F471860

General Info

Members Datasets Scaffolds Average Seq Length
642 309 616 252

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10001996|Ga0163161_100019964
Length 280
Sequence MFKPVQELPGEDQTMLAPAERTRDCIDTTARFQEADAVRLNRMFRGTETIEMLETLLREQMAGDVAIVSSFGAESAVLLHLVSRIDPNVPVLFLDTGKHFPETLAYRDEVIARLGLTDVRNLAPEPEEVAKRDENGLRWSFDPDGCCEIRKVKPLAKALAGFDATITGRKAFQAKTRSSLPRFEIDSTDKQGRLKINPLIDWTAEDIAAYIAEHDLPAHPLVAEGYPSIGCSPCTSKVAPGEDPRSGRWKGWDKVECGIHVGGQSDVVPVELPPGYEPAF

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
15 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
20 2849560528 Caulobacter zeae 410 Isolate Unclassified
21 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
22 2851153111 Caulobacter radicis 736 Isolate Unclassified
23 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
24 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
25 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
26 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
278 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
281 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
282 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
283 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
286 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
287 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
288 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
289 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
290 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
294 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
295 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
302 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
303 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
304 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
309 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 0.16
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.83
Nodule 0.47
Rhizoplane 3.43
Rhizosphere 64.02
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1017218 3300003771 Bacteria 2776
2 Ga0055537_1001890 3300003773 Bacteria 7519
3 Ga0055524_1020919 3300003775 Bacteria 2187
4 Ga0055524_1025148 3300003775 Bacteria 1871
5 Ga0055536_1002622 3300003781 Bacteria 10014
6 Ga0055536_1004003 3300003781 Bacteria 7698
7 Ga0055528_1014364 3300003790 Bacteria 2932
8 Ga0055530_10000076 3300003791 Bacteria 84675
9 Ga0055530_10000188 3300003791 Bacteria 55307
10 Ga0055530_10001171 3300003791 Bacteria 20279
11 Ga0055530_10003041 3300003791 Bacteria 10011
12 Ga0055530_10004969 3300003791 Bacteria 6577
13 Ga0055531_10000161 3300003794 Bacteria 76455
14 Ga0055531_10001970 3300003794 Bacteria 14316
15 Ga0055531_10005752 3300003794 Bacteria 7183
16 Ga0055531_10006606 3300003794 Bacteria 6539
17 Ga0055543_1010540 3300004625 Bacteria 1932
18 Ga0065165_1000029 3300005262 Bacteria 220342
19 Ga0065165_1031169 3300005262 Bacteria 1689
20 Ga0065704_10075690 3300005289 Bacteria 5465
21 Ga0070658_10135198 3300005327 Bacteria 2056
22 Ga0070683_100473442 3300005329 Bacteria 1196
23 Ga0070670_100000050 3300005331 Bacteria 132470
24 Ga0070670_100009012 3300005331 Bacteria 8524
25 Ga0070670_100117301 3300005331 Bacteria 2295
26 Ga0070670_100312032 3300005331 Bacteria 1377
27 Ga0070666_10047259 3300005335 Bacteria 2889
28 Ga0070666_10201248 3300005335 Bacteria 1401
29 Ga0070680_100026527 3300005336 Bacteria 4634
30 Ga0070680_100131236 3300005336 Bacteria 2096
31 Ga0070660_100021475 3300005339 Bacteria 4762
32 Ga0070660_100126465 3300005339 Bacteria 2042
33 Ga0070691_10024488 3300005341 Bacteria 2805
34 Ga0070668_100001178 3300005347 Bacteria 18504
35 Ga0070668_100002233 3300005347 Bacteria 14239
36 Ga0070668_100010330 3300005347 Bacteria 6930
37 Ga0070668_100022775 3300005347 Bacteria 4736
38 Ga0070668_100206646 3300005347 Bacteria 1613
39 Ga0070669_100000840 3300005353 Bacteria 22295
40 Ga0070671_100000153 3300005355 Bacteria 45037
41 Ga0070671_100072784 3300005355 Bacteria 2870
42 Ga0070671_100164519 3300005355 Bacteria 1876
43 Ga0070671_100168754 3300005355 Bacteria 1850
44 Ga0070671_100245732 3300005355 Bacteria 1519
45 Ga0070673_100449055 3300005364 Bacteria 1160
46 Ga0070659_100000040 3300005366 Bacteria 104145
47 Ga0070659_100023337 3300005366 Bacteria 4733
48 Ga0070667_100000299 3300005367 Bacteria 55531
49 Ga0070667_100004014 3300005367 Bacteria 12458
50 Ga0070667_100006029 3300005367 Bacteria 10072
51 Ga0070667_100010698 3300005367 Bacteria 7582
52 Ga0070667_100019418 3300005367 Bacteria 5639
53 Ga0070667_100106034 3300005367 Bacteria 2432
54 Ga0070662_100223071 3300005457 Bacteria 1505
55 Ga0070681_10351475 3300005458 Bacteria 1384
56 Ga0070679_100107588 3300005530 Bacteria 2774
57 Ga0068853_100124440 3300005539 Bacteria 2303
58 Ga0068853_100270725 3300005539 Bacteria 1564
59 Ga0068853_100376213 3300005539 Bacteria 1326
60 Ga0070665_100000248 3300005548 Bacteria 89239
61 Ga0070665_100000867 3300005548 Bacteria 39214
62 Ga0070665_100001223 3300005548 Bacteria 31260
63 Ga0070665_100001434 3300005548 Bacteria 27937
64 Ga0070665_100338150 3300005548 Bacteria 1510
65 Ga0068855_100010807 3300005563 Bacteria 11021
66 Ga0068855_100098172 3300005563 Bacteria 3374
67 Ga0068855_100396913 3300005563 Bacteria 1512
68 Ga0068855_100523808 3300005563 Bacteria 1286
69 Ga0070664_100245591 3300005564 Bacteria 1608
70 Ga0068854_100010741 3300005578 Bacteria 5941
71 Ga0068856_100070294 3300005614 Bacteria 3463
72 Ga0068856_100199046 3300005614 Bacteria 2018
73 Ga0068856_100365449 3300005614 Bacteria 1462
74 Ga0068859_100000744 3300005617 Bacteria 32833
75 Ga0068859_100011775 3300005617 Bacteria 8788
76 Ga0068859_100077982 3300005617 Bacteria 3354
77 Ga0068859_100149996 3300005617 Bacteria 2407
78 Ga0068859_100749565 3300005617 Bacteria 1065
79 Ga0068864_100000238 3300005618 Bacteria 49284
80 Ga0068864_100001411 3300005618 Bacteria 19860
81 Ga0068864_100001967 3300005618 Bacteria 16895
82 Ga0068864_100100302 3300005618 Bacteria 2566
83 Ga0068861_100381852 3300005719 Bacteria 1245
84 Ga0068863_100000688 3300005841 Bacteria 34001
85 Ga0068863_100002323 3300005841 Bacteria 18907
86 Ga0068863_100003091 3300005841 Bacteria 16449
87 Ga0068863_100004317 3300005841 Bacteria 14009
88 Ga0068863_100006056 3300005841 Bacteria 11870
89 Ga0068858_100000129 3300005842 Bacteria 79265
90 Ga0068858_100001538 3300005842 Bacteria 23685
91 Ga0068858_100119048 3300005842 Bacteria 2469
92 Ga0068858_100323098 3300005842 Bacteria 1475
93 Ga0068860_100000108 3300005843 Bacteria 132230
94 Ga0068860_100000517 3300005843 Bacteria 47364
95 Ga0068860_100003590 3300005843 Bacteria 15950
96 Ga0068860_100153815 3300005843 Bacteria 2216
97 Ga0068860_100161217 3300005843 Bacteria 2162
98 Ga0068862_100000786 3300005844 Bacteria 31460
99 Ga0068862_100002133 3300005844 Bacteria 17807
100 Ga0068862_100009671 3300005844 Bacteria 7969
101 Ga0068862_100010294 3300005844 Bacteria 7717
102 Ga0068862_100011439 3300005844 Bacteria 7324
103 Ga0068862_100097097 3300005844 Bacteria 2572
104 Ga0068862_100239704 3300005844 Bacteria 1648
105 Ga0068862_100290192 3300005844 Bacteria 1502
106 Ga0075368_10002174 3300006042 Bacteria 6343
107 Ga0075363_100011199 3300006048 Bacteria 4288
108 Ga0075363_100102825 3300006048 Bacteria 1582
