTGKHFPETLAYRDEVIARLGLTDVRNLAPEPEEVAKRDENGLRWSFDPDGCCEIRKVKPLAKALAGFDATITGRKAFQAKTRSSLPRFEIDSTDKQGRLKINPLIDWTAEDIAAYIAEHDLPAHPLVAEGYPSIGCSPCTSKVAPGEDPRSGRWKGWDKVECGIHVGGQSDVVPVELPPGYEPAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 4 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 5 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 6 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 7 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 8 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 9 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 10 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 11 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 12 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 13 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 14 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 15 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 16 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 17 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 18 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 19 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 20 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 21 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 22 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 23 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 24 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 25 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 26 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 174 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 175 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 179 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 180 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 266 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 269 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 271 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 272 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 275 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 276 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 278 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 279 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 280 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 281 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 282 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 283 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 284 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 285 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 286 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 287 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 288 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 290 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 291 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 295 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 297 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 301 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 302 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 307 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.79 |
| Metatranscriptomes | 0.16 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.83 |
| Nodule | 0.47 |
| Rhizoplane | 3.43 |
| Rhizosphere | 64.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1017218 | 3300003771 | Bacteria | 2776 |
| 2 | Ga0055537_1001890 | 3300003773 | Bacteria | 7519 |
| 3 | Ga0055524_1020919 | 3300003775 | Bacteria | 2187 |
| 4 | Ga0055524_1025148 | 3300003775 | Bacteria | 1871 |
| 5 | Ga0055536_1002622 | 3300003781 | Bacteria | 10014 |
| 6 | Ga0055536_1004003 | 3300003781 | Bacteria | 7698 |
| 7 | Ga0055528_1014364 | 3300003790 | Bacteria | 2932 |
| 8 | Ga0055530_10000076 | 3300003791 | Bacteria | 84675 |
| 9 | Ga0055530_10000188 | 3300003791 | Bacteria | 55307 |
| 10 | Ga0055530_10001171 | 3300003791 | Bacteria | 20279 |
| 11 | Ga0055530_10003041 | 3300003791 | Bacteria | 10011 |
| 12 | Ga0055530_10004969 | 3300003791 | Bacteria | 6577 |
| 13 | Ga0055531_10000161 | 3300003794 | Bacteria | 76455 |
| 14 | Ga0055531_10001970 | 3300003794 | Bacteria | 14316 |
| 15 | Ga0055531_10005752 | 3300003794 | Bacteria | 7183 |
| 16 | Ga0055531_10006606 | 3300003794 | Bacteria | 6539 |
| 17 | Ga0055543_1010540 | 3300004625 | Bacteria | 1932 |
| 18 | Ga0065165_1000029 | 3300005262 | Bacteria | 220342 |
| 19 | Ga0065165_1031169 | 3300005262 | Bacteria | 1689 |
| 20 | Ga0065704_10075690 | 3300005289 | Bacteria | 5465 |
| 21 | Ga0070658_10135198 | 3300005327 | Bacteria | 2056 |
| 22 | Ga0070683_100473442 | 3300005329 | Bacteria | 1196 |
| 23 | Ga0070670_100000050 | 3300005331 | Bacteria | 132470 |
| 24 | Ga0070670_100009012 | 3300005331 | Bacteria | 8524 |
| 25 | Ga0070670_100117301 | 3300005331 | Bacteria | 2295 |
| 26 | Ga0070670_100312032 | 3300005331 | Bacteria | 1377 |
| 27 | Ga0070666_10047259 | 3300005335 | Bacteria | 2889 |
| 28 | Ga0070666_10201248 | 3300005335 | Bacteria | 1401 |
| 29 | Ga0070680_100026527 | 3300005336 | Bacteria | 4634 |
| 30 | Ga0070680_100131236 | 3300005336 | Bacteria | 2096 |
| 31 | Ga0070660_100021475 | 3300005339 | Bacteria | 4762 |
| 32 | Ga0070660_100126465 | 3300005339 | Bacteria | 2042 |
| 33 | Ga0070691_10024488 | 3300005341 | Bacteria | 2805 |
| 34 | Ga0070668_100001178 | 3300005347 | Bacteria | 18504 |
| 35 | Ga0070668_100002233 | 3300005347 | Bacteria | 14239 |
| 36 | Ga0070668_100010330 | 3300005347 | Bacteria | 6930 |
| 37 | Ga0070668_100022775 | 3300005347 | Bacteria | 4736 |
| 38 | Ga0070668_100206646 | 3300005347 | Bacteria | 1613 |
| 39 | Ga0070669_100000840 | 3300005353 | Bacteria | 22295 |
| 40 | Ga0070671_100000153 | 3300005355 | Bacteria | 45037 |
| 41 | Ga0070671_100072784 | 3300005355 | Bacteria | 2870 |
| 42 | Ga0070671_100164519 | 3300005355 | Bacteria | 1876 |
| 43 | Ga0070671_100168754 | 3300005355 | Bacteria | 1850 |
| 44 | Ga0070671_100245732 | 3300005355 | Bacteria | 1519 |
| 45 | Ga0070673_100449055 | 3300005364 | Bacteria | 1160 |
| 46 | Ga0070659_100000040 | 3300005366 | Bacteria | 104145 |
| 47 | Ga0070659_100023337 | 3300005366 | Bacteria | 4733 |
| 48 | Ga0070667_100000299 | 3300005367 | Bacteria | 55531 |
| 49 | Ga0070667_100004014 | 3300005367 | Bacteria | 12458 |
| 50 | Ga0070667_100006029 | 3300005367 | Bacteria | 10072 |
| 51 | Ga0070667_100010698 | 3300005367 | Bacteria | 7582 |
| 52 | Ga0070667_100019418 | 3300005367 | Bacteria | 5639 |
| 53 | Ga0070667_100106034 | 3300005367 | Bacteria | 2432 |
| 54 | Ga0070662_100223071 | 3300005457 | Bacteria | 1505 |
| 55 | Ga0070681_10351475 | 3300005458 | Bacteria | 1384 |
| 56 | Ga0070679_100107588 | 3300005530 | Bacteria | 2774 |
| 57 | Ga0068853_100124440 | 3300005539 | Bacteria | 2303 |
| 58 | Ga0068853_100270725 | 3300005539 | Bacteria | 1564 |
| 59 | Ga0068853_100376213 | 3300005539 | Bacteria | 1326 |
| 60 | Ga0070665_100000248 | 3300005548 | Bacteria | 89239 |
| 61 | Ga0070665_100000867 | 3300005548 | Bacteria | 39214 |
| 62 | Ga0070665_100001223 | 3300005548 | Bacteria | 31260 |
| 63 | Ga0070665_100001434 | 3300005548 | Bacteria | 27937 |
| 64 | Ga0070665_100338150 | 3300005548 | Bacteria | 1510 |
| 65 | Ga0068855_100010807 | 3300005563 | Bacteria | 11021 |
| 66 | Ga0068855_100098172 | 3300005563 | Bacteria | 3374 |
| 67 | Ga0068855_100396913 | 3300005563 | Bacteria | 1512 |
| 68 | Ga0068855_100523808 | 3300005563 | Bacteria | 1286 |
| 69 | Ga0070664_100245591 | 3300005564 | Bacteria | 1608 |
| 70 | Ga0068854_100010741 | 3300005578 | Bacteria | 5941 |
| 71 | Ga0068856_100070294 | 3300005614 | Bacteria | 3463 |
| 72 | Ga0068856_100199046 | 3300005614 | Bacteria | 2018 |
| 73 | Ga0068856_100365449 | 3300005614 | Bacteria | 1462 |
| 74 | Ga0068859_100000744 | 3300005617 | Bacteria | 32833 |
| 75 | Ga0068859_100011775 | 3300005617 | Bacteria | 8788 |
| 76 | Ga0068859_100077982 | 3300005617 | Bacteria | 3354 |
| 77 | Ga0068859_100149996 | 3300005617 | Bacteria | 2407 |
| 78 | Ga0068859_100749565 | 3300005617 | Bacteria | 1065 |
| 79 | Ga0068864_100000238 | 3300005618 | Bacteria | 49284 |
| 80 | Ga0068864_100001411 | 3300005618 | Bacteria | 19860 |
| 81 | Ga0068864_100001967 | 3300005618 | Bacteria | 16895 |
| 82 | Ga0068864_100100302 | 3300005618 | Bacteria | 2566 |
| 83 | Ga0068861_100381852 | 3300005719 | Bacteria | 1245 |
| 84 | Ga0068863_100000688 | 3300005841 | Bacteria | 34001 |
| 85 | Ga0068863_100002323 | 3300005841 | Bacteria | 18907 |
| 86 | Ga0068863_100003091 | 3300005841 | Bacteria | 16449 |
| 87 | Ga0068863_100004317 | 3300005841 | Bacteria | 14009 |
| 88 | Ga0068863_100006056 | 3300005841 | Bacteria | 11870 |
| 89 | Ga0068858_100000129 | 3300005842 | Bacteria | 79265 |
| 90 | Ga0068858_100001538 | 3300005842 | Bacteria | 23685 |
| 91 | Ga0068858_100119048 | 3300005842 | Bacteria | 2469 |
| 92 | Ga0068858_100323098 | 3300005842 | Bacteria | 1475 |
| 93 | Ga0068860_100000108 | 3300005843 | Bacteria | 132230 |
| 94 | Ga0068860_100000517 | 3300005843 | Bacteria | 47364 |
| 95 | Ga0068860_100003590 | 3300005843 | Bacteria | 15950 |
| 96 | Ga0068860_100153815 | 3300005843 | Bacteria | 2216 |
| 97 | Ga0068860_100161217 | 3300005843 | Bacteria | 2162 |
| 98 | Ga0068862_100000786 | 3300005844 | Bacteria | 31460 |
| 99 | Ga0068862_100002133 | 3300005844 | Bacteria | 17807 |
| 100 | Ga0068862_100009671 | 3300005844 | Bacteria | 7969 |
| 101 | Ga0068862_100010294 | 3300005844 | Bacteria | 7717 |
| 102 | Ga0068862_100011439 | 3300005844 | Bacteria | 7324 |
| 103 | Ga0068862_100097097 | 3300005844 | Bacteria | 2572 |
| 104 | Ga0068862_100239704 | 3300005844 | Bacteria | 1648 |
| 105 | Ga0068862_100290192 | 3300005844 | Bacteria | 1502 |
| 106 | Ga0075368_10002174 | 3300006042 | Bacteria | 6343 |
| 107 | Ga0075363_100011199 | 3300006048 | Bacteria | 4288 |
| 108 | Ga0075363_100102825 | 3300006048 | Bacteria | 1582 |
| 109 | Ga0075364_10000457 | 3300006051 | Bacteria | 20666 |
| 110 | Ga0075364_10196616 | 3300006051 | Bacteria | 1366 |
| 111 | Ga0075362_10019261 | 3300006177 | Bacteria | 2835 |
| 112 | Ga0075367_10001510 | 3300006178 | Bacteria | 10055 |
| 113 | Ga0075367_10087211 | 3300006178 | Bacteria | 1895 |
| 114 | Ga0075369_10001685 | 3300006186 | Bacteria | 7632 |
| 115 | Ga0075369_10043660 | 3300006186 | Bacteria | 1924 |
| 116 | Ga0075369_10060100 | 3300006186 | Bacteria | 1657 |
| 117 | Ga0075369_10091205 | 3300006186 | Bacteria | 1360 |
| 118 | Ga0075366_10017086 | 3300006195 | Bacteria | 4171 |
| 119 | Ga0075366_10051741 | 3300006195 | Bacteria | 2440 |
| 120 | Ga0075366_10174596 | 3300006195 | Bacteria | 1304 |
| 121 | Ga0097621_100219863 | 3300006237 | Bacteria | 1655 |
| 122 | Ga0075370_10003860 | 3300006353 | Bacteria | 7179 |
| 123 | Ga0075370_10050797 | 3300006353 | Bacteria | 2352 |
| 124 | Ga0075370_10086786 | 3300006353 | Bacteria | 1802 |
| 125 | Ga0075370_10104602 | 3300006353 | Bacteria | 1641 |
| 126 | Ga0075370_10305532 | 3300006353 | Bacteria | 946 |
| 127 | Ga0068865_100013238 | 3300006881 | Bacteria | 5209 |
| 128 | Ga0097620_100000744 | 3300006931 | Bacteria | 32833 |
| 129 | Ga0097620_100077982 | 3300006931 | Bacteria | 3354 |
| 130 | Ga0097620_100150003 | 3300006931 | Bacteria | 2407 |
| 131 | Ga0097620_100749558 | 3300006931 | Bacteria | 1065 |
| 132 | Ga0079104_1018642 | 3300006946 | Bacteria | 1962 |
| 133 | Ga0079104_1032186 | 3300006946 | Bacteria | 1295 |
| 134 | Ga0105251_10001541 | 3300009011 | Bacteria | 19789 |
| 135 | Ga0105250_10097249 | 3300009092 | Bacteria | 1200 |
| 136 | Ga0105240_10000522 | 3300009093 | Bacteria | 70833 |
| 137 | Ga0105240_10024604 | 3300009093 | Bacteria | 7931 |
| 138 | Ga0105240_10034503 | 3300009093 | Bacteria | 6525 |
| 139 | Ga0105240_10077997 | 3300009093 | Bacteria | 4080 |
| 140 | Ga0105240_10135159 | 3300009093 | Bacteria | 2953 |
| 141 | Ga0105240_10319924 | 3300009093 | Bacteria | 1769 |
| 142 | Ga0105240_10442461 | 3300009093 | Bacteria | 1456 |
| 143 | Ga0105240_10576444 | 3300009093 | Bacteria | 1242 |
| 144 | Ga0105240_10599993 | 3300009093 | Bacteria | 1212 |
| 145 | Ga0105247_10032924 | 3300009101 | Bacteria | 3150 |
| 146 | Ga0105241_10170532 | 3300009174 | Bacteria | 1797 |
| 147 | Ga0105248_10002783 | 3300009177 | Bacteria | 19441 |
| 148 | Ga0105248_10008987 | 3300009177 | Bacteria | 10985 |
| 149 | Ga0105248_10056366 | 3300009177 | Bacteria | 4409 |
| 150 | Ga0105248_10134183 | 3300009177 | Bacteria | 2793 |
| 151 | Ga0105248_10138720 | 3300009177 | Bacteria | 2743 |
| 152 | Ga0105248_10687095 | 3300009177 | Bacteria | 1155 |
| 153 | Ga0105237_10108394 | 3300009545 | Bacteria | 2769 |
| 154 | Ga0105238_10005659 | 3300009551 | Bacteria | 12351 |
| 155 | Ga0105238_10013681 | 3300009551 | Bacteria | 8195 |
| 156 | Ga0105238_10042636 | 3300009551 | Bacteria | 4593 |
| 157 | Ga0105249_10000356 | 3300009553 | Bacteria | 45856 |
| 158 | Ga0105249_10008807 | 3300009553 | Bacteria | 8809 |
| 159 | Ga0105249_10877985 | 3300009553 | Bacteria | 963 |
| 160 | Ga0105249_11017067 | 3300009553 | Bacteria | 898 |
| 161 | Ga0105239_10092191 | 3300010375 | Bacteria | 3344 |
| 162 | Ga0105239_10127187 | 3300010375 | Bacteria | 2833 |
| 163 | Ga0105239_11252061 | 3300010375 | Bacteria | 855 |
| 164 | Ga0157371_10039533 | 3300013102 | Bacteria | 3373 |
| 165 | Ga0157369_10338253 | 3300013105 | Bacteria | 1564 |
| 166 | Ga0157369_10493488 | 3300013105 | Bacteria | 1267 |
| 167 | Ga0163162_10012291 | 3300013306 | Bacteria | 8358 |
| 168 | Ga0163162_10120960 | 3300013306 | Bacteria | 2723 |
| 169 | Ga0163162_10251112 | 3300013306 | Bacteria | 1901 |
| 170 | Ga0163162_10387584 | 3300013306 | Bacteria | 1530 |
| 171 | Ga0157372_10152059 | 3300013307 | Bacteria | 2672 |
| 172 | Ga0157372_10193139 | 3300013307 | Bacteria | 2358 |
| 173 | Ga0163163_10001756 | 3300014325 | Bacteria | 18264 |
| 174 | Ga0163163_10044363 | 3300014325 | Bacteria | 4362 |
| 175 | Ga0163163_10074998 | 3300014325 | Bacteria | 3376 |
| 176 | Ga0163163_10150187 | 3300014325 | Bacteria | 2374 |
| 177 | Ga0163163_10764405 | 3300014325 | Bacteria | 1030 |
| 178 | Ga0157380_10738414 | 3300014326 | Bacteria | 994 |
| 179 | Ga0157379_10001581 | 3300014968 | Bacteria | 18756 |
| 180 | Ga0157379_10006140 | 3300014968 | Bacteria | 10344 |
| 181 | Ga0157379_10037449 | 3300014968 | Bacteria | 4325 |
| 182 | Ga0157379_10268704 | 3300014968 | Bacteria | 1550 |
| 183 | Ga0163161_10001996 | 3300017792 | Bacteria | 14773 |
| 184 | Ga0213876_10075259 | 3300021384 | Bacteria | 1783 |
| 185 | Ga0213876_10108027 | 3300021384 | Bacteria | 1476 |
| 186 | Ga0209026_1005037 | 3300025250 | Bacteria | 3690 |
| 187 | Ga0209565_1000466 | 3300025263 | Bacteria | 30502 |
| 188 | Ga0209673_1000722 | 3300025273 | Bacteria | 45860 |
| 189 | Ga0209675_1010065 | 3300025291 | Bacteria | 3268 |
| 190 | Ga0209676_1000067 | 3300025292 | Bacteria | 315576 |
| 191 | Ga0209676_1000379 | 3300025292 | Bacteria | 81751 |
| 192 | Ga0209564_1010672 | 3300025295 | Bacteria | 4201 |
| 193 | Ga0209758_1002875 | 3300025297 | Bacteria | 16680 |
| 194 | Ga0209758_1003007 | 3300025297 | Bacteria | 16137 |
| 195 | Ga0209758_1005171 | 3300025297 | Bacteria | 10264 |
| 196 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 197 | Ga0209050_1000031 | 3300025298 | Bacteria | 458181 |
| 198 | Ga0209050_1000154 | 3300025298 | Bacteria | 159160 |
| 199 | Ga0209050_1000449 | 3300025298 | Bacteria | 74643 |
| 200 | Ga0209050_1015693 | 3300025298 | Bacteria | 3159 |
| 201 | Ga0209256_1001877 | 3300025299 | Bacteria | 19375 |
| 202 | Ga0209256_1009314 | 3300025299 | Bacteria | 4328 |
| 203 | Ga0209256_1010502 | 3300025299 | Bacteria | 3863 |
| 204 | Ga0209051_1001178 | 3300025303 | Bacteria | 23705 |
| 205 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 206 | Ga0209257_1000066 | 3300025304 | Bacteria | 344166 |
| 207 | Ga0209257_1000073 | 3300025304 | Bacteria | 325833 |
| 208 | Ga0209257_1000203 | 3300025304 | Bacteria | 146148 |
| 209 | Ga0209257_1000966 | 3300025304 | Bacteria | 39401 |
| 210 | Ga0209257_1010055 | 3300025304 | Bacteria | 4895 |
| 211 | Ga0207697_10116685 | 3300025315 | Bacteria | 1147 |
| 212 | Ga0207713_1000412 | 3300025735 | Bacteria | 45595 |
| 213 | Ga0207710_10091707 | 3300025900 | Bacteria | 1422 |
| 214 | Ga0207680_10203005 | 3300025903 | Bacteria | 1352 |
| 215 | Ga0207680_10231325 | 3300025903 | Bacteria | 1271 |
| 216 | Ga0207680_10338873 | 3300025903 | Bacteria | 1054 |
| 217 | Ga0207705_10013624 | 3300025909 | Bacteria | 5866 |
| 218 | Ga0207705_10082788 | 3300025909 | Bacteria | 2341 |
| 219 | Ga0207705_10275280 | 3300025909 | Bacteria | 1288 |
| 220 | Ga0207707_10122678 | 3300025912 | Bacteria | 2272 |
| 221 | Ga0207707_10455592 | 3300025912 | Bacteria | 1094 |
| 222 | Ga0207695_10000987 | 3300025913 | Bacteria | 50463 |
| 223 | Ga0207695_10001134 | 3300025913 | Bacteria | 46205 |
| 224 | Ga0207695_10043719 | 3300025913 | Bacteria | 4772 |
| 225 | Ga0207695_10044496 | 3300025913 | Bacteria | 4721 |
| 226 | Ga0207695_10113133 | 3300025913 | Bacteria | 2691 |
| 227 | Ga0207695_10184169 | 3300025913 | Bacteria | 2008 |
| 228 | Ga0207671_10215829 | 3300025914 | Bacteria | 1502 |
| 229 | Ga0207660_10004369 | 3300025917 | Bacteria | 9219 |
| 230 | Ga0207660_10077458 | 3300025917 | Bacteria | 2434 |
| 231 | Ga0207657_10005615 | 3300025919 | Bacteria | 13091 |
| 232 | Ga0207657_10494347 | 3300025919 | Bacteria | 959 |
| 233 | Ga0207652_10222722 | 3300025921 | Bacteria | 1700 |
| 234 | Ga0207681_10000499 | 3300025923 | Bacteria | 27301 |
| 235 | Ga0207681_10049084 | 3300025923 | Bacteria | 2851 |
| 236 | Ga0207694_10027260 | 3300025924 | Bacteria | 4350 |
| 237 | Ga0207694_10099616 | 3300025924 | Bacteria | 2302 |
| 238 | Ga0207694_10258044 | 3300025924 | Bacteria | 1427 |
| 239 | Ga0207694_10393472 | 3300025924 | Bacteria | 1152 |
| 240 | Ga0207650_10000133 | 3300025925 | Bacteria | 90953 |
| 241 | Ga0207650_10063546 | 3300025925 | Bacteria | 2760 |
| 242 | Ga0207650_10261930 | 3300025925 | Bacteria | 1403 |
| 243 | Ga0207650_10309498 | 3300025925 | Bacteria | 1292 |
| 244 | Ga0207687_10734869 | 3300025927 | Bacteria | 839 |
| 245 | Ga0207644_10005355 | 3300025931 | Bacteria | 8370 |
| 246 | Ga0207644_10122237 | 3300025931 | Bacteria | 1983 |
| 247 | Ga0207690_10000134 | 3300025932 | Bacteria | 60374 |
| 248 | Ga0207690_10098748 | 3300025932 | Bacteria | 2080 |
| 249 | Ga0207706_10031012 | 3300025933 | Bacteria | 4764 |
| 250 | Ga0207706_10589070 | 3300025933 | Bacteria | 956 |
| 251 | Ga0207670_10420518 | 3300025936 | Bacteria | 1072 |
| 252 | Ga0207704_10001576 | 3300025938 | Bacteria | 10235 |
| 253 | Ga0207711_10000625 | 3300025941 | Bacteria | 35512 |
| 254 | Ga0207711_10003070 | 3300025941 | Bacteria | 14583 |
| 255 | Ga0207711_10004518 | 3300025941 | Bacteria | 11850 |
| 256 | Ga0207711_10010448 | 3300025941 | Bacteria | 7707 |
| 257 | Ga0207711_10023337 | 3300025941 | Bacteria | 5178 |
| 258 | Ga0207711_10068717 | 3300025941 | Bacteria | 3069 |
| 259 | Ga0207711_10097346 | 3300025941 | Bacteria | 2598 |
| 260 | Ga0207711_10178550 | 3300025941 | Bacteria | 1929 |
| 261 | Ga0207661_10655415 | 3300025944 | Bacteria | 965 |
| 262 | Ga0207679_10285997 | 3300025945 | Bacteria | 1416 |
| 263 | Ga0207667_10006755 | 3300025949 | Bacteria | 13849 |
| 264 | Ga0207667_10041133 | 3300025949 | Bacteria | 4917 |
| 265 | Ga0207667_10490065 | 3300025949 | Bacteria | 1247 |
| 266 | Ga0207651_10218156 | 3300025960 | Bacteria | 1540 |
| 267 | Ga0207712_10000790 | 3300025961 | Bacteria | 23489 |
| 268 | Ga0207712_10107914 | 3300025961 | Bacteria | 2082 |
| 269 | Ga0207668_10000016 | 3300025972 | Bacteria | 159703 |
| 270 | Ga0207668_10000662 | 3300025972 | Bacteria | 21158 |
| 271 | Ga0207668_10007795 | 3300025972 | Bacteria | 6370 |
| 272 | Ga0207668_10015854 | 3300025972 | Bacteria | 4692 |
| 273 | Ga0207668_10027975 | 3300025972 | Bacteria | 3680 |
| 274 | Ga0207668_10030241 | 3300025972 | Bacteria | 3557 |
| 275 | Ga0207658_10000931 | 3300025986 | Bacteria | 24185 |
| 276 | Ga0207658_10004668 | 3300025986 | Bacteria | 9495 |
| 277 | Ga0207658_10013584 | 3300025986 | Bacteria | 5569 |
| 278 | Ga0207658_10015286 | 3300025986 | Bacteria | 5266 |
| 279 | Ga0207658_10125531 | 3300025986 | Bacteria | 2053 |
| 280 | Ga0207677_10135899 | 3300026023 | Bacteria | 1874 |
| 281 | Ga0207703_10000086 | 3300026035 | Bacteria | 107307 |
| 282 | Ga0207703_10003556 | 3300026035 | Bacteria | 13024 |
| 283 | Ga0207703_10010955 | 3300026035 | Bacteria | 7066 |
| 284 | Ga0207703_10547172 | 3300026035 | Bacteria | 1091 |
| 285 | Ga0207639_10022556 | 3300026041 | Bacteria | 4535 |
| 286 | Ga0207639_10110891 | 3300026041 | Bacteria | 2236 |
| 287 | Ga0207702_10105004 | 3300026078 | Bacteria | 2501 |
| 288 | Ga0207702_10178850 | 3300026078 | Bacteria | 1952 |
| 289 | Ga0207641_10000204 | 3300026088 | Bacteria | 79460 |
| 290 | Ga0207641_10002389 | 3300026088 | Bacteria | 17326 |
| 291 | Ga0207641_10003109 | 3300026088 | Bacteria | 14930 |
| 292 | Ga0207641_10005335 | 3300026088 | Bacteria | 10980 |
| 293 | Ga0207641_10022336 | 3300026088 | Bacteria | 5207 |
| 294 | Ga0207641_10291200 | 3300026088 | Bacteria | 1539 |
| 295 | Ga0207641_10416318 | 3300026088 | Bacteria | 1293 |
| 296 | Ga0207641_10775560 | 3300026088 | Bacteria | 947 |
| 297 | Ga0207676_10000109 | 3300026095 | Bacteria | 74080 |
| 298 | Ga0207676_10001695 | 3300026095 | Bacteria | 16256 |
| 299 | Ga0207676_10001962 | 3300026095 | Bacteria | 14986 |
| 300 | Ga0207676_10726154 | 3300026095 | Bacteria | 964 |
| 301 | Ga0207675_100029840 | 3300026118 | Bacteria | 5078 |
| 302 | Ga0207675_100220553 | 3300026118 | Bacteria | 1827 |
| 303 | Ga0207698_10122133 | 3300026142 | Bacteria | 2207 |
| 304 | Ga0207698_10284379 | 3300026142 | Bacteria | 1531 |
| 305 | Ga0209281_1010105 | 3300027111 | Bacteria | 2178 |
| 306 | Ga0209981_1002428 | 3300027378 | Bacteria | 2374 |
| 307 | Ga0209999_1000319 | 3300027543 | Bacteria | 7192 |
| 308 | Ga0209983_1001813 | 3300027665 | Bacteria | 4744 |
| 309 | Ga0209813_10002858 | 3300027866 | Bacteria | 3997 |
| 310 | Ga0209813_10004549 | 3300027866 | Bacteria | 3319 |
| 311 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 312 | Ga0268266_10001277 | 3300028379 | Bacteria | 30750 |
| 313 | Ga0268266_10013343 | 3300028379 | Bacteria | 7079 |