109 Ga0075364_10000457 3300006051 Bacteria 20666
110 Ga0075364_10196616 3300006051 Bacteria 1366
111 Ga0075362_10019261 3300006177 Bacteria 2835
112 Ga0075367_10001510 3300006178 Bacteria 10055
113 Ga0075367_10087211 3300006178 Bacteria 1895
114 Ga0075369_10001685 3300006186 Bacteria 7632
115 Ga0075369_10043660 3300006186 Bacteria 1924
116 Ga0075369_10060100 3300006186 Bacteria 1657
117 Ga0075369_10091205 3300006186 Bacteria 1360
118 Ga0075366_10017086 3300006195 Bacteria 4171
119 Ga0075366_10051741 3300006195 Bacteria 2440
120 Ga0075366_10174596 3300006195 Bacteria 1304
121 Ga0097621_100219863 3300006237 Bacteria 1655
122 Ga0075370_10003860 3300006353 Bacteria 7179
123 Ga0075370_10050797 3300006353 Bacteria 2352
124 Ga0075370_10086786 3300006353 Bacteria 1802
125 Ga0075370_10104602 3300006353 Bacteria 1641
126 Ga0075370_10305532 3300006353 Bacteria 946
127 Ga0068865_100013238 3300006881 Bacteria 5209
128 Ga0097620_100000744 3300006931 Bacteria 32833
129 Ga0097620_100077982 3300006931 Bacteria 3354
130 Ga0097620_100150003 3300006931 Bacteria 2407
131 Ga0097620_100749558 3300006931 Bacteria 1065
132 Ga0079104_1018642 3300006946 Bacteria 1962
133 Ga0079104_1032186 3300006946 Bacteria 1295
134 Ga0105251_10001541 3300009011 Bacteria 19789
135 Ga0105250_10097249 3300009092 Bacteria 1200
136 Ga0105240_10000522 3300009093 Bacteria 70833
137 Ga0105240_10024604 3300009093 Bacteria 7931
138 Ga0105240_10034503 3300009093 Bacteria 6525
139 Ga0105240_10077997 3300009093 Bacteria 4080
140 Ga0105240_10135159 3300009093 Bacteria 2953
141 Ga0105240_10319924 3300009093 Bacteria 1769
142 Ga0105240_10442461 3300009093 Bacteria 1456
143 Ga0105240_10576444 3300009093 Bacteria 1242
144 Ga0105240_10599993 3300009093 Bacteria 1212
145 Ga0105247_10032924 3300009101 Bacteria 3150
146 Ga0105241_10170532 3300009174 Bacteria 1797
147 Ga0105248_10002783 3300009177 Bacteria 19441
148 Ga0105248_10008987 3300009177 Bacteria 10985
149 Ga0105248_10056366 3300009177 Bacteria 4409
150 Ga0105248_10134183 3300009177 Bacteria 2793
151 Ga0105248_10138720 3300009177 Bacteria 2743
152 Ga0105248_10687095 3300009177 Bacteria 1155
153 Ga0105237_10108394 3300009545 Bacteria 2769
154 Ga0105238_10005659 3300009551 Bacteria 12351
155 Ga0105238_10013681 3300009551 Bacteria 8195
156 Ga0105238_10042636 3300009551 Bacteria 4593
157 Ga0105249_10000356 3300009553 Bacteria 45856
158 Ga0105249_10008807 3300009553 Bacteria 8809
159 Ga0105249_10877985 3300009553 Bacteria 963
160 Ga0105249_11017067 3300009553 Bacteria 898
161 Ga0105239_10092191 3300010375 Bacteria 3344
162 Ga0105239_10127187 3300010375 Bacteria 2833
163 Ga0105239_11252061 3300010375 Bacteria 855
164 Ga0157371_10039533 3300013102 Bacteria 3373
165 Ga0157369_10338253 3300013105 Bacteria 1564
166 Ga0157369_10493488 3300013105 Bacteria 1267
167 Ga0163162_10012291 3300013306 Bacteria 8358
168 Ga0163162_10120960 3300013306 Bacteria 2723
169 Ga0163162_10251112 3300013306 Bacteria 1901
170 Ga0163162_10387584 3300013306 Bacteria 1530
171 Ga0157372_10152059 3300013307 Bacteria 2672
172 Ga0157372_10193139 3300013307 Bacteria 2358
173 Ga0163163_10001756 3300014325 Bacteria 18264
174 Ga0163163_10044363 3300014325 Bacteria 4362
175 Ga0163163_10074998 3300014325 Bacteria 3376
176 Ga0163163_10150187 3300014325 Bacteria 2374
177 Ga0163163_10764405 3300014325 Bacteria 1030
178 Ga0157380_10738414 3300014326 Bacteria 994
179 Ga0157379_10001581 3300014968 Bacteria 18756
180 Ga0157379_10006140 3300014968 Bacteria 10344
181 Ga0157379_10037449 3300014968 Bacteria 4325
182 Ga0157379_10268704 3300014968 Bacteria 1550
183 Ga0163161_10001996 3300017792 Bacteria 14773
184 Ga0213876_10075259 3300021384 Bacteria 1783
185 Ga0213876_10108027 3300021384 Bacteria 1476
186 Ga0209026_1005037 3300025250 Bacteria 3690
187 Ga0209565_1000466 3300025263 Bacteria 30502
188 Ga0209673_1000722 3300025273 Bacteria 45860
189 Ga0209675_1010065 3300025291 Bacteria 3268
190 Ga0209676_1000067 3300025292 Bacteria 315576
191 Ga0209676_1000379 3300025292 Bacteria 81751
192 Ga0209564_1010672 3300025295 Bacteria 4201
193 Ga0209758_1002875 3300025297 Bacteria 16680
194 Ga0209758_1003007 3300025297 Bacteria 16137
195 Ga0209758_1005171 3300025297 Bacteria 10264
196 Ga0209050_1000014 3300025298 Bacteria 774327
197 Ga0209050_1000031 3300025298 Bacteria 458181
198 Ga0209050_1000154 3300025298 Bacteria 159160
199 Ga0209050_1000449 3300025298 Bacteria 74643
200 Ga0209050_1015693 3300025298 Bacteria 3159
201 Ga0209256_1001877 3300025299 Bacteria 19375
202 Ga0209256_1009314 3300025299 Bacteria 4328
203 Ga0209256_1010502 3300025299 Bacteria 3863
204 Ga0209051_1001178 3300025303 Bacteria 23705
205 Ga0209257_1000019 3300025304 Bacteria 774261
206 Ga0209257_1000066 3300025304 Bacteria 344166
207 Ga0209257_1000073 3300025304 Bacteria 325833
208 Ga0209257_1000203 3300025304 Bacteria 146148
209 Ga0209257_1000966 3300025304 Bacteria 39401
210 Ga0209257_1010055 3300025304 Bacteria 4895
211 Ga0207697_10116685 3300025315 Bacteria 1147
212 Ga0207713_1000412 3300025735 Bacteria 45595
213 Ga0207710_10091707 3300025900 Bacteria 1422
214 Ga0207680_10203005 3300025903 Bacteria 1352
215 Ga0207680_10231325 3300025903 Bacteria 1271
216 Ga0207680_10338873 3300025903 Bacteria 1054
217 Ga0207705_10013624 3300025909 Bacteria 5866
218 Ga0207705_10082788 3300025909 Bacteria 2341
219 Ga0207705_10275280 3300025909 Bacteria 1288
220 Ga0207707_10122678 3300025912 Bacteria 2272
221 Ga0207707_10455592 3300025912 Bacteria 1094
222 Ga0207695_10000987 3300025913 Bacteria 50463
223 Ga0207695_10001134 3300025913 Bacteria 46205
224 Ga0207695_10043719 3300025913 Bacteria 4772
225 Ga0207695_10044496 3300025913 Bacteria 4721
226 Ga0207695_10113133 3300025913 Bacteria 2691
227 Ga0207695_10184169 3300025913 Bacteria 2008
228 Ga0207671_10215829 3300025914 Bacteria 1502
229 Ga0207660_10004369 3300025917 Bacteria 9219
230 Ga0207660_10077458 3300025917 Bacteria 2434
231 Ga0207657_10005615 3300025919 Bacteria 13091
232 Ga0207657_10494347 3300025919 Bacteria 959
233 Ga0207652_10222722 3300025921 Bacteria 1700
234 Ga0207681_10000499 3300025923 Bacteria 27301
235 Ga0207681_10049084 3300025923 Bacteria 2851
236 Ga0207694_10027260 3300025924 Bacteria 4350
237 Ga0207694_10099616 3300025924 Bacteria 2302
238 Ga0207694_10258044 3300025924 Bacteria 1427
239 Ga0207694_10393472 3300025924 Bacteria 1152
240 Ga0207650_10000133 3300025925 Bacteria 90953
241 Ga0207650_10063546 3300025925 Bacteria 2760
242 Ga0207650_10261930 3300025925 Bacteria 1403
243 Ga0207650_10309498 3300025925 Bacteria 1292
244 Ga0207687_10734869 3300025927 Bacteria 839
245 Ga0207644_10005355 3300025931 Bacteria 8370
246 Ga0207644_10122237 3300025931 Bacteria 1983
247 Ga0207690_10000134 3300025932 Bacteria 60374
248 Ga0207690_10098748 3300025932 Bacteria 2080
249 Ga0207706_10031012 3300025933 Bacteria 4764
250 Ga0207706_10589070 3300025933 Bacteria 956
251 Ga0207670_10420518 3300025936 Bacteria 1072
252 Ga0207704_10001576 3300025938 Bacteria 10235
253 Ga0207711_10000625 3300025941 Bacteria 35512
254 Ga0207711_10003070 3300025941 Bacteria 14583
255 Ga0207711_10004518 3300025941 Bacteria 11850
256 Ga0207711_10010448 3300025941 Bacteria 7707
257 Ga0207711_10023337 3300025941 Bacteria 5178
258 Ga0207711_10068717 3300025941 Bacteria 3069