| 314 | Ga0268266_10013577 | 3300028379 | Bacteria | 7015 |
| 315 | Ga0268265_10001942 | 3300028380 | Bacteria | 16408 |
| 316 | Ga0268265_10002377 | 3300028380 | Bacteria | 14227 |
| 317 | Ga0268265_10004078 | 3300028380 | Bacteria | 10263 |
| 318 | Ga0268265_10004204 | 3300028380 | Bacteria | 10072 |
| 319 | Ga0268265_10013434 | 3300028380 | Bacteria | 5563 |
| 320 | Ga0268265_10069488 | 3300028380 | Bacteria | 2735 |
| 321 | Ga0268265_10125789 | 3300028380 | Bacteria | 2121 |
| 322 | Ga0268265_10495257 | 3300028380 | Bacteria | 1150 |
| 323 | Ga0268264_10000126 | 3300028381 | Bacteria | 186138 |
| 324 | Ga0268264_10000364 | 3300028381 | Bacteria | 67218 |
| 325 | Ga0268264_10000416 | 3300028381 | Bacteria | 60203 |
| 326 | Ga0268264_10071206 | 3300028381 | Bacteria | 2945 |
| 327 | Ga0268264_10273395 | 3300028381 | Bacteria | 1579 |
| 328 | Ga0268264_10587756 | 3300028381 | Bacteria | 1096 |
| 329 | Ga0307517_10017137 | 3300028786 | Bacteria | 9463 |
| 330 | Ga0307515_10026487 | 3300028794 | Bacteria | 9977 |
| 331 | Ga0307515_10139358 | 3300028794 | Bacteria | 2612 |
| 332 | Ga0265338_10012856 | 3300028800 | Bacteria | 9513 |
| 333 | Ga0307511_10126914 | 3300030521 | Bacteria | 1552 |
| 334 | Ga0265760_10019481 | 3300031090 | Bacteria | 1955 |
| 335 | Ga0265340_10030466 | 3300031247 | Bacteria | 2703 |
| 336 | Ga0307513_10007192 | 3300031456 | Bacteria | 14457 |
| 337 | Ga0307513_10007802 | 3300031456 | Bacteria | 13803 |
| 338 | Ga0307513_10010089 | 3300031456 | Bacteria | 11892 |
| 339 | Ga0307513_10041492 | 3300031456 | Bacteria | 5078 |
| 340 | Ga0307508_10144165 | 3300031616 | Bacteria | 1986 |
| 341 | Ga0307414_10076931 | 3300032004 | Bacteria | 2427 |
| 342 | Ga0307411_10368543 | 3300032005 | Bacteria | 1177 |
| 343 | Ga0307510_10017593 | 3300033180 | Bacteria | 8428 |
| 344 | Ga0307510_10131873 | 3300033180 | Bacteria | 2169 |
| 345 | Ga0307510_10143225 | 3300033180 | Bacteria | 2029 |
| 346 | Ga0373944_0015705 | 3300035089 | Bacteria | 2128 |
| 347 | Ga0373927_0000130 | 3300035695 | Bacteria | 57890 |
| 348 | Ga0373947_0072289 | 3300035725 | Bacteria | 2118 |
| 349 | Ga0373925_0000022 | 3300037068 | Bacteria | 160046 |
| 350 | Ga0373925_0351289 | 3300037068 | Bacteria | 1197 |
| 351 | Ga0395899_0000984 | 3300037312 | Bacteria | 26243 |
| 352 | Ga0395899_0029052 | 3300037312 | Bacteria | 4159 |
| 353 | Ga0395899_0143603 | 3300037312 | Bacteria | 1696 |
| 354 | Ga0395900_0000010 | 3300037418 | Bacteria | 461364 |
| 355 | Ga0395900_0044298 | 3300037418 | Bacteria | 4585 |
| 356 | Ga0395898_0004653 | 3300037466 | Bacteria | 14958 |
| 357 | Ga0395905_0001301 | 3300037471 | Bacteria | 30685 |
| 358 | Ga0395905_0039254 | 3300037471 | Bacteria | 4441 |
| 359 | Ga0395905_0075530 | 3300037471 | Bacteria | 3159 |
| 360 | Ga0395905_0102109 | 3300037471 | Bacteria | 2692 |
| 361 | Ga0395905_0127790 | 3300037471 | Bacteria | 2390 |
| 362 | Ga0395905_0133687 | 3300037471 | Bacteria | 2333 |
| 363 | Ga0395905_0333141 | 3300037471 | Bacteria | 1408 |
| 364 | Ga0395905_0689689 | 3300037471 | Bacteria | 924 |
| 365 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 366 | Ga0395901_0031434 | 3300038443 | Bacteria | 5475 |
| 367 | Ga0395901_0229573 | 3300038443 | Bacteria | 1938 |
| 368 | Ga0395901_0521868 | 3300038443 | Bacteria | 1206 |
| 369 | Ga0436365_0005985 | 3300039437 | Bacteria | 1465 |
| 370 | Ga0436365_1596297 | 3300039437 | Bacteria | 3685 |
| 371 | Ga0436360_0837528 | 3300039438 | Bacteria | 1605 |
| 372 | Ga0439461_0000282 | 3300041410 | Bacteria | 7317 |
| 373 | Ga0439465_0004149 | 3300041413 | Bacteria | 4715 |
| 374 | Ga0451853_0416643 | 3300041512 | Bacteria | 4269 |
| 375 | Ga0439431_0002774 | 3300041997 | Bacteria | 3856 |
| 376 | Ga0439441_016409 | 3300042001 | Bacteria | 1320 |
| 377 | Ga0439442_009911 | 3300042002 | Bacteria | 1927 |
| 378 | Ga0439445_0004449 | 3300042004 | Bacteria | 3174 |
| 379 | Ga0439432_001007 | 3300042006 | Bacteria | 10647 |
| 380 | Ga0439452_022882 | 3300042010 | Bacteria | 1613 |
| 381 | Ga0439462_0012207 | 3300042015 | Bacteria | 2193 |
| 382 | Ga0439446_0018177 | 3300042156 | Bacteria | 1967 |
| 383 | Ga0439434_0018068 | 3300042435 | Bacteria | 2109 |
| 384 | Ga0439435_0007978 | 3300042436 | Bacteria | 2445 |
| 385 | Ga0466961_0111950 | 3300044693 | Bacteria | 1717 |
| 386 | Ga0453684_0285383 | 3300044712 | Bacteria | 1881 |
| 387 | Ga0495590_0112293 | 3300046457 | Bacteria | 973 |
| 388 | Ga0495638_0000109 | 3300046460 | Bacteria | 131610 |
| 389 | Ga0495638_0001122 | 3300046460 | Bacteria | 25994 |
| 390 | Ga0495638_0001193 | 3300046460 | Bacteria | 24877 |
| 391 | Ga0495638_0005052 | 3300046460 | Bacteria | 9895 |
| 392 | Ga0495638_0031759 | 3300046460 | Bacteria | 3390 |
| 393 | Ga0495638_0045573 | 3300046460 | Bacteria | 2758 |
| 394 | Ga0495638_0131225 | 3300046460 | Bacteria | 1471 |
| 395 | Ga0495650_0000020 | 3300046471 | Bacteria | 533839 |
| 396 | Ga0495650_0048529 | 3300046471 | Bacteria | 1769 |
| 397 | Ga0495585_0034512 | 3300046492 | Bacteria | 2860 |
| 398 | Ga0495596_0000579 | 3300046500 | Bacteria | 22857 |
| 399 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 400 | Ga0495583_0085426 | 3300046506 | Bacteria | 1366 |
| 401 | Ga0495583_0128094 | 3300046506 | Bacteria | 1064 |
| 402 | Ga0495606_0022189 | 3300046507 | Bacteria | 4632 |
| 403 | Ga0495606_0022286 | 3300046507 | Bacteria | 4617 |
| 404 | Ga0495610_0000218 | 3300046512 | Bacteria | 61777 |
| 405 | Ga0495610_0002807 | 3300046512 | Bacteria | 14223 |
| 406 | Ga0495610_0003224 | 3300046512 | Bacteria | 12907 |
| 407 | Ga0495610_0004486 | 3300046512 | Bacteria | 10296 |
| 408 | Ga0495610_0005829 | 3300046512 | Bacteria | 8656 |
| 409 | Ga0495610_0058681 | 3300046512 | Bacteria | 1840 |
| 410 | Ga0495616_0001067 | 3300046513 | Bacteria | 19477 |
| 411 | Ga0495620_0069285 | 3300046515 | Bacteria | 1447 |
| 412 | Ga0495620_0077725 | 3300046515 | Bacteria | 1347 |
| 413 | Ga0495628_0123718 | 3300046516 | Bacteria | 1982 |
| 414 | Ga0495631_0011245 | 3300046518 | Bacteria | 4406 |
| 415 | Ga0495632_0002715 | 3300046519 | Bacteria | 13155 |
| 416 | Ga0495637_0013209 | 3300046520 | Bacteria | 3926 |
| 417 | Ga0495643_0000027 | 3300046522 | Bacteria | 266446 |
| 418 | Ga0495643_0031859 | 3300046522 | Bacteria | 2931 |
| 419 | Ga0495643_0033953 | 3300046522 | Bacteria | 2817 |
| 420 | Ga0495648_0000075 | 3300046524 | Bacteria | 129579 |
| 421 | Ga0495654_0000139 | 3300046530 | Bacteria | 75903 |
| 422 | Ga0495586_0298947 | 3300046535 | Bacteria | 922 |
| 423 | Ga0495609_0001808 | 3300046538 | Bacteria | 13737 |
| 424 | Ga0495609_0050970 | 3300046538 | Bacteria | 1844 |
| 425 | Ga0495597_0001893 | 3300046542 | Bacteria | 14240 |
| 426 | Ga0495597_0079102 | 3300046542 | Bacteria | 1408 |
| 427 | Ga0495622_0002466 | 3300046557 | Bacteria | 8963 |
| 428 | Ga0495633_0064066 | 3300046558 | Bacteria | 1719 |
| 429 | Ga0495668_0000042 | 3300046616 | Bacteria | 229361 |
| 430 | Ga0495668_0015614 | 3300046616 | Bacteria | 4430 |
| 431 | Ga0495668_0031580 | 3300046616 | Bacteria | 2984 |
| 432 | Ga0495668_0038680 | 3300046616 | Bacteria | 2665 |
| 433 | Ga0495668_0051644 | 3300046616 | Bacteria | 2276 |
| 434 | Ga0495668_0066742 | 3300046616 | Bacteria | 1979 |
| 435 | Ga0495668_0074411 | 3300046616 | Bacteria | 1865 |
| 436 | Ga0495668_0079102 | 3300046616 | Bacteria | 1805 |
| 437 | Ga0495668_0135715 | 3300046616 | Bacteria | 1347 |
| 438 | Ga0495611_0002548 | 3300046648 | Bacteria | 8267 |
| 439 | Ga0495611_0172877 | 3300046648 | Bacteria | 1010 |
| 440 | Ga0495625_0000165 | 3300046660 | Bacteria | 102988 |
| 441 | Ga0495625_0002840 | 3300046660 | Bacteria | 18199 |
| 442 | Ga0495625_0018621 | 3300046660 | Bacteria | 5413 |
| 443 | Ga0495625_0020407 | 3300046660 | Bacteria | 5116 |
| 444 | Ga0495625_0020928 | 3300046660 | Bacteria | 5042 |
| 445 | Ga0495625_0088733 | 3300046660 | Bacteria | 2141 |
| 446 | Ga0495669_0000172 | 3300046684 | Bacteria | 40888 |
| 447 | Ga0495669_0019239 | 3300046684 | Bacteria | 2946 |
| 448 | Ga0495669_0129071 | 3300046684 | Bacteria | 1189 |
| 449 | Ga0495669_0263852 | 3300046684 | Bacteria | 828 |
| 450 | Ga0495613_0002308 | 3300046689 | Bacteria | 14452 |
| 451 | Ga0495624_0306614 | 3300046690 | Bacteria | 957 |
| 452 | Ga0495670_0163271 | 3300046691 | Bacteria | 1171 |
| 453 | Ga0495671_0062855 | 3300046692 | Bacteria | 1829 |
| 454 | Ga0495589_0013489 | 3300046794 | Bacteria | 4215 |
| 455 | Ga0495660_0024954 | 3300046810 | Bacteria | 3399 |
| 456 | Ga0495660_0145642 | 3300046810 | Bacteria | 1174 |
| 457 | Ga0495636_0028685 | 3300047318 | Bacteria | 2271 |
| 458 | Ga0495674_0127193 | 3300047319 | Bacteria | 2149 |
| 459 | Ga0495672_0001176 | 3300047320 | Bacteria | 26541 |
| 460 | Ga0495672_0052681 | 3300047320 | Bacteria | 2389 |
| 461 | Ga0495679_011751 | 3300047446 | Bacteria | 3364 |
| 462 | Ga0495673_0000139 | 3300047469 | Bacteria | 130652 |
| 463 | Ga0495673_0000305 | 3300047469 | Bacteria | 65300 |
| 464 | Ga0495673_0001209 | 3300047469 | Bacteria | 21505 |
| 465 | Ga0495681_0086568 | 3300047470 | Bacteria | 1390 |
| 466 | Ga0495686_0000870 | 3300047472 | Bacteria | 38471 |
| 467 | Ga0495686_0004871 | 3300047472 | Bacteria | 10826 |
| 468 | Ga0495686_0006911 | 3300047472 | Bacteria | 8585 |
| 469 | Ga0495686_0016070 | 3300047472 | Bacteria | 5087 |
| 470 | Ga0495686_0033861 | 3300047472 | Bacteria | 3294 |
| 471 | Ga0495686_0181389 | 3300047472 | Bacteria | 1219 |
| 472 | Ga0495593_0061590 | 3300047673 | Bacteria | 1962 |
| 473 | Ga0495615_0000090 | 3300048090 | Bacteria | 26651 |
| 474 | Ga0495626_0001824 | 3300048091 | Bacteria | 16051 |
| 475 | Ga0496102_0069444 | 3300048905 | Bacteria | 3234 |
| 476 | Ga0496102_0082361 | 3300048905 | Bacteria | 2967 |
| 477 | Ga0496102_0202463 | 3300048905 | Bacteria | 1871 |
| 478 | Ga0496103_0029588 | 3300048906 | Bacteria | 3330 |
| 479 | Ga0496103_0041410 | 3300048906 | Bacteria | 2832 |
| 480 | Ga0496104_0054442 | 3300048907 | Bacteria | 3781 |
| 481 | Ga0496105_0000215 | 3300048908 | Bacteria | 38742 |
| 482 | Ga0496106_0069223 | 3300048909 | Bacteria | 2693 |
| 483 | Ga0496106_0168234 | 3300048909 | Bacteria | 1736 |
| 484 | Ga0496107_0000050 | 3300048910 | Bacteria | 63795 |
| 485 | Ga0496108_0076213 | 3300048911 | Bacteria | 2834 |
| 486 | Ga0496109_0010443 | 3300048912 | Bacteria | 7934 |
| 487 | Ga0496110_0154844 | 3300048913 | Bacteria | 2076 |
| 488 | Ga0496112_0032793 | 3300048915 | Bacteria | 5043 |
| 489 | Ga0496112_0257185 | 3300048915 | Bacteria | 1696 |
| 490 | Ga0496112_0257829 | 3300048915 | Bacteria | 1694 |
| 491 | Ga0496113_0078572 | 3300048916 | Bacteria | 2525 |
| 492 | Ga0496114_0320881 | 3300048917 | Bacteria | 1369 |
| 493 | Ga0496115_0001599 | 3300048918 | Bacteria | 16277 |
| 494 | Ga0496115_0001643 | 3300048918 | Bacteria | 16076 |
| 495 | Ga0496115_0018435 | 3300048918 | Bacteria | 5359 |
| 496 | Ga0496115_0143039 | 3300048918 | Bacteria | 1973 |
| 497 | Ga0496116_0140391 | 3300048919 | Bacteria | 1360 |
| 498 | Ga0496117_0011327 | 3300048920 | Bacteria | 7994 |
| 499 | Ga0496117_0047823 | 3300048920 | Bacteria | 3063 |
| 500 | Ga0496118_0128666 | 3300048921 | Bacteria | 1631 |
| 501 | Ga0496119_0020652 | 3300048922 | Bacteria | 4794 |
| 502 | Ga0496119_0149066 | 3300048922 | Bacteria | 1255 |
| 503 | Ga0496120_0116948 | 3300048923 | Bacteria | 1384 |
| 504 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 505 | Ga0496121_0001187 | 3300048924 | Bacteria | 45612 |
| 506 | Ga0496121_0007757 | 3300048924 | Bacteria | 12858 |
| 507 | Ga0496121_0019233 | 3300048924 | Bacteria | 6840 |
| 508 | Ga0496121_0087699 | 3300048924 | Bacteria | 2442 |
| 509 | Ga0496121_0141393 | 3300048924 | Bacteria | 1785 |
| 510 | Ga0496122_0154135 | 3300048925 | Bacteria | 1412 |
| 511 | Ga0496123_0006320 | 3300048926 | Bacteria | 11511 |
| 512 | Ga0496124_0015996 | 3300048927 | Bacteria | 7160 |
| 513 | Ga0496124_0036531 | 3300048927 | Bacteria | 4284 |
| 514 | Ga0496125_0012540 | 3300048928 | Bacteria | 8407 |
| 515 | Ga0496125_0037095 | 3300048928 | Bacteria | 4242 |
| 516 | Ga0496126_0009455 | 3300048929 | Bacteria | 10345 |
| 517 | Ga0495678_001134 | 3300049459 | Bacteria | 22127 |
| 518 | Ga0501032_0033635 | 3300049569 | Bacteria | 3512 |
| 519 | Ga0501033_0029990 | 3300049570 | Bacteria | 4088 |
| 520 | Ga0501037_0158589 | 3300049573 | Bacteria | 1614 |
| 521 | Ga0501037_0197165 | 3300049573 | Bacteria | 1424 |
| 522 | Ga0501047_0071484 | 3300049581 | Bacteria | 3340 |
| 523 | Ga0501047_0101781 | 3300049581 | Bacteria | 2752 |
| 524 | Ga0501047_0225927 | 3300049581 | Bacteria | 1727 |
| 525 | Ga0501257_016058 | 3300049686 | Bacteria | 1733 |
| 526 | Ga0501035_0180472 | 3300049822 | Bacteria | 1819 |
| 527 | Ga0501044_0004038 | 3300049823 | Bacteria | 16462 |
| 528 | Ga0501044_0221897 | 3300049823 | Bacteria | 1841 |
| 529 | nmdc:mga03683_229_c1 | 3300050489 | Bacteria | 17517 |
| 530 | nmdc:mga00v17_801_c1 | 3300050491 | Bacteria | 17106 |
| 531 | nmdc:mga0k408_226329_c1 | 3300050493 | Bacteria | 1117 |
| 532 | nmdc:mga0k408_5702_c1 | 3300050493 | Bacteria | 6623 |
| 533 | nmdc:mga0k408_68244_c1 | 3300050493 | Bacteria | 2074 |
| 534 | nmdc:mga06z11_3771_c1 | 3300050494 | Bacteria | 5895 |
| 535 | nmdc:mga06z11_6554_c1 | 3300050494 | Bacteria | 4748 |
| 536 | nmdc:mga04h51_55743_c1 | 3300050495 | Bacteria | 1340 |
| 537 | nmdc:mga07m45_10034_c1 | 3300050496 | Bacteria | 4930 |
| 538 | nmdc:mga07m45_22038_c1 | 3300050496 | Bacteria | 3476 |
| 539 | nmdc:mga07m45_33_c1 | 3300050496 | Bacteria | 75596 |
| 540 | nmdc:mga07m45_76366_c1 | 3300050496 | Bacteria | 1910 |
| 541 | nmdc:mga07m45_85846_c1 | 3300050496 | Bacteria | 1800 |
| 542 | nmdc:mga0sz30_11763_c1 | 3300050516 | Bacteria | 3388 |
| 543 | nmdc:mga0sz30_161874_c1 | 3300050516 | Bacteria | 991 |
| 544 | nmdc:mga0sz30_3042_c1 | 3300050516 | Bacteria | 6003 |
| 545 | nmdc:mga0sz30_86882_c1 | 3300050516 | Bacteria | 1358 |
| 546 | nmdc:mga0sz30_9117_c1 | 3300050516 | Bacteria | 3764 |
| 547 | Ga0500635_0000082 | 3300053080 | Bacteria | 62117 |
| 548 | Ga0500578_0000023 | 3300053086 | Bacteria | 153470 |
| 549 | Ga0500643_000423 | 3300053087 | Bacteria | 32227 |
| 550 | Ga0500643_007099 | 3300053087 | Bacteria | 4583 |
| 551 | Ga0500643_018127 | 3300053087 | Bacteria | 2343 |
| 552 | Ga0500643_028141 | 3300053087 | Bacteria | 1740 |
| 553 | Ga0500644_0000005 | 3300053088 | Bacteria | 164966 |
| 554 | Ga0500651_0002702 | 3300053093 | Bacteria | 9453 |
| 555 | Ga0500566_0015011 | 3300053094 | Bacteria | 4548 |
| 556 | Ga0500641_0000558 | 3300053096 | Bacteria | 13473 |
| 557 | Ga0500555_001298 | 3300053103 | Bacteria | 7915 |
| 558 | Ga0500556_0001541 | 3300053104 | Bacteria | 9422 |
| 559 | Ga0500556_0015121 | 3300053104 | Bacteria | 2373 |
| 560 | Ga0500556_0126815 | 3300053104 | Bacteria | 999 |
| 561 | Ga0500562_000242 | 3300053108 | Bacteria | 14220 |
| 562 | Ga0500562_000372 | 3300053108 | Bacteria | 10836 |
| 563 | Ga0500562_001156 | 3300053108 | Bacteria | 6499 |
| 564 | Ga0500562_011937 | 3300053108 | Bacteria | 2205 |
| 565 | Ga0500569_000868 | 3300053109 | Bacteria | 5375 |
| 566 | Ga0500572_001158 | 3300053111 | Bacteria | 7619 |
| 567 | Ga0500593_102690 | 3300053117 | Bacteria | 1190 |
| 568 | Ga0500594_0000078 | 3300053118 | Bacteria | 30653 |
| 569 | Ga0500595_002406 | 3300053119 | Bacteria | 9340 |
| 570 | Ga0500607_000098 | 3300053121 | Bacteria | 65919 |
| 571 | Ga0500608_000013 | 3300053122 | Bacteria | 86291 |
| 572 | Ga0500608_000054 | 3300053122 | Bacteria | 51067 |
| 573 | Ga0500614_001498 | 3300053123 | Bacteria | 5563 |
| 574 | Ga0500614_055042 | 3300053123 | Bacteria | 1055 |
| 575 | Ga0500618_000195 | 3300053125 | Bacteria | 49434 |
| 576 | Ga0500618_000803 | 3300053125 | Bacteria | 17291 |
| 577 | Ga0500642_0071546 | 3300053130 | Bacteria | 1579 |
| 578 | Ga0500652_101490 | 3300053131 | Bacteria | 1203 |
| 579 | Ga0500658_0002785 | 3300053134 | Bacteria | 6708 |
| 580 | Ga0500559_0000002 | 3300053136 | Bacteria | 262002 |
| 581 | Ga0500559_0000024 | 3300053136 | Bacteria | 126300 |
| 582 | Ga0500559_0006094 | 3300053136 | Bacteria | 5463 |
| 583 | Ga0500559_0010593 | 3300053136 | Bacteria | 3953 |
| 584 | Ga0500559_0013755 | 3300053136 | Bacteria | 3423 |
| 585 | Ga0500559_0088361 | 3300053136 | Bacteria | 1416 |
| 586 | Ga0500564_000100 | 3300053138 | Bacteria | 22073 |
| 587 | Ga0500564_186289 | 3300053138 | Bacteria | 862 |
| 588 | Ga0500573_0097357 | 3300053140 | Bacteria | 1658 |
| 589 | Ga0500577_0001328 | 3300053142 | Bacteria | 6333 |
| 590 | Ga0500590_004891 | 3300053148 | Bacteria | 6395 |
| 591 | Ga0500590_107421 | 3300053148 | Bacteria | 1330 |
| 592 | Ga0500604_0064831 | 3300053151 | Bacteria | 1155 |
| 593 | Ga0500616_0012850 | 3300053153 | Bacteria | 4883 |
| 594 | Ga0500616_0029837 | 3300053153 | Bacteria | 2998 |
| 595 | Ga0500619_021926 | 3300053154 | Bacteria | 1847 |
| 596 | Ga0500622_0001014 | 3300053156 | Bacteria | 23572 |
| 597 | Ga0500622_0002724 | 3300053156 | Bacteria | 12478 |
| 598 | Ga0500622_0003809 | 3300053156 | Bacteria | 9825 |
| 599 | Ga0500622_0007061 | 3300053156 | Bacteria | 6421 |
| 600 | Ga0500622_0007316 | 3300053156 | Bacteria | 6286 |
| 601 | Ga0500622_0007734 | 3300053156 | Bacteria | 6067 |
| 602 | Ga0500622_0106528 | 3300053156 | Bacteria | 1374 |
| 603 | Ga0500624_024419 | 3300053157 | Bacteria | 998 |
| 604 | Ga0500627_0005963 | 3300053158 | Bacteria | 4097 |
| 605 | Ga0500638_088017 | 3300053162 | Bacteria | 1466 |
| 606 | Ga0500639_123533 | 3300053163 | Bacteria | 1239 |
| 607 | Ga0500636_0024519 | 3300053177 | Bacteria | 3568 |
| 608 | Ga0500636_0036828 | 3300053177 | Bacteria | 2895 |
| 609 | Ga0500636_0044953 | 3300053177 | Bacteria | 2605 |
| 610 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 611 | Ga0500645_000594 | 3300053730 | Bacteria | 23306 |
| 612 | Ga0500645_000819 | 3300053730 | Bacteria | 18532 |
| 613 | Ga0500645_009486 | 3300053730 | Bacteria | 3267 |
| 614 | Ga0500645_037537 | 3300053730 | Bacteria | 1438 |
| 615 | Ga0500609_000114 | 3300053731 | Bacteria | 10626 |
| 616 | Ga0500596_000086 | 3300053735 | Bacteria | 12601 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0127790 | Ga0395905_0127790_1736_2359 | 207 |
| 2 | 3300046684 | Ga0495669_0263852 | Ga0495669_0263852_143_802 | 219 |
| 3 | 3300005329 | Ga0070683_100473442 | Ga0070683_1004734422 | 229 |
| 4 | 3300005719 | Ga0068861_100381852 | Ga0068861_1003818521 | 232 |
| 5 | 3300010375 | Ga0105239_11252061 | Ga0105239_112520611 | 232 |
| 6 | 3300026118 | Ga0207675_100220553 | Ga0207675_1002205531 | 232 |
| 7 | 3300033180 | Ga0307510_10131873 | Ga0307510_101318733 | 232 |
| 8 | 3300048924 | Ga0496121_0087699 | Ga0496121_0087699_868_1578 | 232 |
| 9 | 3300053104 | Ga0500556_0126815 | Ga0500556_0126815_67_777 | 232 |
| 10 | 3300053131 | Ga0500652_101490 | Ga0500652_101490_292_1002 | 232 |
| 11 | 3300053136 | Ga0500559_0000002 | Ga0500559_0000002_133822_134592 | 236 |
| 12 | 3300053136 | Ga0500559_0088361 | Ga0500559_0088361_264_1034 | 236 |
| 13 | 3300005617 | Ga0068859_100011775 | Ga0068859_1000117755 | 237 |
| 14 | 3300009553 | Ga0105249_10008807 | Ga0105249_100088075 | 237 |
| 15 | 3300031456 | Ga0307513_10010089 | Ga0307513_100100896 | 237 |
| 16 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_120482_121264 | 237 |
| 17 | iso_pu_bacteria | 2510917021 | 2511128981 | 238 |
| 18 | 3300005563 | Ga0068855_100010807 | Ga0068855_1000108079 | 239 |
| 19 | 3300025949 | Ga0207667_10006755 | Ga0207667_100067554 | 239 |
| 20 | 3300026142 | Ga0207698_10122133 | Ga0207698_101221333 | 239 |
| 21 | 3300053125 | Ga0500618_000803 | Ga0500618_000803_14140_14928 | 239 |
| 22 | 3300005578 | Ga0068854_100010741 | Ga0068854_1000107413 | 240 |
| 23 | 3300053140 | Ga0500573_0097357 | Ga0500573_0097357_61_846 | 240 |
| 24 | iso_pu_bacteria | 2585428106 | 2587916052 | 240 |
| 25 | iso_pu_bacteria | 2643221640 | 2644224423 | 240 |
| 26 | iso_pu_bacteria | 2643221642 | 2644234640 | 240 |
| 27 | iso_pu_bacteria | 2857504554 | 2857507381 | 240 |
| 28 | iso_pu_bacteria | 2884960567 | 2884962804 | 240 |
| 29 | iso_pu_bacteria | 2928531327 | 2928532684 | 240 |
| 30 | 3300003791 | Ga0055530_10001171 | Ga0055530_100011719 | 241 |
| 31 | 3300003794 | Ga0055531_10000161 | Ga0055531_1000016116 | 241 |
| 32 | 3300025298 | Ga0209050_1000014 | Ga0209050_1000014489 | 241 |
| 33 | 3300025304 | Ga0209257_1000019 | Ga0209257_1000019203 | 241 |
| 34 | 3300041410 | Ga0439461_0000282 | Ga0439461_0000282_175_954 | 241 |
| 35 | 3300041413 | Ga0439465_0004149 | Ga0439465_0004149_783_1562 | 241 |
| 36 | 3300041997 | Ga0439431_0002774 | Ga0439431_0002774_1145_1924 | 241 |
| 37 | 3300042002 | Ga0439442_009911 | Ga0439442_009911_231_1010 | 241 |
| 38 | 3300042004 | Ga0439445_0004449 | Ga0439445_0004449_214_993 | 241 |
| 39 | 3300042006 | Ga0439432_001007 | Ga0439432_001007_1714_2493 | 241 |
| 40 | 3300042010 | Ga0439452_022882 | Ga0439452_022882_237_1016 | 241 |
| 41 | 3300042015 | Ga0439462_0012207 | Ga0439462_0012207_1352_2131 | 241 |
| 42 | 3300042435 | Ga0439434_0018068 | Ga0439434_0018068_1297_2076 | 241 |
| 43 | 3300005331 | Ga0070670_100312032 | Ga0070670_1003120321 | 242 |
| 44 | 3300005367 | Ga0070667_100006029 | Ga0070667_1000060299 | 242 |
| 45 | 3300005539 | Ga0068853_100270725 | Ga0068853_1002707251 | 242 |
| 46 | 3300005841 | Ga0068863_100000688 | Ga0068863_1000006885 | 242 |
| 47 | 3300005843 | Ga0068860_100000108 | Ga0068860_10000010849 | 242 |
| 48 | 3300005844 | Ga0068862_100010294 | Ga0068862_1000102945 | 242 |
| 49 | 3300006946 | Ga0079104_1018642 | Ga0079104_10186423 | 242 |
| 50 | 3300026088 | Ga0207641_10000204 | Ga0207641_1000020448 | 242 |
| 51 | 3300027111 | Ga0209281_1010105 | Ga0209281_10101053 | 242 |
| 52 | 3300028380 | Ga0268265_10004204 | Ga0268265_100042047 | 242 |
| 53 | 3300028381 | Ga0268264_10000126 | Ga0268264_1000012649 | 242 |
| 54 | 3300031090 | Ga0265760_10019481 | Ga0265760_100194813 | 242 |
| 55 | 3300046500 | Ga0495596_0000579 | Ga0495596_0000579_14401_15213 | 242 |
| 56 | 3300046506 | Ga0495583_0085426 | Ga0495583_0085426_320_1123 | 242 |
| 57 | 3300046507 | Ga0495606_0022189 | Ga0495606_0022189_3648_4460 | 242 |
| 58 | 3300046512 | Ga0495610_0005829 | Ga0495610_0005829_7686_8498 | 242 |