259 Ga0207711_10097346 3300025941 Bacteria 2598
260 Ga0207711_10178550 3300025941 Bacteria 1929
261 Ga0207661_10655415 3300025944 Bacteria 965
262 Ga0207679_10285997 3300025945 Bacteria 1416
263 Ga0207667_10006755 3300025949 Bacteria 13849
264 Ga0207667_10041133 3300025949 Bacteria 4917
265 Ga0207667_10490065 3300025949 Bacteria 1247
266 Ga0207651_10218156 3300025960 Bacteria 1540
267 Ga0207712_10000790 3300025961 Bacteria 23489
268 Ga0207712_10107914 3300025961 Bacteria 2082
269 Ga0207668_10000016 3300025972 Bacteria 159703
270 Ga0207668_10000662 3300025972 Bacteria 21158
271 Ga0207668_10007795 3300025972 Bacteria 6370
272 Ga0207668_10015854 3300025972 Bacteria 4692
273 Ga0207668_10027975 3300025972 Bacteria 3680
274 Ga0207668_10030241 3300025972 Bacteria 3557
275 Ga0207658_10000931 3300025986 Bacteria 24185
276 Ga0207658_10004668 3300025986 Bacteria 9495
277 Ga0207658_10013584 3300025986 Bacteria 5569
278 Ga0207658_10015286 3300025986 Bacteria 5266
279 Ga0207658_10125531 3300025986 Bacteria 2053
280 Ga0207677_10135899 3300026023 Bacteria 1874
281 Ga0207703_10000086 3300026035 Bacteria 107307
282 Ga0207703_10003556 3300026035 Bacteria 13024
283 Ga0207703_10010955 3300026035 Bacteria 7066
284 Ga0207703_10547172 3300026035 Bacteria 1091
285 Ga0207639_10022556 3300026041 Bacteria 4535
286 Ga0207639_10110891 3300026041 Bacteria 2236
287 Ga0207702_10105004 3300026078 Bacteria 2501
288 Ga0207702_10178850 3300026078 Bacteria 1952
289 Ga0207641_10000204 3300026088 Bacteria 79460
290 Ga0207641_10002389 3300026088 Bacteria 17326
291 Ga0207641_10003109 3300026088 Bacteria 14930
292 Ga0207641_10005335 3300026088 Bacteria 10980
293 Ga0207641_10022336 3300026088 Bacteria 5207
294 Ga0207641_10291200 3300026088 Bacteria 1539
295 Ga0207641_10416318 3300026088 Bacteria 1293
296 Ga0207641_10775560 3300026088 Bacteria 947
297 Ga0207676_10000109 3300026095 Bacteria 74080
298 Ga0207676_10001695 3300026095 Bacteria 16256
299 Ga0207676_10001962 3300026095 Bacteria 14986
300 Ga0207676_10726154 3300026095 Bacteria 964
301 Ga0207675_100029840 3300026118 Bacteria 5078
302 Ga0207675_100220553 3300026118 Bacteria 1827
303 Ga0207698_10122133 3300026142 Bacteria 2207
304 Ga0207698_10284379 3300026142 Bacteria 1531
305 Ga0209281_1010105 3300027111 Bacteria 2178
306 Ga0209981_1002428 3300027378 Bacteria 2374
307 Ga0209999_1000319 3300027543 Bacteria 7192
308 Ga0209983_1001813 3300027665 Bacteria 4744
309 Ga0209813_10002858 3300027866 Bacteria 3997
310 Ga0209813_10004549 3300027866 Bacteria 3319
311 Ga0268266_10000005 3300028379 Bacteria 1448194
312 Ga0268266_10001277 3300028379 Bacteria 30750
313 Ga0268266_10013343 3300028379 Bacteria 7079
314 Ga0268266_10013577 3300028379 Bacteria 7015
315 Ga0268265_10001942 3300028380 Bacteria 16408
316 Ga0268265_10002377 3300028380 Bacteria 14227
317 Ga0268265_10004078 3300028380 Bacteria 10263
318 Ga0268265_10004204 3300028380 Bacteria 10072
319 Ga0268265_10013434 3300028380 Bacteria 5563
320 Ga0268265_10069488 3300028380 Bacteria 2735
321 Ga0268265_10125789 3300028380 Bacteria 2121
322 Ga0268265_10495257 3300028380 Bacteria 1150
323 Ga0268264_10000126 3300028381 Bacteria 186138
324 Ga0268264_10000364 3300028381 Bacteria 67218
325 Ga0268264_10000416 3300028381 Bacteria 60203
326 Ga0268264_10071206 3300028381 Bacteria 2945
327 Ga0268264_10273395 3300028381 Bacteria 1579
328 Ga0268264_10587756 3300028381 Bacteria 1096
329 Ga0307517_10017137 3300028786 Bacteria 9463
330 Ga0307515_10026487 3300028794 Bacteria 9977
331 Ga0307515_10139358 3300028794 Bacteria 2612
332 Ga0265338_10012856 3300028800 Bacteria 9513
333 Ga0307511_10126914 3300030521 Bacteria 1552
334 Ga0265760_10019481 3300031090 Bacteria 1955
335 Ga0265340_10030466 3300031247 Bacteria 2703
336 Ga0307513_10007192 3300031456 Bacteria 14457
337 Ga0307513_10007802 3300031456 Bacteria 13803
338 Ga0307513_10010089 3300031456 Bacteria 11892
339 Ga0307513_10041492 3300031456 Bacteria 5078
340 Ga0307508_10144165 3300031616 Bacteria 1986
341 Ga0307414_10076931 3300032004 Bacteria 2427
342 Ga0307411_10368543 3300032005 Bacteria 1177
343 Ga0307510_10017593 3300033180 Bacteria 8428
344 Ga0307510_10131873 3300033180 Bacteria 2169
345 Ga0307510_10143225 3300033180 Bacteria 2029
346 Ga0373944_0015705 3300035089 Bacteria 2128
347 Ga0373927_0000130 3300035695 Bacteria 57890
348 Ga0373947_0072289 3300035725 Bacteria 2118
349 Ga0373925_0000022 3300037068 Bacteria 160046
350 Ga0373925_0351289 3300037068 Bacteria 1197
351 Ga0395899_0000984 3300037312 Bacteria 26243
352 Ga0395899_0029052 3300037312 Bacteria 4159
353 Ga0395899_0143603 3300037312 Bacteria 1696
354 Ga0395900_0000010 3300037418 Bacteria 461364
355 Ga0395900_0044298 3300037418 Bacteria 4585
356 Ga0395898_0004653 3300037466 Bacteria 14958
357 Ga0395905_0001301 3300037471 Bacteria 30685
358 Ga0395905_0039254 3300037471 Bacteria 4441
359 Ga0395905_0075530 3300037471 Bacteria 3159
360 Ga0395905_0102109 3300037471 Bacteria 2692
361 Ga0395905_0127790 3300037471 Bacteria 2390
362 Ga0395905_0133687 3300037471 Bacteria 2333
363 Ga0395905_0333141 3300037471 Bacteria 1408
364 Ga0395905_0689689 3300037471 Bacteria 924
365 Ga0395901_0000007 3300038443 Bacteria 497408
366 Ga0395901_0031434 3300038443 Bacteria 5475
367 Ga0395901_0229573 3300038443 Bacteria 1938
368 Ga0395901_0521868 3300038443 Bacteria 1206
369 Ga0436365_0005985 3300039437 Bacteria 1465
370 Ga0436365_1596297 3300039437 Bacteria 3685
371 Ga0436360_0837528 3300039438 Bacteria 1605
372 Ga0439461_0000282 3300041410 Bacteria 7317
373 Ga0439465_0004149 3300041413 Bacteria 4715
374 Ga0451853_0416643 3300041512 Bacteria 4269
375 Ga0439431_0002774 3300041997 Bacteria 3856
376 Ga0439441_016409 3300042001 Bacteria 1320
377 Ga0439442_009911 3300042002 Bacteria 1927
378 Ga0439445_0004449 3300042004 Bacteria 3174
379 Ga0439432_001007 3300042006 Bacteria 10647
380 Ga0439452_022882 3300042010 Bacteria 1613
381 Ga0439462_0012207 3300042015 Bacteria 2193
382 Ga0439446_0018177 3300042156 Bacteria 1967
383 Ga0439434_0018068 3300042435 Bacteria 2109
384 Ga0439435_0007978 3300042436 Bacteria 2445
385 Ga0466961_0111950 3300044693 Bacteria 1717
386 Ga0453684_0285383 3300044712 Bacteria 1881
387 Ga0495590_0112293 3300046457 Bacteria 973
388 Ga0495638_0000109 3300046460 Bacteria 131610
389 Ga0495638_0001122 3300046460 Bacteria 25994
390 Ga0495638_0001193 3300046460 Bacteria 24877
391 Ga0495638_0005052 3300046460 Bacteria 9895
392 Ga0495638_0031759 3300046460 Bacteria 3390
393 Ga0495638_0045573 3300046460 Bacteria 2758
394 Ga0495638_0131225 3300046460 Bacteria 1471
395 Ga0495650_0000020 3300046471 Bacteria 533839
396 Ga0495650_0048529 3300046471 Bacteria 1769
397 Ga0495585_0034512 3300046492 Bacteria 2860
398 Ga0495596_0000579 3300046500 Bacteria 22857
399 Ga0495583_0000001 3300046506 Bacteria 811973
400 Ga0495583_0085426 3300046506 Bacteria 1366
401 Ga0495583_0128094 3300046506 Bacteria 1064
402 Ga0495606_0022189 3300046507 Bacteria 4632
403 Ga0495606_0022286 3300046507 Bacteria 4617
404 Ga0495610_0000218 3300046512 Bacteria 61777
405 Ga0495610_0002807 3300046512 Bacteria 14223
406 Ga0495610_0003224 3300046512 Bacteria 12907
407 Ga0495610_0004486 3300046512 Bacteria 10296
408 Ga0495610_0005829 3300046512 Bacteria 8656