| 59 | 3300046522 | Ga0495643_0000027 | Ga0495643_0000027_197449_198261 | 242 |
| 60 | 3300046522 | Ga0495643_0033953 | Ga0495643_0033953_1051_1863 | 242 |
| 61 | 3300046538 | Ga0495609_0001808 | Ga0495609_0001808_5919_6731 | 242 |
| 62 | 3300046558 | Ga0495633_0064066 | Ga0495633_0064066_218_1024 | 242 |
| 63 | 3300046616 | Ga0495668_0051644 | Ga0495668_0051644_940_1752 | 242 |
| 64 | 3300046692 | Ga0495671_0062855 | Ga0495671_0062855_883_1695 | 242 |
| 65 | 3300047470 | Ga0495681_0086568 | Ga0495681_0086568_77_889 | 242 |
| 66 | 3300048905 | Ga0496102_0202463 | Ga0496102_0202463_503_1315 | 242 |
| 67 | 3300048906 | Ga0496103_0029588 | Ga0496103_0029588_1653_2465 | 242 |
| 68 | 3300048907 | Ga0496104_0054442 | Ga0496104_0054442_1058_1870 | 242 |
| 69 | 3300048908 | Ga0496105_0000215 | Ga0496105_0000215_24546_25358 | 242 |
| 70 | 3300048922 | Ga0496119_0149066 | Ga0496119_0149066_73_885 | 242 |
| 71 | 3300048924 | Ga0496121_0141393 | Ga0496121_0141393_375_1187 | 242 |
| 72 | 3300053156 | Ga0500622_0001014 | Ga0500622_0001014_7633_8436 | 242 |
| 73 | iso_pu_bacteria | 2582581279 | 2585146072 | 242 |
| 74 | iso_pu_bacteria | 2739367664 | 2739651930 | 242 |
| 75 | iso_pu_bacteria | 2739367865 | 2740030404 | 242 |
| 76 | 3300006353 | Ga0075370_10003860 | Ga0075370_100038605 | 243 |
| 77 | 3300006353 | Ga0075370_10104602 | Ga0075370_101046022 | 243 |
| 78 | 3300032005 | Ga0307411_10368543 | Ga0307411_103685432 | 243 |
| 79 | 3300046460 | Ga0495638_0045573 | Ga0495638_0045573_1431_2237 | 243 |
| 80 | 3300046512 | Ga0495610_0004486 | Ga0495610_0004486_733_1533 | 243 |
| 81 | 3300048090 | Ga0495615_0000090 | Ga0495615_0000090_18929_19747 | 243 |
| 82 | 3300048091 | Ga0495626_0001824 | Ga0495626_0001824_3440_4240 | 243 |
| 83 | 3300048925 | Ga0496122_0154135 | Ga0496122_0154135_555_1373 | 243 |
| 84 | 3300048926 | Ga0496123_0006320 | Ga0496123_0006320_3863_4681 | 243 |
| 85 | 3300048927 | Ga0496124_0036531 | Ga0496124_0036531_1260_2078 | 243 |
| 86 | 3300049569 | Ga0501032_0033635 | Ga0501032_0033635_845_1576 | 243 |
| 87 | 3300050496 | nmdc:mga07m45_10034_c1 | nmdc:mga07m45_10034_c1_4079_4885 | 243 |
| 88 | 3300050496 | nmdc:mga07m45_85846_c1 | nmdc:mga07m45_85846_c1_207_1013 | 243 |
| 89 | 3300053087 | Ga0500643_007099 | Ga0500643_007099_68_874 | 243 |
| 90 | iso_pu_bacteria | 2791355048 | 2792463533 | 243 |
| 91 | iso_pu_bacteria | 2843744320 | 2843748325 | 243 |
| 92 | iso_pu_bacteria | 2849560528 | 2849564776 | 243 |
| 93 | iso_pu_bacteria | 2849573788 | 2849576979 | 243 |
| 94 | iso_pu_bacteria | 2851153111 | 2851155165 | 243 |
| 95 | iso_pu_bacteria | 2898329390 | 2898329713 | 243 |
| 96 | 3300003781 | Ga0055536_1002622 | Ga0055536_10026225 | 244 |
| 97 | 3300003781 | Ga0055536_1004003 | Ga0055536_10040035 | 244 |
| 98 | 3300003791 | Ga0055530_10003041 | Ga0055530_100030415 | 244 |
| 99 | 3300003791 | Ga0055530_10004969 | Ga0055530_100049695 | 244 |
| 100 | 3300003794 | Ga0055531_10006606 | Ga0055531_100066064 | 244 |
| 101 | 3300006186 | Ga0075369_10001685 | Ga0075369_100016858 | 244 |
| 102 | 3300006195 | Ga0075366_10051741 | Ga0075366_100517413 | 244 |
| 103 | 3300006353 | Ga0075370_10086786 | Ga0075370_100867863 | 244 |
| 104 | 3300013102 | Ga0157371_10039533 | Ga0157371_100395332 | 244 |
| 105 | 3300025292 | Ga0209676_1000067 | Ga0209676_1000067222 | 244 |
| 106 | 3300025292 | Ga0209676_1000379 | Ga0209676_100037941 | 244 |
| 107 | 3300025298 | Ga0209050_1000154 | Ga0209050_100015441 | 244 |
| 108 | 3300025298 | Ga0209050_1000449 | Ga0209050_100044937 | 244 |
| 109 | 3300025299 | Ga0209256_1009314 | Ga0209256_10093142 | 244 |
| 110 | 3300025303 | Ga0209051_1001178 | Ga0209051_10011782 | 244 |
| 111 | 3300025304 | Ga0209257_1000203 | Ga0209257_100020398 | 244 |
| 112 | 3300025304 | Ga0209257_1010055 | Ga0209257_10100552 | 244 |
| 113 | 3300025986 | Ga0207658_10125531 | Ga0207658_101255313 | 244 |
| 114 | 3300027378 | Ga0209981_1002428 | Ga0209981_10024282 | 244 |
| 115 | 3300027543 | Ga0209999_1000319 | Ga0209999_10003198 | 244 |
| 116 | 3300027665 | Ga0209983_1001813 | Ga0209983_10018133 | 244 |
| 117 | 3300031456 | Ga0307513_10041492 | Ga0307513_100414923 | 244 |
| 118 | 3300046460 | Ga0495638_0131225 | Ga0495638_0131225_666_1400 | 244 |
| 119 | 3300046542 | Ga0495597_0079102 | Ga0495597_0079102_204_938 | 244 |
| 120 | 3300046616 | Ga0495668_0000042 | Ga0495668_0000042_94257_94991 | 244 |
| 121 | 3300046616 | Ga0495668_0015614 | Ga0495668_0015614_2100_2834 | 244 |
| 122 | 3300046660 | Ga0495625_0020928 | Ga0495625_0020928_3758_4492 | 244 |
| 123 | 3300047472 | Ga0495686_0016070 | Ga0495686_0016070_1455_2189 | 244 |
| 124 | 3300048927 | Ga0496124_0015996 | Ga0496124_0015996_5645_6379 | 244 |
| 125 | 3300048928 | Ga0496125_0012540 | Ga0496125_0012540_1390_2124 | 244 |
| 126 | 3300048929 | Ga0496126_0009455 | Ga0496126_0009455_4230_4964 | 244 |
| 127 | 3300049573 | Ga0501037_0197165 | Ga0501037_0197165_298_1101 | 244 |
| 128 | 3300050493 | nmdc:mga0k408_68244_c1 | nmdc:mga0k408_68244_c1_1089_1823 | 244 |
| 129 | 3300050496 | nmdc:mga07m45_76366_c1 | nmdc:mga07m45_76366_c1_901_1635 | 244 |
| 130 | 3300050516 | nmdc:mga0sz30_3042_c1 | nmdc:mga0sz30_3042_c1_190_924 | 244 |
| 131 | 3300053087 | Ga0500643_000423 | Ga0500643_000423_25363_26106 | 244 |
| 132 | 3300053096 | Ga0500641_0000558 | Ga0500641_0000558_9826_10569 | 244 |
| 133 | 3300053104 | Ga0500556_0015121 | Ga0500556_0015121_547_1290 | 244 |
| 134 | 3300053108 | Ga0500562_000242 | Ga0500562_000242_2999_3742 | 244 |
| 135 | 3300053108 | Ga0500562_011937 | Ga0500562_011937_1432_2175 | 244 |
| 136 | 3300053117 | Ga0500593_102690 | Ga0500593_102690_250_993 | 244 |
| 137 | 3300053121 | Ga0500607_000098 | Ga0500607_000098_5795_6601 | 244 |
| 138 | 3300053122 | Ga0500608_000013 | Ga0500608_000013_47987_48721 | 244 |
| 139 | 3300053130 | Ga0500642_0071546 | Ga0500642_0071546_743_1477 | 244 |
| 140 | 3300053136 | Ga0500559_0006094 | Ga0500559_0006094_4397_5131 | 244 |
| 141 | 3300053153 | Ga0500616_0012850 | Ga0500616_0012850_3402_4145 | 244 |
| 142 | 3300053153 | Ga0500616_0029837 | Ga0500616_0029837_1995_2738 | 244 |
| 143 | 3300053156 | Ga0500622_0003809 | Ga0500622_0003809_2045_2779 | 244 |
| 144 | 3300053156 | Ga0500622_0007061 | Ga0500622_0007061_3663_4406 | 244 |
| 145 | 3300053156 | Ga0500622_0007316 | Ga0500622_0007316_377_1120 | 244 |
| 146 | 3300053156 | Ga0500622_0106528 | Ga0500622_0106528_276_1010 | 244 |
| 147 | 3300053730 | Ga0500645_000594 | Ga0500645_000594_11683_12426 | 244 |
| 148 | 3300053730 | Ga0500645_000819 | Ga0500645_000819_5020_5763 | 244 |
| 149 | 3300003791 | Ga0055530_10000076 | Ga0055530_1000007680 | 245 |
| 150 | 3300003791 | Ga0055530_10000188 | Ga0055530_1000018838 | 245 |
| 151 | 3300003794 | Ga0055531_10005752 | Ga0055531_100057523 | 245 |
| 152 | 3300004625 | Ga0055543_1010540 | Ga0055543_10105402 | 245 |
| 153 | 3300005262 | Ga0065165_1000029 | Ga0065165_1000029105 | 245 |
| 154 | 3300005335 | Ga0070666_10201248 | Ga0070666_102012482 | 245 |
| 155 | 3300005842 | Ga0068858_100323098 | Ga0068858_1003230981 | 245 |
| 156 | 3300006042 | Ga0075368_10002174 | Ga0075368_100021745 | 245 |
| 157 | 3300006051 | Ga0075364_10000457 | Ga0075364_1000045711 | 245 |
| 158 | 3300006178 | Ga0075367_10001510 | Ga0075367_100015105 | 245 |
| 159 | 3300006186 | Ga0075369_10060100 | Ga0075369_100601003 | 245 |
| 160 | 3300006195 | Ga0075366_10017086 | Ga0075366_100170863 | 245 |
| 161 | 3300006353 | Ga0075370_10305532 | Ga0075370_103055321 | 245 |
| 162 | 3300009553 | Ga0105249_10877985 | Ga0105249_108779851 | 245 |
| 163 | 3300021384 | Ga0213876_10108027 | Ga0213876_101080272 | 245 |
| 164 | 3300025250 | Ga0209026_1005037 | Ga0209026_10050374 | 245 |
| 165 | 3300025297 | Ga0209758_1002875 | Ga0209758_100287519 | 245 |
| 166 | 3300025298 | Ga0209050_1000031 | Ga0209050_1000031294 | 245 |
| 167 | 3300025304 | Ga0209257_1000073 | Ga0209257_100007386 | 245 |
| 168 | 3300025304 | Ga0209257_1000966 | Ga0209257_100096626 | 245 |
| 169 | 3300025903 | Ga0207680_10203005 | Ga0207680_102030052 | 245 |
| 170 | 3300026035 | Ga0207703_10547172 | Ga0207703_105471722 | 245 |
| 171 | 3300027866 | Ga0209813_10004549 | Ga0209813_100045492 | 245 |
| 172 | 3300028380 | Ga0268265_10125789 | Ga0268265_101257892 | 245 |
| 173 | 3300032004 | Ga0307414_10076931 | Ga0307414_100769312 | 245 |
| 174 | 3300033180 | Ga0307510_10143225 | Ga0307510_101432253 | 245 |
| 175 | 3300039437 | Ga0436365_0005985 | Ga0436365_0005985_533_1270 | 245 |
| 176 | 3300044693 | Ga0466961_0111950 | Ga0466961_0111950_560_1306 | 245 |
| 177 | 3300044712 | Ga0453684_0285383 | Ga0453684_0285383_746_1483 | 245 |
| 178 | 3300046616 | Ga0495668_0074411 | Ga0495668_0074411_23_760 | 245 |
| 179 | 3300047318 | Ga0495636_0028685 | Ga0495636_0028685_206_955 | 245 |
| 180 | 3300047472 | Ga0495686_0006911 | Ga0495686_0006911_4220_4957 | 245 |
| 181 | 3300049570 | Ga0501033_0029990 | Ga0501033_0029990_2879_3622 | 245 |
| 182 | 3300049573 | Ga0501037_0158589 | Ga0501037_0158589_208_951 | 245 |
| 183 | 3300049581 | Ga0501047_0071484 | Ga0501047_0071484_1994_2737 | 245 |
| 184 | 3300049822 | Ga0501035_0180472 | Ga0501035_0180472_515_1258 | 245 |
| 185 | 3300049823 | Ga0501044_0004038 | Ga0501044_0004038_4894_5637 | 245 |
| 186 | 3300050491 | nmdc:mga00v17_801_c1 | nmdc:mga00v17_801_c1_6420_7163 | 245 |
| 187 | 3300050493 | nmdc:mga0k408_5702_c1 | nmdc:mga0k408_5702_c1_3416_4159 | 245 |
| 188 | 3300050494 | nmdc:mga06z11_3771_c1 | nmdc:mga06z11_3771_c1_1594_2337 | 245 |
| 189 | 3300050496 | nmdc:mga07m45_22038_c1 | nmdc:mga07m45_22038_c1_355_1098 | 245 |
| 190 | 3300050516 | nmdc:mga0sz30_11763_c1 | nmdc:mga0sz30_11763_c1_125_868 | 245 |
| 191 | 3300053730 | Ga0500645_009486 | Ga0500645_009486_1423_2160 | 245 |
| 192 | 3300005262 | Ga0065165_1031169 | Ga0065165_10311693 | 246 |
| 193 | 3300005327 | Ga0070658_10135198 | Ga0070658_101351982 | 246 |
| 194 | 3300005331 | Ga0070670_100000050 | Ga0070670_100000050124 | 246 |
| 195 | 3300005331 | Ga0070670_100117301 | Ga0070670_1001173011 | 246 |
| 196 | 3300005335 | Ga0070666_10047259 | Ga0070666_100472591 | 246 |
| 197 | 3300005336 | Ga0070680_100026527 | Ga0070680_1000265273 | 246 |
| 198 | 3300005336 | Ga0070680_100131236 | Ga0070680_1001312362 | 246 |
| 199 | 3300005339 | Ga0070660_100021475 | Ga0070660_1000214756 | 246 |
| 200 | 3300005339 | Ga0070660_100126465 | Ga0070660_1001264651 | 246 |
| 201 | 3300005341 | Ga0070691_10024488 | Ga0070691_100244883 | 246 |
| 202 | 3300005347 | Ga0070668_100001178 | Ga0070668_1000011789 | 246 |
| 203 | 3300005347 | Ga0070668_100002233 | Ga0070668_1000022333 | 246 |
| 204 | 3300005347 | Ga0070668_100010330 | Ga0070668_1000103303 | 246 |
| 205 | 3300005347 | Ga0070668_100022775 | Ga0070668_1000227753 | 246 |
| 206 | 3300005347 | Ga0070668_100206646 | Ga0070668_1002066463 | 246 |
| 207 | 3300005355 | Ga0070671_100000153 | Ga0070671_10000015337 | 246 |
| 208 | 3300005355 | Ga0070671_100168754 | Ga0070671_1001687543 | 246 |
| 209 | 3300005366 | Ga0070659_100000040 | Ga0070659_10000004076 | 246 |
| 210 | 3300005366 | Ga0070659_100023337 | Ga0070659_1000233376 | 246 |
| 211 | 3300005367 | Ga0070667_100000299 | Ga0070667_10000029947 | 246 |