409 Ga0495610_0058681 3300046512 Bacteria 1840
410 Ga0495616_0001067 3300046513 Bacteria 19477
411 Ga0495620_0069285 3300046515 Bacteria 1447
412 Ga0495620_0077725 3300046515 Bacteria 1347
413 Ga0495628_0123718 3300046516 Bacteria 1982
414 Ga0495631_0011245 3300046518 Bacteria 4406
415 Ga0495632_0002715 3300046519 Bacteria 13155
416 Ga0495637_0013209 3300046520 Bacteria 3926
417 Ga0495643_0000027 3300046522 Bacteria 266446
418 Ga0495643_0031859 3300046522 Bacteria 2931
419 Ga0495643_0033953 3300046522 Bacteria 2817
420 Ga0495648_0000075 3300046524 Bacteria 129579
421 Ga0495654_0000139 3300046530 Bacteria 75903
422 Ga0495586_0298947 3300046535 Bacteria 922
423 Ga0495609_0001808 3300046538 Bacteria 13737
424 Ga0495609_0050970 3300046538 Bacteria 1844
425 Ga0495597_0001893 3300046542 Bacteria 14240
426 Ga0495597_0079102 3300046542 Bacteria 1408
427 Ga0495622_0002466 3300046557 Bacteria 8963
428 Ga0495633_0064066 3300046558 Bacteria 1719
429 Ga0495668_0000042 3300046616 Bacteria 229361
430 Ga0495668_0015614 3300046616 Bacteria 4430
431 Ga0495668_0031580 3300046616 Bacteria 2984
432 Ga0495668_0038680 3300046616 Bacteria 2665
433 Ga0495668_0051644 3300046616 Bacteria 2276
434 Ga0495668_0066742 3300046616 Bacteria 1979
435 Ga0495668_0074411 3300046616 Bacteria 1865
436 Ga0495668_0079102 3300046616 Bacteria 1805
437 Ga0495668_0135715 3300046616 Bacteria 1347
438 Ga0495611_0002548 3300046648 Bacteria 8267
439 Ga0495611_0172877 3300046648 Bacteria 1010
440 Ga0495625_0000165 3300046660 Bacteria 102988
441 Ga0495625_0002840 3300046660 Bacteria 18199
442 Ga0495625_0018621 3300046660 Bacteria 5413
443 Ga0495625_0020407 3300046660 Bacteria 5116
444 Ga0495625_0020928 3300046660 Bacteria 5042
445 Ga0495625_0088733 3300046660 Bacteria 2141
446 Ga0495669_0000172 3300046684 Bacteria 40888
447 Ga0495669_0019239 3300046684 Bacteria 2946
448 Ga0495669_0129071 3300046684 Bacteria 1189
449 Ga0495669_0263852 3300046684 Bacteria 828
450 Ga0495613_0002308 3300046689 Bacteria 14452
451 Ga0495624_0306614 3300046690 Bacteria 957
452 Ga0495670_0163271 3300046691 Bacteria 1171
453 Ga0495671_0062855 3300046692 Bacteria 1829
454 Ga0495589_0013489 3300046794 Bacteria 4215
455 Ga0495660_0024954 3300046810 Bacteria 3399
456 Ga0495660_0145642 3300046810 Bacteria 1174
457 Ga0495636_0028685 3300047318 Bacteria 2271
458 Ga0495674_0127193 3300047319 Bacteria 2149
459 Ga0495672_0001176 3300047320 Bacteria 26541
460 Ga0495672_0052681 3300047320 Bacteria 2389
461 Ga0495679_011751 3300047446 Bacteria 3364
462 Ga0495673_0000139 3300047469 Bacteria 130652
463 Ga0495673_0000305 3300047469 Bacteria 65300
464 Ga0495673_0001209 3300047469 Bacteria 21505
465 Ga0495681_0086568 3300047470 Bacteria 1390
466 Ga0495686_0000870 3300047472 Bacteria 38471
467 Ga0495686_0004871 3300047472 Bacteria 10826
468 Ga0495686_0006911 3300047472 Bacteria 8585
469 Ga0495686_0016070 3300047472 Bacteria 5087
470 Ga0495686_0033861 3300047472 Bacteria 3294
471 Ga0495686_0181389 3300047472 Bacteria 1219
472 Ga0495593_0061590 3300047673 Bacteria 1962
473 Ga0495615_0000090 3300048090 Bacteria 26651
474 Ga0495626_0001824 3300048091 Bacteria 16051
475 Ga0496102_0069444 3300048905 Bacteria 3234
476 Ga0496102_0082361 3300048905 Bacteria 2967
477 Ga0496102_0202463 3300048905 Bacteria 1871
478 Ga0496103_0029588 3300048906 Bacteria 3330
479 Ga0496103_0041410 3300048906 Bacteria 2832
480 Ga0496104_0054442 3300048907 Bacteria 3781
481 Ga0496105_0000215 3300048908 Bacteria 38742
482 Ga0496106_0069223 3300048909 Bacteria 2693
483 Ga0496106_0168234 3300048909 Bacteria 1736
484 Ga0496107_0000050 3300048910 Bacteria 63795
485 Ga0496108_0076213 3300048911 Bacteria 2834
486 Ga0496109_0010443 3300048912 Bacteria 7934
487 Ga0496110_0154844 3300048913 Bacteria 2076
488 Ga0496112_0032793 3300048915 Bacteria 5043
489 Ga0496112_0257185 3300048915 Bacteria 1696
490 Ga0496112_0257829 3300048915 Bacteria 1694
491 Ga0496113_0078572 3300048916 Bacteria 2525
492 Ga0496114_0320881 3300048917 Bacteria 1369
493 Ga0496115_0001599 3300048918 Bacteria 16277
494 Ga0496115_0001643 3300048918 Bacteria 16076
495 Ga0496115_0018435 3300048918 Bacteria 5359
496 Ga0496115_0143039 3300048918 Bacteria 1973
497 Ga0496116_0140391 3300048919 Bacteria 1360
498 Ga0496117_0011327 3300048920 Bacteria 7994
499 Ga0496117_0047823 3300048920 Bacteria 3063
500 Ga0496118_0128666 3300048921 Bacteria 1631
501 Ga0496119_0020652 3300048922 Bacteria 4794
502 Ga0496119_0149066 3300048922 Bacteria 1255
503 Ga0496120_0116948 3300048923 Bacteria 1384
504 Ga0496121_0000017 3300048924 Bacteria 546415
505 Ga0496121_0001187 3300048924 Bacteria 45612
506 Ga0496121_0007757 3300048924 Bacteria 12858
507 Ga0496121_0019233 3300048924 Bacteria 6840
508 Ga0496121_0087699 3300048924 Bacteria 2442
509 Ga0496121_0141393 3300048924 Bacteria 1785
510 Ga0496122_0154135 3300048925 Bacteria 1412
511 Ga0496123_0006320 3300048926 Bacteria 11511
512 Ga0496124_0015996 3300048927 Bacteria 7160
513 Ga0496124_0036531 3300048927 Bacteria 4284
514 Ga0496125_0012540 3300048928 Bacteria 8407
515 Ga0496125_0037095 3300048928 Bacteria 4242
516 Ga0496126_0009455 3300048929 Bacteria 10345
517 Ga0495678_001134 3300049459 Bacteria 22127
518 Ga0501032_0033635 3300049569 Bacteria 3512
519 Ga0501033_0029990 3300049570 Bacteria 4088
520 Ga0501037_0158589 3300049573 Bacteria 1614
521 Ga0501037_0197165 3300049573 Bacteria 1424
522 Ga0501047_0071484 3300049581 Bacteria 3340
523 Ga0501047_0101781 3300049581 Bacteria 2752
524 Ga0501047_0225927 3300049581 Bacteria 1727
525 Ga0501257_016058 3300049686 Bacteria 1733
526 Ga0501035_0180472 3300049822 Bacteria 1819
527 Ga0501044_0004038 3300049823 Bacteria 16462
528 Ga0501044_0221897 3300049823 Bacteria 1841
529 nmdc:mga03683_229_c1 3300050489 Bacteria 17517
530 nmdc:mga00v17_801_c1 3300050491 Bacteria 17106
531 nmdc:mga0k408_226329_c1 3300050493 Bacteria 1117
532 nmdc:mga0k408_5702_c1 3300050493 Bacteria 6623
533 nmdc:mga0k408_68244_c1 3300050493 Bacteria 2074
534 nmdc:mga06z11_3771_c1 3300050494 Bacteria 5895
535 nmdc:mga06z11_6554_c1 3300050494 Bacteria 4748
536 nmdc:mga04h51_55743_c1 3300050495 Bacteria 1340
537 nmdc:mga07m45_10034_c1 3300050496 Bacteria 4930
538 nmdc:mga07m45_22038_c1 3300050496 Bacteria 3476
539 nmdc:mga07m45_33_c1 3300050496 Bacteria 75596
540 nmdc:mga07m45_76366_c1 3300050496 Bacteria 1910
541 nmdc:mga07m45_85846_c1 3300050496 Bacteria 1800
542 nmdc:mga0sz30_11763_c1 3300050516 Bacteria 3388
543 nmdc:mga0sz30_161874_c1 3300050516 Bacteria 991
544 nmdc:mga0sz30_3042_c1 3300050516 Bacteria 6003
545 nmdc:mga0sz30_86882_c1 3300050516 Bacteria 1358
546 nmdc:mga0sz30_9117_c1 3300050516 Bacteria 3764
547 Ga0500635_0000082 3300053080 Bacteria 62117
548 Ga0500578_0000023 3300053086 Bacteria 153470
549 Ga0500643_000423 3300053087 Bacteria 32227
550 Ga0500643_007099 3300053087 Bacteria 4583
551 Ga0500643_018127 3300053087 Bacteria 2343
552 Ga0500643_028141 3300053087 Bacteria 1740
553 Ga0500644_0000005 3300053088 Bacteria 164966
554 Ga0500651_0002702 3300053093 Bacteria 9453
555 Ga0500566_0015011 3300053094 Bacteria 4548
556 Ga0500641_0000558 3300053096 Bacteria 13473
557 Ga0500555_001298 3300053103 Bacteria 7915
558 Ga0500556_0001541 3300053104 Bacteria 9422
559 Ga0500556_0015121 3300053104 Bacteria 2373
560 Ga0500556_0126815 3300053104 Bacteria 999
561 Ga0500562_000242 3300053108 Bacteria 14220
562 Ga0500562_000372 3300053108 Bacteria 10836
563 Ga0500562_001156 3300053108 Bacteria 6499
564 Ga0500562_011937 3300053108 Bacteria 2205
565 Ga0500569_000868 3300053109 Bacteria 5375
566 Ga0500572_001158 3300053111 Bacteria 7619
567 Ga0500593_102690 3300053117 Bacteria 1190
568 Ga0500594_0000078 3300053118 Bacteria 30653
569 Ga0500595_002406 3300053119 Bacteria 9340
570 Ga0500607_000098 3300053121 Bacteria 65919
571 Ga0500608_000013 3300053122 Bacteria 86291
572 Ga0500608_000054 3300053122 Bacteria 51067
573 Ga0500614_001498 3300053123 Bacteria 5563
574 Ga0500614_055042 3300053123 Bacteria 1055
575 Ga0500618_000195 3300053125 Bacteria 49434
576 Ga0500618_000803 3300053125 Bacteria 17291
577 Ga0500642_0071546 3300053130 Bacteria 1579
578 Ga0500652_101490 3300053131 Bacteria 1203
579 Ga0500658_0002785 3300053134 Bacteria 6708
580 Ga0500559_0000002 3300053136 Bacteria 262002
581 Ga0500559_0000024 3300053136 Bacteria 126300
582 Ga0500559_0006094 3300053136 Bacteria 5463
583 Ga0500559_0010593 3300053136 Bacteria 3953
584 Ga0500559_0013755 3300053136 Bacteria 3423
585 Ga0500559_0088361 3300053136 Bacteria 1416
586 Ga0500564_000100 3300053138 Bacteria 22073
587 Ga0500564_186289 3300053138 Bacteria 862
588 Ga0500573_0097357 3300053140 Bacteria 1658
589 Ga0500577_0001328 3300053142 Bacteria 6333
590 Ga0500590_004891 3300053148 Bacteria 6395
591 Ga0500590_107421 3300053148 Bacteria 1330
592 Ga0500604_0064831 3300053151 Bacteria 1155
593 Ga0500616_0012850 3300053153 Bacteria 4883
594 Ga0500616_0029837 3300053153 Bacteria 2998
595 Ga0500619_021926 3300053154 Bacteria 1847
596 Ga0500622_0001014 3300053156 Bacteria 23572
597 Ga0500622_0002724 3300053156 Bacteria 12478
598 Ga0500622_0003809 3300053156 Bacteria 9825
599 Ga0500622_0007061 3300053156 Bacteria 6421
600 Ga0500622_0007316 3300053156 Bacteria 6286
601 Ga0500622_0007734 3300053156 Bacteria 6067
602 Ga0500622_0106528 3300053156 Bacteria 1374
603 Ga0500624_024419 3300053157 Bacteria 998
604 Ga0500627_0005963 3300053158 Bacteria 4097
605 Ga0500638_088017 3300053162 Bacteria 1466
606 Ga0500639_123533 3300053163 Bacteria 1239
607 Ga0500636_0024519 3300053177 Bacteria 3568
608 Ga0500636_0036828 3300053177 Bacteria 2895
609 Ga0500636_0044953 3300053177 Bacteria 2605
610 Ga0500625_000002 3300053729 Bacteria 371909
611 Ga0500645_000594 3300053730 Bacteria 23306
612 Ga0500645_000819 3300053730 Bacteria 18532
613 Ga0500645_009486 3300053730 Bacteria 3267
614 Ga0500645_037537 3300053730 Bacteria 1438
615 Ga0500609_000114 3300053731 Bacteria 10626
616 Ga0500596_000086 3300053735 Bacteria 12601

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0127790 Ga0395905_0127790_1736_2359 207
2 3300046684 Ga0495669_0263852 Ga0495669_0263852_143_802 219
3 3300005329 Ga0070683_100473442 Ga0070683_1004734422 229
4 3300005719 Ga0068861_100381852 Ga0068861_1003818521 232
5 3300010375 Ga0105239_11252061 Ga0105239_112520611 232
6 3300026118 Ga0207675_100220553 Ga0207675_1002205531 232
7 3300033180 Ga0307510_10131873 Ga0307510_101318733 232
8 3300048924 Ga0496121_0087699 Ga0496121_0087699_868_1578 232
9 3300053104 Ga0500556_0126815 Ga0500556_0126815_67_777 232
10 3300053131 Ga0500652_101490 Ga0500652_101490_292_1002 232
11 3300053136 Ga0500559_0000002 Ga0500559_0000002_133822_134592 236
12 3300053136 Ga0500559_0088361 Ga0500559_0088361_264_1034 236
13 3300005617 Ga0068859_100011775 Ga0068859_1000117755 237
14 3300009553 Ga0105249_10008807 Ga0105249_100088075 237
15 3300031456 Ga0307513_10010089 Ga0307513_100100896 237
16 3300048924 Ga0496121_0000017 Ga0496121_0000017_120482_121264 237
17 iso_pu_bacteria 2510917021 2511128981 238
18 3300005563 Ga0068855_100010807 Ga0068855_1000108079 239
19 3300025949 Ga0207667_10006755 Ga0207667_100067554 239
20 3300026142 Ga0207698_10122133 Ga0207698_101221333 239
21 3300053125 Ga0500618_000803 Ga0500618_000803_14140_14928 239
22 3300005578 Ga0068854_100010741 Ga0068854_1000107413 240
23 3300053140 Ga0500573_0097357 Ga0500573_0097357_61_846 240
24 iso_pu_bacteria 2585428106 2587916052 240
25 iso_pu_bacteria 2643221640 2644224423 240
26 iso_pu_bacteria 2643221642 2644234640 240
27 iso_pu_bacteria 2857504554 2857507381 240
28 iso_pu_bacteria 2884960567 2884962804 240
29 iso_pu_bacteria 2928531327 2928532684 240
30 3300003791 Ga0055530_10001171 Ga0055530_100011719 241
31 3300003794 Ga0055531_10000161 Ga0055531_1000016116 241
32 3300025298 Ga0209050_1000014 Ga0209050_1000014489 241
33 3300025304 Ga0209257_1000019 Ga0209257_1000019203 241
34 3300041410 Ga0439461_0000282 Ga0439461_0000282_175_954 241
35 3300041413 Ga0439465_0004149 Ga0439465_0004149_783_1562 241
36 3300041997 Ga0439431_0002774 Ga0439431_0002774_1145_1924 241
37 3300042002 Ga0439442_009911 Ga0439442_009911_231_1010 241
38 3300042004 Ga0439445_0004449 Ga0439445_0004449_214_993 241
39 3300042006 Ga0439432_001007 Ga0439432_001007_1714_2493 241
40 3300042010 Ga0439452_022882 Ga0439452_022882_237_1016 241
41 3300042015 Ga0439462_0012207 Ga0439462_0012207_1352_2131 241
42 3300042435 Ga0439434_0018068 Ga0439434_0018068_1297_2076 241
43 3300005331 Ga0070670_100312032 Ga0070670_1003120321 242
44 3300005367 Ga0070667_100006029 Ga0070667_1000060299 242
45 3300005539 Ga0068853_100270725 Ga0068853_1002707251 242
46 3300005841 Ga0068863_100000688 Ga0068863_1000006885 242
47 3300005843 Ga0068860_100000108 Ga0068860_10000010849 242
48 3300005844 Ga0068862_100010294 Ga0068862_1000102945 242
49 3300006946 Ga0079104_1018642 Ga0079104_10186423 242
50 3300026088 Ga0207641_10000204 Ga0207641_1000020448 242
51 3300027111 Ga0209281_1010105 Ga0209281_10101053 242
52 3300028380 Ga0268265_10004204 Ga0268265_100042047 242
53 3300028381 Ga0268264_10000126 Ga0268264_1000012649 242
54 3300031090 Ga0265760_10019481 Ga0265760_100194813 242
55 3300046500 Ga0495596_0000579 Ga0495596_0000579_14401_15213 242
56 3300046506 Ga0495583_0085426 Ga0495583_0085426_320_1123 242
57 3300046507 Ga0495606_0022189 Ga0495606_0022189_3648_4460 242
58 3300046512 Ga0495610_0005829 Ga0495610_0005829_7686_8498 242
59 3300046522 Ga0495643_0000027 Ga0495643_0000027_197449_198261 242
60 3300046522 Ga0495643_0033953 Ga0495643_0033953_1051_1863 242
61 3300046538 Ga0495609_0001808 Ga0495609_0001808_5919_6731 242
62 3300046558 Ga0495633_0064066 Ga0495633_0064066_218_1024 242
63 3300046616 Ga0495668_0051644 Ga0495668_0051644_940_1752 242
64 3300046692 Ga0495671_0062855 Ga0495671_0062855_883_1695 242
65 3300047470 Ga0495681_0086568 Ga0495681_0086568_77_889 242
66 3300048905 Ga0496102_0202463 Ga0496102_0202463_503_1315 242
67 3300048906 Ga0496103_0029588 Ga0496103_0029588_1653_2465 242
68 3300048907 Ga0496104_0054442 Ga0496104_0054442_1058_1870 242
69 3300048908 Ga0496105_0000215 Ga0496105_0000215_24546_25358 242
70 3300048922 Ga0496119_0149066 Ga0496119_0149066_73_885 242
71 3300048924 Ga0496121_0141393 Ga0496121_0141393_375_1187 242
72 3300053156 Ga0500622_0001014 Ga0500622_0001014_7633_8436 242
73 iso_pu_bacteria 2582581279 2585146072 242
74 iso_pu_bacteria 2739367664 2739651930 242
75 iso_pu_bacteria 2739367865 2740030404 242
76 3300006353 Ga0075370_10003860 Ga0075370_100038605 243