| 212 | 3300005367 | Ga0070667_100004014 | Ga0070667_10000401411 | 246 |
| 213 | 3300005367 | Ga0070667_100019418 | Ga0070667_1000194183 | 246 |
| 214 | 3300005367 | Ga0070667_100106034 | Ga0070667_1001060342 | 246 |
| 215 | 3300005458 | Ga0070681_10351475 | Ga0070681_103514751 | 246 |
| 216 | 3300005530 | Ga0070679_100107588 | Ga0070679_1001075882 | 246 |
| 217 | 3300005539 | Ga0068853_100124440 | Ga0068853_1001244401 | 246 |
| 218 | 3300005539 | Ga0068853_100376213 | Ga0068853_1003762132 | 246 |
| 219 | 3300005548 | Ga0070665_100000248 | Ga0070665_10000024881 | 246 |
| 220 | 3300005548 | Ga0070665_100000867 | Ga0070665_10000086715 | 246 |
| 221 | 3300005548 | Ga0070665_100001434 | Ga0070665_1000014343 | 246 |
| 222 | 3300005548 | Ga0070665_100338150 | Ga0070665_1003381503 | 246 |
| 223 | 3300005563 | Ga0068855_100098172 | Ga0068855_1000981724 | 246 |
| 224 | 3300005563 | Ga0068855_100396913 | Ga0068855_1003969131 | 246 |
| 225 | 3300005614 | Ga0068856_100199046 | Ga0068856_1001990462 | 246 |
| 226 | 3300005614 | Ga0068856_100365449 | Ga0068856_1003654492 | 246 |
| 227 | 3300005617 | Ga0068859_100000744 | Ga0068859_10000074429 | 246 |
| 228 | 3300005617 | Ga0068859_100077982 | Ga0068859_1000779824 | 246 |
| 229 | 3300005617 | Ga0068859_100149996 | Ga0068859_1001499962 | 246 |
| 230 | 3300005617 | Ga0068859_100749565 | Ga0068859_1007495652 | 246 |
| 231 | 3300005618 | Ga0068864_100000238 | Ga0068864_10000023811 | 246 |
| 232 | 3300005618 | Ga0068864_100001411 | Ga0068864_1000014115 | 246 |
| 233 | 3300005618 | Ga0068864_100100302 | Ga0068864_1001003023 | 246 |
| 234 | 3300005841 | Ga0068863_100002323 | Ga0068863_10000232312 | 246 |
| 235 | 3300005841 | Ga0068863_100003091 | Ga0068863_1000030912 | 246 |
| 236 | 3300005841 | Ga0068863_100006056 | Ga0068863_10000605612 | 246 |
| 237 | 3300005842 | Ga0068858_100000129 | Ga0068858_10000012953 | 246 |
| 238 | 3300005842 | Ga0068858_100001538 | Ga0068858_1000015387 | 246 |
| 239 | 3300005843 | Ga0068860_100000517 | Ga0068860_10000051752 | 246 |
| 240 | 3300005843 | Ga0068860_100003590 | Ga0068860_1000035908 | 246 |
| 241 | 3300005843 | Ga0068860_100161217 | Ga0068860_1001612171 | 246 |
| 242 | 3300005844 | Ga0068862_100000786 | Ga0068862_10000078624 | 246 |
| 243 | 3300005844 | Ga0068862_100002133 | Ga0068862_1000021339 | 246 |
| 244 | 3300005844 | Ga0068862_100009671 | Ga0068862_1000096713 | 246 |
| 245 | 3300005844 | Ga0068862_100011439 | Ga0068862_1000114392 | 246 |
| 246 | 3300005844 | Ga0068862_100239704 | Ga0068862_1002397042 | 246 |
| 247 | 3300005844 | Ga0068862_100290192 | Ga0068862_1002901922 | 246 |
| 248 | 3300006048 | Ga0075363_100011199 | Ga0075363_1000111996 | 246 |
| 249 | 3300006048 | Ga0075363_100102825 | Ga0075363_1001028252 | 246 |
| 250 | 3300006051 | Ga0075364_10196616 | Ga0075364_101966162 | 246 |
| 251 | 3300006177 | Ga0075362_10019261 | Ga0075362_100192612 | 246 |
| 252 | 3300006178 | Ga0075367_10087211 | Ga0075367_100872111 | 246 |
| 253 | 3300006186 | Ga0075369_10043660 | Ga0075369_100436602 | 246 |
| 254 | 3300006195 | Ga0075366_10174596 | Ga0075366_101745961 | 246 |
| 255 | 3300006353 | Ga0075370_10050797 | Ga0075370_100507973 | 246 |
| 256 | 3300006931 | Ga0097620_100000744 | Ga0097620_10000074429 | 246 |
| 257 | 3300006931 | Ga0097620_100077982 | Ga0097620_1000779824 | 246 |
| 258 | 3300006931 | Ga0097620_100150003 | Ga0097620_1001500032 | 246 |
| 259 | 3300006931 | Ga0097620_100749558 | Ga0097620_1007495582 | 246 |
| 260 | 3300006946 | Ga0079104_1032186 | Ga0079104_10321862 | 246 |
| 261 | 3300009092 | Ga0105250_10097249 | Ga0105250_100972492 | 246 |
| 262 | 3300009093 | Ga0105240_10000522 | Ga0105240_1000052229 | 246 |
| 263 | 3300009093 | Ga0105240_10024604 | Ga0105240_100246049 | 246 |
| 264 | 3300009093 | Ga0105240_10034503 | Ga0105240_100345036 | 246 |
| 265 | 3300009093 | Ga0105240_10077997 | Ga0105240_100779973 | 246 |
| 266 | 3300009093 | Ga0105240_10135159 | Ga0105240_101351594 | 246 |
| 267 | 3300009093 | Ga0105240_10319924 | Ga0105240_103199243 | 246 |
| 268 | 3300009093 | Ga0105240_10576444 | Ga0105240_105764442 | 246 |
| 269 | 3300009101 | Ga0105247_10032924 | Ga0105247_100329243 | 246 |
| 270 | 3300009174 | Ga0105241_10170532 | Ga0105241_101705323 | 246 |
| 271 | 3300009177 | Ga0105248_10002783 | Ga0105248_1000278310 | 246 |
| 272 | 3300009177 | Ga0105248_10056366 | Ga0105248_100563663 | 246 |
| 273 | 3300009177 | Ga0105248_10134183 | Ga0105248_101341833 | 246 |
| 274 | 3300009177 | Ga0105248_10687095 | Ga0105248_106870952 | 246 |
| 275 | 3300009545 | Ga0105237_10108394 | Ga0105237_101083942 | 246 |
| 276 | 3300009551 | Ga0105238_10005659 | Ga0105238_1000565913 | 246 |
| 277 | 3300009551 | Ga0105238_10013681 | Ga0105238_100136817 | 246 |
| 278 | 3300009551 | Ga0105238_10042636 | Ga0105238_100426362 | 246 |
| 279 | 3300009553 | Ga0105249_10000356 | Ga0105249_1000035637 | 246 |
| 280 | 3300009553 | Ga0105249_11017067 | Ga0105249_110170672 | 246 |
| 281 | 3300010375 | Ga0105239_10092191 | Ga0105239_100921913 | 246 |
| 282 | 3300010375 | Ga0105239_10127187 | Ga0105239_101271874 | 246 |
| 283 | 3300013105 | Ga0157369_10338253 | Ga0157369_103382532 | 246 |
| 284 | 3300013306 | Ga0163162_10012291 | Ga0163162_100122912 | 246 |
| 285 | 3300013306 | Ga0163162_10120960 | Ga0163162_101209603 | 246 |
| 286 | 3300013306 | Ga0163162_10387584 | Ga0163162_103875842 | 246 |
| 287 | 3300013307 | Ga0157372_10193139 | Ga0157372_101931392 | 246 |
| 288 | 3300014325 | Ga0163163_10001756 | Ga0163163_1000175610 | 246 |
| 289 | 3300014325 | Ga0163163_10044363 | Ga0163163_100443636 | 246 |
| 290 | 3300014325 | Ga0163163_10764405 | Ga0163163_107644051 | 246 |
| 291 | 3300014326 | Ga0157380_10738414 | Ga0157380_107384142 | 246 |
| 292 | 3300014968 | Ga0157379_10001581 | Ga0157379_1000158110 | 246 |
| 293 | 3300014968 | Ga0157379_10006140 | Ga0157379_100061408 | 246 |
| 294 | 3300014968 | Ga0157379_10037449 | Ga0157379_100374492 | 246 |
| 295 | 3300014968 | Ga0157379_10268704 | Ga0157379_102687042 | 246 |
| 296 | 3300025315 | Ga0207697_10116685 | Ga0207697_101166851 | 246 |
| 297 | 3300025900 | Ga0207710_10091707 | Ga0207710_100917071 | 246 |
| 298 | 3300025903 | Ga0207680_10231325 | Ga0207680_102313252 | 246 |
| 299 | 3300025903 | Ga0207680_10338873 | Ga0207680_103388731 | 246 |
| 300 | 3300025909 | Ga0207705_10013624 | Ga0207705_100136242 | 246 |
| 301 | 3300025909 | Ga0207705_10082788 | Ga0207705_100827883 | 246 |
| 302 | 3300025912 | Ga0207707_10122678 | Ga0207707_101226783 | 246 |
| 303 | 3300025912 | Ga0207707_10455592 | Ga0207707_104555921 | 246 |
| 304 | 3300025913 | Ga0207695_10000987 | Ga0207695_1000098718 | 246 |
| 305 | 3300025913 | Ga0207695_10001134 | Ga0207695_1000113429 | 246 |
| 306 | 3300025913 | Ga0207695_10043719 | Ga0207695_100437193 | 246 |
| 307 | 3300025913 | Ga0207695_10044496 | Ga0207695_100444965 | 246 |
| 308 | 3300025913 | Ga0207695_10113133 | Ga0207695_101131334 | 246 |
| 309 | 3300025913 | Ga0207695_10184169 | Ga0207695_101841692 | 246 |
| 310 | 3300025914 | Ga0207671_10215829 | Ga0207671_102158291 | 246 |
| 311 | 3300025917 | Ga0207660_10004369 | Ga0207660_100043695 | 246 |
| 312 | 3300025917 | Ga0207660_10077458 | Ga0207660_100774582 | 246 |
| 313 | 3300025919 | Ga0207657_10005615 | Ga0207657_1000561510 | 246 |
| 314 | 3300025919 | Ga0207657_10494347 | Ga0207657_104943472 | 246 |
| 315 | 3300025921 | Ga0207652_10222722 | Ga0207652_102227222 | 246 |
| 316 | 3300025923 | Ga0207681_10049084 | Ga0207681_100490841 | 246 |
| 317 | 3300025924 | Ga0207694_10027260 | Ga0207694_100272603 | 246 |
| 318 | 3300025924 | Ga0207694_10258044 | Ga0207694_102580442 | 246 |
| 319 | 3300025924 | Ga0207694_10393472 | Ga0207694_103934722 | 246 |
| 320 | 3300025925 | Ga0207650_10000133 | Ga0207650_1000013381 | 246 |
| 321 | 3300025925 | Ga0207650_10261930 | Ga0207650_102619302 | 246 |
| 322 | 3300025925 | Ga0207650_10309498 | Ga0207650_103094981 | 246 |
| 323 | 3300025927 | Ga0207687_10734869 | Ga0207687_107348691 | 246 |
| 324 | 3300025931 | Ga0207644_10005355 | Ga0207644_100053554 | 246 |
| 325 | 3300025931 | Ga0207644_10122237 | Ga0207644_101222373 | 246 |
| 326 | 3300025932 | Ga0207690_10000134 | Ga0207690_1000013427 | 246 |
| 327 | 3300025932 | Ga0207690_10098748 | Ga0207690_100987482 | 246 |
| 328 | 3300025933 | Ga0207706_10589070 | Ga0207706_105890702 | 246 |
| 329 | 3300025936 | Ga0207670_10420518 | Ga0207670_104205181 | 246 |
| 330 | 3300025941 | Ga0207711_10004518 | Ga0207711_1000451810 | 246 |
| 331 | 3300025941 | Ga0207711_10010448 | Ga0207711_1001044810 | 246 |
| 332 | 3300025941 | Ga0207711_10023337 | Ga0207711_100233372 | 246 |
| 333 | 3300025941 | Ga0207711_10068717 | Ga0207711_100687172 | 246 |
| 334 | 3300025941 | Ga0207711_10097346 | Ga0207711_100973461 | 246 |
| 335 | 3300025941 | Ga0207711_10178550 | Ga0207711_101785502 | 246 |
| 336 | 3300025949 | Ga0207667_10041133 | Ga0207667_100411334 | 246 |
| 337 | 3300025961 | Ga0207712_10000790 | Ga0207712_1000079019 | 246 |
| 338 | 3300025961 | Ga0207712_10107914 | Ga0207712_101079142 | 246 |
| 339 | 3300025972 | Ga0207668_10000016 | Ga0207668_10000016141 | 246 |
| 340 | 3300025972 | Ga0207668_10000662 | Ga0207668_1000066212 | 246 |
| 341 | 3300025972 | Ga0207668_10007795 | Ga0207668_100077958 | 246 |
| 342 | 3300025972 | Ga0207668_10015854 | Ga0207668_100158543 | 246 |
| 343 | 3300025972 | Ga0207668_10027975 | Ga0207668_100279755 | 246 |
| 344 | 3300025972 | Ga0207668_10030241 | Ga0207668_100302413 | 246 |
| 345 | 3300025986 | Ga0207658_10000931 | Ga0207658_1000093111 | 246 |
| 346 | 3300025986 | Ga0207658_10013584 | Ga0207658_100135844 | 246 |
| 347 | 3300025986 | Ga0207658_10015286 | Ga0207658_100152866 | 246 |
| 348 | 3300026035 | Ga0207703_10000086 | Ga0207703_1000008617 | 246 |
| 349 | 3300026035 | Ga0207703_10003556 | Ga0207703_100035564 | 246 |
| 350 | 3300026035 | Ga0207703_10010955 | Ga0207703_100109553 | 246 |
| 351 | 3300026041 | Ga0207639_10022556 | Ga0207639_100225562 | 246 |
| 352 | 3300026041 | Ga0207639_10110891 | Ga0207639_101108913 | 246 |
| 353 | 3300026078 | Ga0207702_10178850 | Ga0207702_101788503 | 246 |
| 354 | 3300026088 | Ga0207641_10002389 | Ga0207641_100023892 | 246 |
| 355 | 3300026088 | Ga0207641_10003109 | Ga0207641_100031099 | 246 |
| 356 | 3300026088 | Ga0207641_10005335 | Ga0207641_100053355 | 246 |
| 357 | 3300026088 | Ga0207641_10291200 | Ga0207641_102912002 | 246 |
| 358 | 3300026088 | Ga0207641_10416318 | Ga0207641_104163181 | 246 |
| 359 | 3300026095 | Ga0207676_10000109 | Ga0207676_1000010911 | 246 |
| 360 | 3300026095 | Ga0207676_10001695 | Ga0207676_100016952 | 246 |
| 361 | 3300026095 | Ga0207676_10726154 | Ga0207676_107261542 | 246 |
| 362 | 3300026118 | Ga0207675_100029840 | Ga0207675_1000298403 | 246 |
| 363 | 3300026142 | Ga0207698_10284379 | Ga0207698_102843792 | 246 |
| 364 | 3300027866 | Ga0209813_10002858 | Ga0209813_100028581 | 246 |
| 365 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051125 | 246 |
| 366 | 3300028379 | Ga0268266_10013577 | Ga0268266_100135774 | 246 |
| 367 | 3300028380 | Ga0268265_10001942 | Ga0268265_100019422 | 246 |