77 3300006353 Ga0075370_10104602 Ga0075370_101046022 243
78 3300032005 Ga0307411_10368543 Ga0307411_103685432 243
79 3300046460 Ga0495638_0045573 Ga0495638_0045573_1431_2237 243
80 3300046512 Ga0495610_0004486 Ga0495610_0004486_733_1533 243
81 3300048090 Ga0495615_0000090 Ga0495615_0000090_18929_19747 243
82 3300048091 Ga0495626_0001824 Ga0495626_0001824_3440_4240 243
83 3300048925 Ga0496122_0154135 Ga0496122_0154135_555_1373 243
84 3300048926 Ga0496123_0006320 Ga0496123_0006320_3863_4681 243
85 3300048927 Ga0496124_0036531 Ga0496124_0036531_1260_2078 243
86 3300049569 Ga0501032_0033635 Ga0501032_0033635_845_1576 243
87 3300050496 nmdc:mga07m45_10034_c1 nmdc:mga07m45_10034_c1_4079_4885 243
88 3300050496 nmdc:mga07m45_85846_c1 nmdc:mga07m45_85846_c1_207_1013 243
89 3300053087 Ga0500643_007099 Ga0500643_007099_68_874 243
90 iso_pu_bacteria 2791355048 2792463533 243
91 iso_pu_bacteria 2843744320 2843748325 243
92 iso_pu_bacteria 2849560528 2849564776 243
93 iso_pu_bacteria 2849573788 2849576979 243
94 iso_pu_bacteria 2851153111 2851155165 243
95 iso_pu_bacteria 2898329390 2898329713 243
96 3300003781 Ga0055536_1002622 Ga0055536_10026225 244
97 3300003781 Ga0055536_1004003 Ga0055536_10040035 244
98 3300003791 Ga0055530_10003041 Ga0055530_100030415 244
99 3300003791 Ga0055530_10004969 Ga0055530_100049695 244
100 3300003794 Ga0055531_10006606 Ga0055531_100066064 244
101 3300006186 Ga0075369_10001685 Ga0075369_100016858 244
102 3300006195 Ga0075366_10051741 Ga0075366_100517413 244
103 3300006353 Ga0075370_10086786 Ga0075370_100867863 244
104 3300013102 Ga0157371_10039533 Ga0157371_100395332 244
105 3300025292 Ga0209676_1000067 Ga0209676_1000067222 244
106 3300025292 Ga0209676_1000379 Ga0209676_100037941 244
107 3300025298 Ga0209050_1000154 Ga0209050_100015441 244
108 3300025298 Ga0209050_1000449 Ga0209050_100044937 244
109 3300025299 Ga0209256_1009314 Ga0209256_10093142 244
110 3300025303 Ga0209051_1001178 Ga0209051_10011782 244
111 3300025304 Ga0209257_1000203 Ga0209257_100020398 244
112 3300025304 Ga0209257_1010055 Ga0209257_10100552 244
113 3300025986 Ga0207658_10125531 Ga0207658_101255313 244
114 3300027378 Ga0209981_1002428 Ga0209981_10024282 244
115 3300027543 Ga0209999_1000319 Ga0209999_10003198 244
116 3300027665 Ga0209983_1001813 Ga0209983_10018133 244
117 3300031456 Ga0307513_10041492 Ga0307513_100414923 244
118 3300046460 Ga0495638_0131225 Ga0495638_0131225_666_1400 244
119 3300046542 Ga0495597_0079102 Ga0495597_0079102_204_938 244
120 3300046616 Ga0495668_0000042 Ga0495668_0000042_94257_94991 244
121 3300046616 Ga0495668_0015614 Ga0495668_0015614_2100_2834 244
122 3300046660 Ga0495625_0020928 Ga0495625_0020928_3758_4492 244
123 3300047472 Ga0495686_0016070 Ga0495686_0016070_1455_2189 244
124 3300048927 Ga0496124_0015996 Ga0496124_0015996_5645_6379 244
125 3300048928 Ga0496125_0012540 Ga0496125_0012540_1390_2124 244
126 3300048929 Ga0496126_0009455 Ga0496126_0009455_4230_4964 244
127 3300049573 Ga0501037_0197165 Ga0501037_0197165_298_1101 244
128 3300050493 nmdc:mga0k408_68244_c1 nmdc:mga0k408_68244_c1_1089_1823 244
129 3300050496 nmdc:mga07m45_76366_c1 nmdc:mga07m45_76366_c1_901_1635 244
130 3300050516 nmdc:mga0sz30_3042_c1 nmdc:mga0sz30_3042_c1_190_924 244
131 3300053087 Ga0500643_000423 Ga0500643_000423_25363_26106 244
132 3300053096 Ga0500641_0000558 Ga0500641_0000558_9826_10569 244
133 3300053104 Ga0500556_0015121 Ga0500556_0015121_547_1290 244
134 3300053108 Ga0500562_000242 Ga0500562_000242_2999_3742 244
135 3300053108 Ga0500562_011937 Ga0500562_011937_1432_2175 244
136 3300053117 Ga0500593_102690 Ga0500593_102690_250_993 244
137 3300053121 Ga0500607_000098 Ga0500607_000098_5795_6601 244
138 3300053122 Ga0500608_000013 Ga0500608_000013_47987_48721 244
139 3300053130 Ga0500642_0071546 Ga0500642_0071546_743_1477 244
140 3300053136 Ga0500559_0006094 Ga0500559_0006094_4397_5131 244
141 3300053153 Ga0500616_0012850 Ga0500616_0012850_3402_4145 244
142 3300053153 Ga0500616_0029837 Ga0500616_0029837_1995_2738 244
143 3300053156 Ga0500622_0003809 Ga0500622_0003809_2045_2779 244
144 3300053156 Ga0500622_0007061 Ga0500622_0007061_3663_4406 244
145 3300053156 Ga0500622_0007316 Ga0500622_0007316_377_1120 244
146 3300053156 Ga0500622_0106528 Ga0500622_0106528_276_1010 244
147 3300053730 Ga0500645_000594 Ga0500645_000594_11683_12426 244
148 3300053730 Ga0500645_000819 Ga0500645_000819_5020_5763 244
149 3300003791 Ga0055530_10000076 Ga0055530_1000007680 245
150 3300003791 Ga0055530_10000188 Ga0055530_1000018838 245
151 3300003794 Ga0055531_10005752 Ga0055531_100057523 245
152 3300004625 Ga0055543_1010540 Ga0055543_10105402 245
153 3300005262 Ga0065165_1000029 Ga0065165_1000029105 245
154 3300005335 Ga0070666_10201248 Ga0070666_102012482 245
155 3300005842 Ga0068858_100323098 Ga0068858_1003230981 245
156 3300006042 Ga0075368_10002174 Ga0075368_100021745 245
157 3300006051 Ga0075364_10000457 Ga0075364_1000045711 245
158 3300006178 Ga0075367_10001510 Ga0075367_100015105 245
159 3300006186 Ga0075369_10060100 Ga0075369_100601003 245
160 3300006195 Ga0075366_10017086 Ga0075366_100170863 245
161 3300006353 Ga0075370_10305532 Ga0075370_103055321 245
162 3300009553 Ga0105249_10877985 Ga0105249_108779851 245
163 3300021384 Ga0213876_10108027 Ga0213876_101080272 245
164 3300025250 Ga0209026_1005037 Ga0209026_10050374 245
165 3300025297 Ga0209758_1002875 Ga0209758_100287519 245
166 3300025298 Ga0209050_1000031 Ga0209050_1000031294 245
167 3300025304 Ga0209257_1000073 Ga0209257_100007386 245
168 3300025304 Ga0209257_1000966 Ga0209257_100096626 245
169 3300025903 Ga0207680_10203005 Ga0207680_102030052 245
170 3300026035 Ga0207703_10547172 Ga0207703_105471722 245
171 3300027866 Ga0209813_10004549 Ga0209813_100045492 245
172 3300028380 Ga0268265_10125789 Ga0268265_101257892 245
173 3300032004 Ga0307414_10076931 Ga0307414_100769312 245
174 3300033180 Ga0307510_10143225 Ga0307510_101432253 245
175 3300039437 Ga0436365_0005985 Ga0436365_0005985_533_1270 245
176 3300044693 Ga0466961_0111950 Ga0466961_0111950_560_1306 245
177 3300044712 Ga0453684_0285383 Ga0453684_0285383_746_1483 245
178 3300046616 Ga0495668_0074411 Ga0495668_0074411_23_760 245
179 3300047318 Ga0495636_0028685 Ga0495636_0028685_206_955 245
180 3300047472 Ga0495686_0006911 Ga0495686_0006911_4220_4957 245
181 3300049570 Ga0501033_0029990 Ga0501033_0029990_2879_3622 245
182 3300049573 Ga0501037_0158589 Ga0501037_0158589_208_951 245
183 3300049581 Ga0501047_0071484 Ga0501047_0071484_1994_2737 245
184 3300049822 Ga0501035_0180472 Ga0501035_0180472_515_1258 245
185 3300049823 Ga0501044_0004038 Ga0501044_0004038_4894_5637 245
186 3300050491 nmdc:mga00v17_801_c1 nmdc:mga00v17_801_c1_6420_7163 245
187 3300050493 nmdc:mga0k408_5702_c1 nmdc:mga0k408_5702_c1_3416_4159 245
188 3300050494 nmdc:mga06z11_3771_c1 nmdc:mga06z11_3771_c1_1594_2337 245
189 3300050496 nmdc:mga07m45_22038_c1 nmdc:mga07m45_22038_c1_355_1098 245
190 3300050516 nmdc:mga0sz30_11763_c1 nmdc:mga0sz30_11763_c1_125_868 245
191 3300053730 Ga0500645_009486 Ga0500645_009486_1423_2160 245
192 3300005262 Ga0065165_1031169 Ga0065165_10311693 246
193 3300005327 Ga0070658_10135198 Ga0070658_101351982 246
194 3300005331 Ga0070670_100000050 Ga0070670_100000050124 246
195 3300005331 Ga0070670_100117301 Ga0070670_1001173011 246
196 3300005335 Ga0070666_10047259 Ga0070666_100472591 246
197 3300005336 Ga0070680_100026527 Ga0070680_1000265273 246
198 3300005336 Ga0070680_100131236 Ga0070680_1001312362 246
199 3300005339 Ga0070660_100021475 Ga0070660_1000214756 246
200 3300005339 Ga0070660_100126465 Ga0070660_1001264651 246
201 3300005341 Ga0070691_10024488 Ga0070691_100244883 246
202 3300005347 Ga0070668_100001178 Ga0070668_1000011789 246
203 3300005347 Ga0070668_100002233 Ga0070668_1000022333 246
204 3300005347 Ga0070668_100010330 Ga0070668_1000103303 246
205 3300005347 Ga0070668_100022775 Ga0070668_1000227753 246
206 3300005347 Ga0070668_100206646 Ga0070668_1002066463 246
207 3300005355 Ga0070671_100000153 Ga0070671_10000015337 246
208 3300005355 Ga0070671_100168754 Ga0070671_1001687543 246
209 3300005366 Ga0070659_100000040 Ga0070659_10000004076 246
210 3300005366 Ga0070659_100023337 Ga0070659_1000233376 246
211 3300005367 Ga0070667_100000299 Ga0070667_10000029947 246
212 3300005367 Ga0070667_100004014 Ga0070667_10000401411 246
213 3300005367 Ga0070667_100019418 Ga0070667_1000194183 246
214 3300005367 Ga0070667_100106034 Ga0070667_1001060342 246
215 3300005458 Ga0070681_10351475 Ga0070681_103514751 246
216 3300005530 Ga0070679_100107588 Ga0070679_1001075882 246
217 3300005539 Ga0068853_100124440 Ga0068853_1001244401 246
218 3300005539 Ga0068853_100376213 Ga0068853_1003762132 246
219 3300005548 Ga0070665_100000248 Ga0070665_10000024881 246
220 3300005548 Ga0070665_100000867 Ga0070665_10000086715 246
221 3300005548 Ga0070665_100001434 Ga0070665_1000014343 246
222 3300005548 Ga0070665_100338150 Ga0070665_1003381503 246
223 3300005563 Ga0068855_100098172 Ga0068855_1000981724 246
224 3300005563 Ga0068855_100396913 Ga0068855_1003969131 246
225 3300005614 Ga0068856_100199046 Ga0068856_1001990462 246
226 3300005614 Ga0068856_100365449 Ga0068856_1003654492 246
227 3300005617 Ga0068859_100000744 Ga0068859_10000074429 246
228 3300005617 Ga0068859_100077982 Ga0068859_1000779824 246
229 3300005617 Ga0068859_100149996 Ga0068859_1001499962 246
230 3300005617 Ga0068859_100749565 Ga0068859_1007495652 246
231 3300005618 Ga0068864_100000238 Ga0068864_10000023811 246
232 3300005618 Ga0068864_100001411 Ga0068864_1000014115 246
233 3300005618 Ga0068864_100100302 Ga0068864_1001003023 246
234 3300005841 Ga0068863_100002323 Ga0068863_10000232312 246
235 3300005841 Ga0068863_100003091 Ga0068863_1000030912 246
236 3300005841 Ga0068863_100006056 Ga0068863_10000605612 246
237 3300005842 Ga0068858_100000129 Ga0068858_10000012953 246
238 3300005842 Ga0068858_100001538 Ga0068858_1000015387 246
239 3300005843 Ga0068860_100000517 Ga0068860_10000051752 246
240 3300005843 Ga0068860_100003590 Ga0068860_1000035908 246
241 3300005843 Ga0068860_100161217 Ga0068860_1001612171 246
242 3300005844 Ga0068862_100000786 Ga0068862_10000078624 246
243 3300005844 Ga0068862_100002133 Ga0068862_1000021339 246
244 3300005844 Ga0068862_100009671 Ga0068862_1000096713 246
245 3300005844 Ga0068862_100011439 Ga0068862_1000114392 246
246 3300005844 Ga0068862_100239704 Ga0068862_1002397042 246
247 3300005844 Ga0068862_100290192 Ga0068862_1002901922 246
248 3300006048 Ga0075363_100011199 Ga0075363_1000111996 246
249 3300006048 Ga0075363_100102825 Ga0075363_1001028252 246
250 3300006051 Ga0075364_10196616 Ga0075364_101966162 246
251 3300006177 Ga0075362_10019261 Ga0075362_100192612 246
252 3300006178 Ga0075367_10087211 Ga0075367_100872111 246
253 3300006186 Ga0075369_10043660 Ga0075369_100436602 246
254 3300006195 Ga0075366_10174596 Ga0075366_101745961 246
255 3300006353 Ga0075370_10050797 Ga0075370_100507973 246
256 3300006931 Ga0097620_100000744 Ga0097620_10000074429 246
257 3300006931 Ga0097620_100077982 Ga0097620_1000779824 246
258 3300006931 Ga0097620_100150003 Ga0097620_1001500032 246
259 3300006931 Ga0097620_100749558 Ga0097620_1007495582 246
260 3300006946 Ga0079104_1032186 Ga0079104_10321862 246
261 3300009092 Ga0105250_10097249 Ga0105250_100972492 246
262 3300009093 Ga0105240_10000522 Ga0105240_1000052229 246
263 3300009093 Ga0105240_10024604 Ga0105240_100246049 246
264 3300009093 Ga0105240_10034503 Ga0105240_100345036 246
265 3300009093 Ga0105240_10077997 Ga0105240_100779973 246
266 3300009093 Ga0105240_10135159 Ga0105240_101351594 246
267 3300009093 Ga0105240_10319924 Ga0105240_103199243 246
268 3300009093 Ga0105240_10576444 Ga0105240_105764442 246
269 3300009101 Ga0105247_10032924 Ga0105247_100329243 246
270 3300009174 Ga0105241_10170532 Ga0105241_101705323 246
271 3300009177 Ga0105248_10002783 Ga0105248_1000278310 246
272 3300009177 Ga0105248_10056366 Ga0105248_100563663 246
273 3300009177 Ga0105248_10134183 Ga0105248_101341833 246
274 3300009177 Ga0105248_10687095 Ga0105248_106870952 246
275 3300009545 Ga0105237_10108394 Ga0105237_101083942 246
276 3300009551 Ga0105238_10005659 Ga0105238_1000565913 246
277 3300009551 Ga0105238_10013681 Ga0105238_100136817 246
278 3300009551 Ga0105238_10042636 Ga0105238_100426362 246
279 3300009553 Ga0105249_10000356 Ga0105249_1000035637 246
280 3300009553 Ga0105249_11017067 Ga0105249_110170672 246
281 3300010375 Ga0105239_10092191 Ga0105239_100921913 246
282 3300010375 Ga0105239_10127187 Ga0105239_101271874 246
283 3300013105 Ga0157369_10338253 Ga0157369_103382532 246
284 3300013306 Ga0163162_10012291 Ga0163162_100122912 246
285 3300013306 Ga0163162_10120960 Ga0163162_101209603 246
286 3300013306 Ga0163162_10387584 Ga0163162_103875842 246
287 3300013307 Ga0157372_10193139 Ga0157372_101931392 246
288 3300014325 Ga0163163_10001756 Ga0163163_1000175610 246
289 3300014325 Ga0163163_10044363 Ga0163163_100443636 246
290 3300014325 Ga0163163_10764405 Ga0163163_107644051 246
291 3300014326 Ga0157380_10738414 Ga0157380_107384142 246
292 3300014968 Ga0157379_10001581 Ga0157379_1000158110 246
293 3300014968 Ga0157379_10006140 Ga0157379_100061408 246
294 3300014968 Ga0157379_10037449 Ga0157379_100374492 246
295 3300014968 Ga0157379_10268704 Ga0157379_102687042 246
296 3300025315 Ga0207697_10116685 Ga0207697_101166851 246
297 3300025900 Ga0207710_10091707 Ga0207710_100917071 246
298 3300025903 Ga0207680_10231325 Ga0207680_102313252 246
299 3300025903 Ga0207680_10338873 Ga0207680_103388731 246
300 3300025909 Ga0207705_10013624 Ga0207705_100136242 246
301 3300025909 Ga0207705_10082788 Ga0207705_100827883 246
302 3300025912 Ga0207707_10122678 Ga0207707_101226783 246
303 3300025912 Ga0207707_10455592 Ga0207707_104555921 246
304 3300025913 Ga0207695_10000987 Ga0207695_1000098718 246
305 3300025913 Ga0207695_10001134 Ga0207695_1000113429 246
306 3300025913 Ga0207695_10043719 Ga0207695_100437193 246
307 3300025913 Ga0207695_10044496 Ga0207695_100444965 246
308 3300025913 Ga0207695_10113133 Ga0207695_101131334 246
309 3300025913 Ga0207695_10184169 Ga0207695_101841692 246
310 3300025914 Ga0207671_10215829 Ga0207671_102158291 246
311 3300025917 Ga0207660_10004369 Ga0207660_100043695 246
312 3300025917 Ga0207660_10077458 Ga0207660_100774582 246
313 3300025919 Ga0207657_10005615 Ga0207657_1000561510 246
314 3300025919 Ga0207657_10494347 Ga0207657_104943472 246
315 3300025921 Ga0207652_10222722 Ga0207652_102227222 246
316 3300025923 Ga0207681_10049084 Ga0207681_100490841 246