| 368 | 3300028380 | Ga0268265_10002377 | Ga0268265_100023779 | 246 |
| 369 | 3300028380 | Ga0268265_10004078 | Ga0268265_1000407812 | 246 |
| 370 | 3300028380 | Ga0268265_10013434 | Ga0268265_100134345 | 246 |
| 371 | 3300028380 | Ga0268265_10069488 | Ga0268265_100694882 | 246 |
| 372 | 3300028380 | Ga0268265_10495257 | Ga0268265_104952572 | 246 |
| 373 | 3300028381 | Ga0268264_10000364 | Ga0268264_1000036412 | 246 |
| 374 | 3300028381 | Ga0268264_10000416 | Ga0268264_1000041618 | 246 |
| 375 | 3300028381 | Ga0268264_10273395 | Ga0268264_102733952 | 246 |
| 376 | 3300028381 | Ga0268264_10587756 | Ga0268264_105877562 | 246 |
| 377 | 3300028794 | Ga0307515_10026487 | Ga0307515_100264874 | 246 |
| 378 | 3300030521 | Ga0307511_10126914 | Ga0307511_101269142 | 246 |
| 379 | 3300033180 | Ga0307510_10017593 | Ga0307510_100175934 | 246 |
| 380 | 3300035089 | Ga0373944_0015705 | Ga0373944_0015705_1197_1937 | 246 |
| 381 | 3300035695 | Ga0373927_0000130 | Ga0373927_0000130_7860_8600 | 246 |
| 382 | 3300035725 | Ga0373947_0072289 | Ga0373947_0072289_1323_2063 | 246 |
| 383 | 3300037068 | Ga0373925_0000022 | Ga0373925_0000022_4953_5693 | 246 |
| 384 | 3300037068 | Ga0373925_0351289 | Ga0373925_0351289_265_1008 | 246 |
| 385 | 3300037312 | Ga0395899_0000984 | Ga0395899_0000984_2477_3223 | 246 |
| 386 | 3300037312 | Ga0395899_0029052 | Ga0395899_0029052_115_864 | 246 |
| 387 | 3300037312 | Ga0395899_0143603 | Ga0395899_0143603_515_1264 | 246 |
| 388 | 3300037418 | Ga0395900_0000010 | Ga0395900_0000010_368361_369107 | 246 |
| 389 | 3300037418 | Ga0395900_0044298 | Ga0395900_0044298_2864_3613 | 246 |
| 390 | 3300037466 | Ga0395898_0004653 | Ga0395898_0004653_6731_7477 | 246 |
| 391 | 3300037471 | Ga0395905_0001301 | Ga0395905_0001301_17213_17959 | 246 |
| 392 | 3300037471 | Ga0395905_0039254 | Ga0395905_0039254_3524_4273 | 246 |
| 393 | 3300037471 | Ga0395905_0075530 | Ga0395905_0075530_1959_2705 | 246 |
| 394 | 3300037471 | Ga0395905_0133687 | Ga0395905_0133687_227_976 | 246 |
| 395 | 3300037471 | Ga0395905_0333141 | Ga0395905_0333141_344_1090 | 246 |
| 396 | 3300037471 | Ga0395905_0689689 | Ga0395905_0689689_58_807 | 246 |
| 397 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_452725_453471 | 246 |
| 398 | 3300038443 | Ga0395901_0229573 | Ga0395901_0229573_44_793 | 246 |
| 399 | 3300038443 | Ga0395901_0521868 | Ga0395901_0521868_424_1173 | 246 |
| 400 | 3300046460 | Ga0495638_0000109 | Ga0495638_0000109_92178_92918 | 246 |
| 401 | 3300046471 | Ga0495650_0048529 | Ga0495650_0048529_666_1406 | 246 |
| 402 | 3300046492 | Ga0495585_0034512 | Ga0495585_0034512_1357_2103 | 246 |
| 403 | 3300046512 | Ga0495610_0002807 | Ga0495610_0002807_10006_10746 | 246 |
| 404 | 3300046512 | Ga0495610_0058681 | Ga0495610_0058681_1084_1830 | 246 |
| 405 | 3300046515 | Ga0495620_0069285 | Ga0495620_0069285_305_1051 | 246 |
| 406 | 3300046518 | Ga0495631_0011245 | Ga0495631_0011245_1820_2560 | 246 |
| 407 | 3300046524 | Ga0495648_0000075 | Ga0495648_0000075_102374_103129 | 246 |
| 408 | 3300046542 | Ga0495597_0001893 | Ga0495597_0001893_11994_12740 | 246 |
| 409 | 3300046557 | Ga0495622_0002466 | Ga0495622_0002466_5423_6169 | 246 |
| 410 | 3300046616 | Ga0495668_0066742 | Ga0495668_0066742_172_912 | 246 |
| 411 | 3300046648 | Ga0495611_0172877 | Ga0495611_0172877_238_984 | 246 |
| 412 | 3300046684 | Ga0495669_0000172 | Ga0495669_0000172_2030_2776 | 246 |
| 413 | 3300046690 | Ga0495624_0306614 | Ga0495624_0306614_44_790 | 246 |
| 414 | 3300047469 | Ga0495673_0000139 | Ga0495673_0000139_112_867 | 246 |
| 415 | 3300047472 | Ga0495686_0000870 | Ga0495686_0000870_20502_21242 | 246 |
| 416 | 3300047673 | Ga0495593_0061590 | Ga0495593_0061590_237_983 | 246 |
| 417 | 3300048905 | Ga0496102_0069444 | Ga0496102_0069444_2353_3099 | 246 |
| 418 | 3300048905 | Ga0496102_0082361 | Ga0496102_0082361_1350_2102 | 246 |
| 419 | 3300048906 | Ga0496103_0041410 | Ga0496103_0041410_1665_2411 | 246 |
| 420 | 3300048915 | Ga0496112_0257829 | Ga0496112_0257829_194_943 | 246 |
| 421 | 3300048918 | Ga0496115_0001599 | Ga0496115_0001599_12979_13719 | 246 |
| 422 | 3300048918 | Ga0496115_0001643 | Ga0496115_0001643_4640_5380 | 246 |
| 423 | 3300048918 | Ga0496115_0143039 | Ga0496115_0143039_216_962 | 246 |
| 424 | 3300048920 | Ga0496117_0047823 | Ga0496117_0047823_1924_2670 | 246 |
| 425 | 3300048921 | Ga0496118_0128666 | Ga0496118_0128666_520_1266 | 246 |
| 426 | 3300048922 | Ga0496119_0020652 | Ga0496119_0020652_2774_3520 | 246 |
| 427 | 3300048923 | Ga0496120_0116948 | Ga0496120_0116948_34_780 | 246 |
| 428 | 3300048924 | Ga0496121_0001187 | Ga0496121_0001187_18146_18892 | 246 |
| 429 | 3300049459 | Ga0495678_001134 | Ga0495678_001134_4888_5628 | 246 |
| 430 | 3300049686 | Ga0501257_016058 | Ga0501257_016058_505_1245 | 246 |
| 431 | 3300050489 | nmdc:mga03683_229_c1 | nmdc:mga03683_229_c1_9311_10129 | 246 |
| 432 | 3300050493 | nmdc:mga0k408_226329_c1 | nmdc:mga0k408_226329_c1_241_1059 | 246 |
| 433 | 3300050494 | nmdc:mga06z11_6554_c1 | nmdc:mga06z11_6554_c1_107_925 | 246 |
| 434 | 3300050495 | nmdc:mga04h51_55743_c1 | nmdc:mga04h51_55743_c1_439_1257 | 246 |
| 435 | 3300050496 | nmdc:mga07m45_33_c1 | nmdc:mga07m45_33_c1_27292_28110 | 246 |
| 436 | 3300050516 | nmdc:mga0sz30_86882_c1 | nmdc:mga0sz30_86882_c1_488_1300 | 246 |
| 437 | 3300050516 | nmdc:mga0sz30_9117_c1 | nmdc:mga0sz30_9117_c1_125_943 | 246 |
| 438 | 3300053080 | Ga0500635_0000082 | Ga0500635_0000082_26234_26980 | 246 |
| 439 | 3300053086 | Ga0500578_0000023 | Ga0500578_0000023_67418_68158 | 246 |
| 440 | 3300053087 | Ga0500643_028141 | Ga0500643_028141_70_825 | 246 |
| 441 | 3300053088 | Ga0500644_0000005 | Ga0500644_0000005_98975_99730 | 246 |
| 442 | 3300053093 | Ga0500651_0002702 | Ga0500651_0002702_6760_7506 | 246 |
| 443 | 3300053094 | Ga0500566_0015011 | Ga0500566_0015011_786_1532 | 246 |
| 444 | 3300053108 | Ga0500562_001156 | Ga0500562_001156_503_1261 | 246 |
| 445 | 3300053109 | Ga0500569_000868 | Ga0500569_000868_2750_3496 | 246 |
| 446 | 3300053118 | Ga0500594_0000078 | Ga0500594_0000078_25043_25783 | 246 |
| 447 | 3300053119 | Ga0500595_002406 | Ga0500595_002406_4063_4809 | 246 |
| 448 | 3300053122 | Ga0500608_000054 | Ga0500608_000054_31748_32560 | 246 |
| 449 | 3300053123 | Ga0500614_001498 | Ga0500614_001498_2088_2834 | 246 |
| 450 | 3300053136 | Ga0500559_0013755 | Ga0500559_0013755_692_1438 | 246 |
| 451 | 3300053138 | Ga0500564_000100 | Ga0500564_000100_21241_21981 | 246 |
| 452 | 3300053138 | Ga0500564_186289 | Ga0500564_186289_83_829 | 246 |
| 453 | 3300053148 | Ga0500590_004891 | Ga0500590_004891_2248_2994 | 246 |
| 454 | 3300053154 | Ga0500619_021926 | Ga0500619_021926_172_918 | 246 |
| 455 | 3300053156 | Ga0500622_0002724 | Ga0500622_0002724_54_794 | 246 |
| 456 | 3300053157 | Ga0500624_024419 | Ga0500624_024419_217_963 | 246 |
| 457 | 3300053162 | Ga0500638_088017 | Ga0500638_088017_46_792 | 246 |
| 458 | 3300053163 | Ga0500639_123533 | Ga0500639_123533_297_1043 | 246 |
| 459 | 3300053177 | Ga0500636_0024519 | Ga0500636_0024519_1620_2366 | 246 |
| 460 | 3300053177 | Ga0500636_0036828 | Ga0500636_0036828_324_1070 | 246 |
| 461 | 3300053729 | Ga0500625_000002 | Ga0500625_000002_181612_182424 | 246 |
| 462 | 3300053735 | Ga0500596_000086 | Ga0500596_000086_8548_9294 | 246 |
| 463 | 3300005289 | Ga0065704_10075690 | Ga0065704_100756902 | 247 |
| 464 | 3300005331 | Ga0070670_100009012 | Ga0070670_1000090123 | 247 |
| 465 | 3300005353 | Ga0070669_100000840 | Ga0070669_10000084012 | 247 |
| 466 | 3300005355 | Ga0070671_100072784 | Ga0070671_1000727841 | 247 |
| 467 | 3300005355 | Ga0070671_100164519 | Ga0070671_1001645191 | 247 |
| 468 | 3300005355 | Ga0070671_100245732 | Ga0070671_1002457322 | 247 |
| 469 | 3300005364 | Ga0070673_100449055 | Ga0070673_1004490552 | 247 |
| 470 | 3300005367 | Ga0070667_100010698 | Ga0070667_1000106982 | 247 |
| 471 | 3300005457 | Ga0070662_100223071 | Ga0070662_1002230712 | 247 |
| 472 | 3300005548 | Ga0070665_100001223 | Ga0070665_10000122311 | 247 |
| 473 | 3300005564 | Ga0070664_100245591 | Ga0070664_1002455912 | 247 |
| 474 | 3300005614 | Ga0068856_100070294 | Ga0068856_1000702943 | 247 |
| 475 | 3300005618 | Ga0068864_100001967 | Ga0068864_10000196720 | 247 |
| 476 | 3300005841 | Ga0068863_100004317 | Ga0068863_1000043177 | 247 |
| 477 | 3300005842 | Ga0068858_100119048 | Ga0068858_1001190482 | 247 |
| 478 | 3300005843 | Ga0068860_100153815 | Ga0068860_1001538152 | 247 |
| 479 | 3300005844 | Ga0068862_100097097 | Ga0068862_1000970972 | 247 |
| 480 | 3300006186 | Ga0075369_10091205 | Ga0075369_100912052 | 247 |
| 481 | 3300006237 | Ga0097621_100219863 | Ga0097621_1002198632 | 247 |
| 482 | 3300009011 | Ga0105251_10001541 | Ga0105251_1000154110 | 247 |
| 483 | 3300009093 | Ga0105240_10442461 | Ga0105240_104424612 | 247 |
| 484 | 3300009177 | Ga0105248_10008987 | Ga0105248_1000898715 | 247 |
| 485 | 3300009177 | Ga0105248_10138720 | Ga0105248_101387201 | 247 |
| 486 | 3300013105 | Ga0157369_10493488 | Ga0157369_104934882 | 247 |
| 487 | 3300013306 | Ga0163162_10251112 | Ga0163162_102511123 | 247 |
| 488 | 3300014325 | Ga0163163_10074998 | Ga0163163_100749982 | 247 |
| 489 | 3300014325 | Ga0163163_10150187 | Ga0163163_101501873 | 247 |
| 490 | 3300021384 | Ga0213876_10075259 | Ga0213876_100752593 | 247 |
| 491 | 3300025735 | Ga0207713_1000412 | Ga0207713_100041231 | 247 |
| 492 | 3300025909 | Ga0207705_10275280 | Ga0207705_102752802 | 247 |
| 493 | 3300025923 | Ga0207681_10000499 | Ga0207681_1000049912 | 247 |
| 494 | 3300025924 | Ga0207694_10099616 | Ga0207694_100996163 | 247 |
| 495 | 3300025925 | Ga0207650_10063546 | Ga0207650_100635462 | 247 |
| 496 | 3300025933 | Ga0207706_10031012 | Ga0207706_100310122 | 247 |
| 497 | 3300025941 | Ga0207711_10000625 | Ga0207711_100006253 | 247 |
| 498 | 3300025941 | Ga0207711_10003070 | Ga0207711_1000307013 | 247 |
| 499 | 3300025944 | Ga0207661_10655415 | Ga0207661_106554151 | 247 |
| 500 | 3300025945 | Ga0207679_10285997 | Ga0207679_102859972 | 247 |
| 501 | 3300025960 | Ga0207651_10218156 | Ga0207651_102181562 | 247 |
| 502 | 3300025986 | Ga0207658_10004668 | Ga0207658_100046687 | 247 |
| 503 | 3300026023 | Ga0207677_10135899 | Ga0207677_101358993 | 247 |
| 504 | 3300026078 | Ga0207702_10105004 | Ga0207702_101050042 | 247 |
| 505 | 3300026088 | Ga0207641_10022336 | Ga0207641_100223363 | 247 |
| 506 | 3300026095 | Ga0207676_10001962 | Ga0207676_100019627 | 247 |
| 507 | 3300028379 | Ga0268266_10001277 | Ga0268266_1000127722 | 247 |
| 508 | 3300028379 | Ga0268266_10013343 | Ga0268266_100133436 | 247 |
| 509 | 3300028381 | Ga0268264_10071206 | Ga0268264_100712062 | 247 |
| 510 | 3300028786 | Ga0307517_10017137 | Ga0307517_1001713710 | 247 |
| 511 | 3300031456 | Ga0307513_10007192 | Ga0307513_1000719210 | 247 |
| 512 | 3300031456 | Ga0307513_10007802 | Ga0307513_100078025 | 247 |
| 513 | 3300031616 | Ga0307508_10144165 | Ga0307508_101441652 | 247 |
| 514 | 3300037471 | Ga0395905_0102109 | Ga0395905_0102109_85_840 | 247 |
| 515 | 3300038443 | Ga0395901_0031434 | Ga0395901_0031434_1728_2483 | 247 |
| 516 | 3300039437 | Ga0436365_1596297 | Ga0436365_1596297_273_1016 | 247 |