317 3300025924 Ga0207694_10027260 Ga0207694_100272603 246
318 3300025924 Ga0207694_10258044 Ga0207694_102580442 246
319 3300025924 Ga0207694_10393472 Ga0207694_103934722 246
320 3300025925 Ga0207650_10000133 Ga0207650_1000013381 246
321 3300025925 Ga0207650_10261930 Ga0207650_102619302 246
322 3300025925 Ga0207650_10309498 Ga0207650_103094981 246
323 3300025927 Ga0207687_10734869 Ga0207687_107348691 246
324 3300025931 Ga0207644_10005355 Ga0207644_100053554 246
325 3300025931 Ga0207644_10122237 Ga0207644_101222373 246
326 3300025932 Ga0207690_10000134 Ga0207690_1000013427 246
327 3300025932 Ga0207690_10098748 Ga0207690_100987482 246
328 3300025933 Ga0207706_10589070 Ga0207706_105890702 246
329 3300025936 Ga0207670_10420518 Ga0207670_104205181 246
330 3300025941 Ga0207711_10004518 Ga0207711_1000451810 246
331 3300025941 Ga0207711_10010448 Ga0207711_1001044810 246
332 3300025941 Ga0207711_10023337 Ga0207711_100233372 246
333 3300025941 Ga0207711_10068717 Ga0207711_100687172 246
334 3300025941 Ga0207711_10097346 Ga0207711_100973461 246
335 3300025941 Ga0207711_10178550 Ga0207711_101785502 246
336 3300025949 Ga0207667_10041133 Ga0207667_100411334 246
337 3300025961 Ga0207712_10000790 Ga0207712_1000079019 246
338 3300025961 Ga0207712_10107914 Ga0207712_101079142 246
339 3300025972 Ga0207668_10000016 Ga0207668_10000016141 246
340 3300025972 Ga0207668_10000662 Ga0207668_1000066212 246
341 3300025972 Ga0207668_10007795 Ga0207668_100077958 246
342 3300025972 Ga0207668_10015854 Ga0207668_100158543 246
343 3300025972 Ga0207668_10027975 Ga0207668_100279755 246
344 3300025972 Ga0207668_10030241 Ga0207668_100302413 246
345 3300025986 Ga0207658_10000931 Ga0207658_1000093111 246
346 3300025986 Ga0207658_10013584 Ga0207658_100135844 246
347 3300025986 Ga0207658_10015286 Ga0207658_100152866 246
348 3300026035 Ga0207703_10000086 Ga0207703_1000008617 246
349 3300026035 Ga0207703_10003556 Ga0207703_100035564 246
350 3300026035 Ga0207703_10010955 Ga0207703_100109553 246
351 3300026041 Ga0207639_10022556 Ga0207639_100225562 246
352 3300026041 Ga0207639_10110891 Ga0207639_101108913 246
353 3300026078 Ga0207702_10178850 Ga0207702_101788503 246
354 3300026088 Ga0207641_10002389 Ga0207641_100023892 246
355 3300026088 Ga0207641_10003109 Ga0207641_100031099 246
356 3300026088 Ga0207641_10005335 Ga0207641_100053355 246
357 3300026088 Ga0207641_10291200 Ga0207641_102912002 246
358 3300026088 Ga0207641_10416318 Ga0207641_104163181 246
359 3300026095 Ga0207676_10000109 Ga0207676_1000010911 246
360 3300026095 Ga0207676_10001695 Ga0207676_100016952 246
361 3300026095 Ga0207676_10726154 Ga0207676_107261542 246
362 3300026118 Ga0207675_100029840 Ga0207675_1000298403 246
363 3300026142 Ga0207698_10284379 Ga0207698_102843792 246
364 3300027866 Ga0209813_10002858 Ga0209813_100028581 246
365 3300028379 Ga0268266_10000005 Ga0268266_100000051125 246
366 3300028379 Ga0268266_10013577 Ga0268266_100135774 246
367 3300028380 Ga0268265_10001942 Ga0268265_100019422 246
368 3300028380 Ga0268265_10002377 Ga0268265_100023779 246
369 3300028380 Ga0268265_10004078 Ga0268265_1000407812 246
370 3300028380 Ga0268265_10013434 Ga0268265_100134345 246
371 3300028380 Ga0268265_10069488 Ga0268265_100694882 246
372 3300028380 Ga0268265_10495257 Ga0268265_104952572 246
373 3300028381 Ga0268264_10000364 Ga0268264_1000036412 246
374 3300028381 Ga0268264_10000416 Ga0268264_1000041618 246
375 3300028381 Ga0268264_10273395 Ga0268264_102733952 246
376 3300028381 Ga0268264_10587756 Ga0268264_105877562 246
377 3300028794 Ga0307515_10026487 Ga0307515_100264874 246
378 3300030521 Ga0307511_10126914 Ga0307511_101269142 246
379 3300033180 Ga0307510_10017593 Ga0307510_100175934 246
380 3300035089 Ga0373944_0015705 Ga0373944_0015705_1197_1937 246
381 3300035695 Ga0373927_0000130 Ga0373927_0000130_7860_8600 246
382 3300035725 Ga0373947_0072289 Ga0373947_0072289_1323_2063 246
383 3300037068 Ga0373925_0000022 Ga0373925_0000022_4953_5693 246
384 3300037068 Ga0373925_0351289 Ga0373925_0351289_265_1008 246
385 3300037312 Ga0395899_0000984 Ga0395899_0000984_2477_3223 246
386 3300037312 Ga0395899_0029052 Ga0395899_0029052_115_864 246
387 3300037312 Ga0395899_0143603 Ga0395899_0143603_515_1264 246
388 3300037418 Ga0395900_0000010 Ga0395900_0000010_368361_369107 246
389 3300037418 Ga0395900_0044298 Ga0395900_0044298_2864_3613 246
390 3300037466 Ga0395898_0004653 Ga0395898_0004653_6731_7477 246
391 3300037471 Ga0395905_0001301 Ga0395905_0001301_17213_17959 246
392 3300037471 Ga0395905_0039254 Ga0395905_0039254_3524_4273 246
393 3300037471 Ga0395905_0075530 Ga0395905_0075530_1959_2705 246
394 3300037471 Ga0395905_0133687 Ga0395905_0133687_227_976 246
395 3300037471 Ga0395905_0333141 Ga0395905_0333141_344_1090 246
396 3300037471 Ga0395905_0689689 Ga0395905_0689689_58_807 246
397 3300038443 Ga0395901_0000007 Ga0395901_0000007_452725_453471 246
398 3300038443 Ga0395901_0229573 Ga0395901_0229573_44_793 246
399 3300038443 Ga0395901_0521868 Ga0395901_0521868_424_1173 246
400 3300046460 Ga0495638_0000109 Ga0495638_0000109_92178_92918 246
401 3300046471 Ga0495650_0048529 Ga0495650_0048529_666_1406 246
402 3300046492 Ga0495585_0034512 Ga0495585_0034512_1357_2103 246
403 3300046512 Ga0495610_0002807 Ga0495610_0002807_10006_10746 246
404 3300046512 Ga0495610_0058681 Ga0495610_0058681_1084_1830 246
405 3300046515 Ga0495620_0069285 Ga0495620_0069285_305_1051 246
406 3300046518 Ga0495631_0011245 Ga0495631_0011245_1820_2560 246
407 3300046524 Ga0495648_0000075 Ga0495648_0000075_102374_103129 246
408 3300046542 Ga0495597_0001893 Ga0495597_0001893_11994_12740 246
409 3300046557 Ga0495622_0002466 Ga0495622_0002466_5423_6169 246
410 3300046616 Ga0495668_0066742 Ga0495668_0066742_172_912 246
411 3300046648 Ga0495611_0172877 Ga0495611_0172877_238_984 246
412 3300046684 Ga0495669_0000172 Ga0495669_0000172_2030_2776 246
413 3300046690 Ga0495624_0306614 Ga0495624_0306614_44_790 246
414 3300047469 Ga0495673_0000139 Ga0495673_0000139_112_867 246
415 3300047472 Ga0495686_0000870 Ga0495686_0000870_20502_21242 246
416 3300047673 Ga0495593_0061590 Ga0495593_0061590_237_983 246
417 3300048905 Ga0496102_0069444 Ga0496102_0069444_2353_3099 246
418 3300048905 Ga0496102_0082361 Ga0496102_0082361_1350_2102 246
419 3300048906 Ga0496103_0041410 Ga0496103_0041410_1665_2411 246
420 3300048915 Ga0496112_0257829 Ga0496112_0257829_194_943 246
421 3300048918 Ga0496115_0001599 Ga0496115_0001599_12979_13719 246
422 3300048918 Ga0496115_0001643 Ga0496115_0001643_4640_5380 246
423 3300048918 Ga0496115_0143039 Ga0496115_0143039_216_962 246
424 3300048920 Ga0496117_0047823 Ga0496117_0047823_1924_2670 246
425 3300048921 Ga0496118_0128666 Ga0496118_0128666_520_1266 246
426 3300048922 Ga0496119_0020652 Ga0496119_0020652_2774_3520 246
427 3300048923 Ga0496120_0116948 Ga0496120_0116948_34_780 246
428 3300048924 Ga0496121_0001187 Ga0496121_0001187_18146_18892 246
429 3300049459 Ga0495678_001134 Ga0495678_001134_4888_5628 246
430 3300049686 Ga0501257_016058 Ga0501257_016058_505_1245 246
431 3300050489 nmdc:mga03683_229_c1 nmdc:mga03683_229_c1_9311_10129 246
432 3300050493 nmdc:mga0k408_226329_c1 nmdc:mga0k408_226329_c1_241_1059 246
433 3300050494 nmdc:mga06z11_6554_c1 nmdc:mga06z11_6554_c1_107_925 246
434 3