| 517 | 3300039438 | Ga0436360_0837528 | Ga0436360_0837528_604_1359 | 247 |
| 518 | 3300046616 | Ga0495668_0079102 | Ga0495668_0079102_859_1608 | 247 |
| 519 | 3300046616 | Ga0495668_0135715 | Ga0495668_0135715_29_772 | 247 |
| 520 | 3300046648 | Ga0495611_0002548 | Ga0495611_0002548_1616_2359 | 247 |
| 521 | 3300046660 | Ga0495625_0018621 | Ga0495625_0018621_137_898 | 247 |
| 522 | 3300046684 | Ga0495669_0019239 | Ga0495669_0019239_228_971 | 247 |
| 523 | 3300046684 | Ga0495669_0129071 | Ga0495669_0129071_39_782 | 247 |
| 524 | 3300046689 | Ga0495613_0002308 | Ga0495613_0002308_2078_2833 | 247 |
| 525 | 3300047320 | Ga0495672_0052681 | Ga0495672_0052681_1192_1935 | 247 |
| 526 | 3300048909 | Ga0496106_0168234 | Ga0496106_0168234_671_1414 | 247 |
| 527 | 3300048911 | Ga0496108_0076213 | Ga0496108_0076213_83_826 | 247 |
| 528 | 3300048912 | Ga0496109_0010443 | Ga0496109_0010443_6291_7034 | 247 |
| 529 | 3300048913 | Ga0496110_0154844 | Ga0496110_0154844_281_1024 | 247 |
| 530 | 3300048915 | Ga0496112_0032793 | Ga0496112_0032793_3358_4101 | 247 |
| 531 | 3300048916 | Ga0496113_0078572 | Ga0496113_0078572_83_826 | 247 |
| 532 | 3300048917 | Ga0496114_0320881 | Ga0496114_0320881_136_879 | 247 |
| 533 | 3300048919 | Ga0496116_0140391 | Ga0496116_0140391_379_1200 | 247 |
| 534 | 3300048920 | Ga0496117_0011327 | Ga0496117_0011327_4459_5280 | 247 |
| 535 | 3300048924 | Ga0496121_0007757 | Ga0496121_0007757_1567_2388 | 247 |
| 536 | 3300048928 | Ga0496125_0037095 | Ga0496125_0037095_3276_4097 | 247 |
| 537 | 3300049581 | Ga0501047_0101781 | Ga0501047_0101781_610_1368 | 247 |
| 538 | 3300049823 | Ga0501044_0221897 | Ga0501044_0221897_1000_1749 | 247 |
| 539 | 3300050516 | nmdc:mga0sz30_161874_c1 | nmdc:mga0sz30_161874_c1_98_850 | 247 |
| 540 | 3300053103 | Ga0500555_001298 | Ga0500555_001298_4473_5222 | 247 |
| 541 | 3300053111 | Ga0500572_001158 | Ga0500572_001158_1539_2291 | 247 |
| 542 | 3300053148 | Ga0500590_107421 | Ga0500590_107421_459_1211 | 247 |
| 543 | 3300053151 | Ga0500604_0064831 | Ga0500604_0064831_25_768 | 247 |
| 544 | 3300009093 | Ga0105240_10599993 | Ga0105240_105999932 | 248 |
| 545 | 3300028800 | Ga0265338_10012856 | Ga0265338_100128563 | 248 |
| 546 | 3300046506 | Ga0495583_0128094 | Ga0495583_0128094_81_827 | 248 |
| 547 | 3300046794 | Ga0495589_0013489 | Ga0495589_0013489_391_1137 | 248 |
| 548 | 3300006881 | Ga0068865_100013238 | Ga0068865_1000132383 | 249 |
| 549 | 3300025938 | Ga0207704_10001576 | Ga0207704_1000157612 | 249 |
| 550 | 3300026088 | Ga0207641_10775560 | Ga0207641_107755601 | 249 |
| 551 | 3300046516 | Ga0495628_0123718 | Ga0495628_0123718_592_1350 | 249 |
| 552 | 3300046535 | Ga0495586_0298947 | Ga0495586_0298947_51_809 | 249 |
| 553 | 3300047319 | Ga0495674_0127193 | Ga0495674_0127193_1021_1779 | 249 |
| 554 | 3300048915 | Ga0496112_0257185 | Ga0496112_0257185_248_1000 | 249 |
| 555 | 3300049581 | Ga0501047_0225927 | Ga0501047_0225927_275_1048 | 249 |
| 556 | 3300017792 | Ga0163161_10001996 | Ga0163161_100019964 | 250 |
| 557 | 3300005563 | Ga0068855_100523808 | Ga0068855_1005238082 | 251 |
| 558 | 3300013307 | Ga0157372_10152059 | Ga0157372_101520593 | 251 |
| 559 | 3300025949 | Ga0207667_10490065 | Ga0207667_104900652 | 251 |
| 560 | 3300046506 | Ga0495583_0000001 | Ga0495583_0000001_141894_142667 | 251 |
| 561 | 3300031247 | Ga0265340_10030466 | Ga0265340_100304663 | 252 |
| 562 | 3300046460 | Ga0495638_0031759 | Ga0495638_0031759_129_905 | 252 |
| 563 | iso_pu_bacteria | 2510917020 | 2511123107 | 252 |
| 564 | 3300053177 | Ga0500636_0044953 | Ga0500636_0044953_966_1736 | 254 |
| 565 | iso_pu_bacteria | 2643221583 | 2643926447 | 254 |
| 566 | 3300003773 | Ga0055537_1001890 | Ga0055537_10018903 | 255 |
| 567 | 3300003775 | Ga0055524_1020919 | Ga0055524_10209193 | 255 |
| 568 | 3300003775 | Ga0055524_1025148 | Ga0055524_10251483 | 255 |
| 569 | 3300003790 | Ga0055528_1014364 | Ga0055528_10143642 | 255 |
| 570 | 3300025263 | Ga0209565_1000466 | Ga0209565_100046622 | 255 |
| 571 | 3300025273 | Ga0209673_1000722 | Ga0209673_100072233 | 255 |
| 572 | 3300025291 | Ga0209675_1010065 | Ga0209675_10100653 | 255 |
| 573 | 3300025297 | Ga0209758_1003007 | Ga0209758_10030076 | 255 |
| 574 | 3300025299 | Ga0209256_1001877 | Ga0209256_10018773 | 255 |
| 575 | 3300025299 | Ga0209256_1010502 | Ga0209256_10105022 | 255 |
| 576 | 3300046460 | Ga0495638_0001122 | Ga0495638_0001122_12658_13425 | 255 |
| 577 | 3300048918 | Ga0496115_0018435 | Ga0496115_0018435_1922_2689 | 255 |
| 578 | 3300053087 | Ga0500643_018127 | Ga0500643_018127_1491_2258 | 255 |
| 579 | 3300053156 | Ga0500622_0007734 | Ga0500622_0007734_244_1011 | 255 |
| 580 | 3300047469 | Ga0495673_0000305 | Ga0495673_0000305_51614_52384 | 256 |
| 581 | 3300053142 | Ga0500577_0001328 | Ga0500577_0001328_2130_2900 | 256 |
| 582 | 3300046457 | Ga0495590_0112293 | Ga0495590_0112293_117_890 | 257 |
| 583 | 3300046460 | Ga0495638_0001193 | Ga0495638_0001193_3564_4337 | 257 |
| 584 | 3300046520 | Ga0495637_0013209 | Ga0495637_0013209_762_1535 | 257 |
| 585 | 3300047320 | Ga0495672_0001176 | Ga0495672_0001176_4910_5683 | 257 |
| 586 | 3300053104 | Ga0500556_0001541 | Ga0500556_0001541_3584_4357 | 257 |
| 587 | 3300053730 | Ga0500645_037537 | Ga0500645_037537_474_1247 | 257 |
| 588 | 3300028794 | Ga0307515_10139358 | Ga0307515_101393583 | 258 |
| 589 | 3300042156 | Ga0439446_0018177 | Ga0439446_0018177_67_843 | 258 |
| 590 | 3300046471 | Ga0495650_0000020 | Ga0495650_0000020_387032_387808 | 258 |
| 591 | 3300046507 | Ga0495606_0022286 | Ga0495606_0022286_1154_1930 | 258 |
| 592 | 3300046512 | Ga0495610_0000218 | Ga0495610_0000218_24200_24976 | 258 |
| 593 | 3300046512 | Ga0495610_0003224 | Ga0495610_0003224_1602_2378 | 258 |
| 594 | 3300046522 | Ga0495643_0031859 | Ga0495643_0031859_1521_2297 | 258 |
| 595 | 3300046530 | Ga0495654_0000139 | Ga0495654_0000139_37157_37933 | 258 |
| 596 | 3300046660 | Ga0495625_0000165 | Ga0495625_0000165_3840_4616 | 258 |
| 597 | 3300046660 | Ga0495625_0020407 | Ga0495625_0020407_3519_4295 | 258 |
| 598 | 3300046660 | Ga0495625_0088733 | Ga0495625_0088733_592_1368 | 258 |
| 599 | 3300046691 | Ga0495670_0163271 | Ga0495670_0163271_226_1002 | 258 |
| 600 | 3300046810 | Ga0495660_0145642 | Ga0495660_0145642_234_1010 | 258 |
| 601 | 3300047446 | Ga0495679_011751 | Ga0495679_011751_519_1295 | 258 |
| 602 | 3300047469 | Ga0495673_0001209 | Ga0495673_0001209_3555_4331 | 258 |
| 603 | 3300047472 | Ga0495686_0004871 | Ga0495686_0004871_5305_6081 | 258 |
| 604 | 3300047472 | Ga0495686_0033861 | Ga0495686_0033861_1971_2747 | 258 |
| 605 | 3300047472 | Ga0495686_0181389 | Ga0495686_0181389_234_1010 | 258 |
| 606 | 3300048909 | Ga0496106_0069223 | Ga0496106_0069223_651_1427 | 258 |
| 607 | 3300048910 | Ga0496107_0000050 | Ga0496107_0000050_58689_59465 | 258 |
| 608 | 3300048924 | Ga0496121_0019233 | Ga0496121_0019233_1776_2552 | 258 |
| 609 | 3300053123 | Ga0500614_055042 | Ga0500614_055042_10_786 | 258 |
| 610 | 3300053125 | Ga0500618_000195 | Ga0500618_000195_15249_16025 | 258 |
| 611 | 3300053134 | Ga0500658_0002785 | Ga0500658_0002785_1433_2209 | 258 |
| 612 | 3300053136 | Ga0500559_0000024 | Ga0500559_0000024_67489_68265 | 258 |
| 613 | 3300053158 | Ga0500627_0005963 | Ga0500627_0005963_983_1759 | 258 |
| 614 | 3300053108 | Ga0500562_000372 | Ga0500562_000372_7883_8668 | 259 |
| 615 | 3300053136 | Ga0500559_0010593 | Ga0500559_0010593_1263_2042 | 259 |
| 616 | iso_pu_bacteria | 2582581280 | 2585150580 | 259 |
| 617 | iso_pu_bacteria | 2582581293 | 2585198098 | 259 |
| 618 | iso_pu_bacteria | 2643221545 | 2643751007 | 259 |
| 619 | iso_pu_bacteria | 2643221552 | 2643782733 | 259 |
| 620 | iso_pu_bacteria | 2643221584 | 2643928042 | 259 |
| 621 | iso_pu_bacteria | 2643221691 | 2644510975 | 259 |
| 622 | iso_pu_bacteria | 2818991435 | 2819539792 | 259 |
| 623 | iso_pu_bacteria | 2818991454 | 2819648929 | 259 |
| 624 | 3300003771 | Ga0055526_1017218 | Ga0055526_10172182 | 263 |
| 625 | 3300003794 | Ga0055531_10001970 | Ga0055531_1000197014 | 263 |
| 626 | 3300025295 | Ga0209564_1010672 | Ga0209564_10106722 | 263 |
| 627 | 3300025297 | Ga0209758_1005171 | Ga0209758_100517113 | 263 |
| 628 | 3300025298 | Ga0209050_1015693 | Ga0209050_10156933 | 263 |
| 629 | 3300025304 | Ga0209257_1000066 | Ga0209257_1000066244 | 263 |
| 630 | 3300041512 | Ga0451853_0416643 | Ga0451853_0416643_1115_1906 | 263 |
| 631 | 3300042001 | Ga0439441_016409 | Ga0439441_016409_472_1263 | 263 |
| 632 | 3300042436 | Ga0439435_0007978 | Ga0439435_0007978_1594_2385 | 263 |
| 633 | 3300046460 | Ga0495638_0005052 | Ga0495638_0005052_670_1461 | 263 |
| 634 | 3300046513 | Ga0495616_0001067 | Ga0495616_0001067_8460_9251 | 263 |
| 635 | 3300046515 | Ga0495620_0077725 | Ga0495620_0077725_91_882 | 263 |
| 636 | 3300046519 | Ga0495632_0002715 | Ga0495632_0002715_4012_4803 | 263 |
| 637 | 3300046538 | Ga0495609_0050970 | Ga0495609_0050970_56_847 | 263 |
| 638 | 3300046616 | Ga0495668_0031580 | Ga0495668_0031580_916_1707 | 263 |
| 639 | 3300046616 | Ga0495668_0038680 | Ga0495668_0038680_108_899 | 263 |
| 640 | 3300046660 | Ga0495625_0002840 | Ga0495625_0002840_3706_4497 | 263 |
| 641 | 3300046810 | Ga0495660_0024954 | Ga0495660_0024954_596_1387 | 263 |
| 642 | 3300053731 | Ga0500609_000114 | Ga0500609_000114_7709_8500 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2goy-assembly2.cif.gz_E | crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps | 0.9299 | 29 | 237 |
| 7lhs-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.9026 | 20 | 224 |
| 7lhu-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.9012 | 20 | 225 |
| 7lhs-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.9006 | 20 | 225 |
| 7lhs-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.89 | 20 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2goyE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9299 | 29 | 237 | 3.40.50.620 |
| af_P9WIK3_10_254_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8994 | 23 | 248 | 3.40.50.620 |
| 2oq2D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8824 | 27 | 248 | 3.40.50.620 |
| 2goyE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8735 | 29 | 237 | 3.40.50.620 |
| af_P17854_2_216_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8727 | 19 | 219 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3AF67-F1-model_v4 | Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) | 0.9892 | 26 | 248 |
GO:0004604
GO:0005737 GO:0019379 GO:0043866 GO:0046872 GO:0051539 GO:0070814 |
| AF-A0A7T7Y7U0-F1-model_v4 | deleted | 0.989 | 29 | 248 |
|
| AF-A0A537PT52-F1-model_v4 | Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) | 0.9885 | 29 | 248 |
GO:0004604
GO:0005737 GO:0019379 GO:0043866 GO:0046872 GO:0051539 GO:0070814 |
| AF-A0A0R3MAL9-F1-model_v4 | Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) | 0.9877 | 32 | 248 |
GO:0004604
GO:0005737 GO:0019379 GO:0046872 GO:0051539 GO:0070814 |
| AF-A0A1M3C8K2-F1-model_v4 | Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) | 0.9876 | 29 | 248 |
GO:0004604
GO:0005737 GO:0019379 GO:0046872 GO:0051539 GO:0070814 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar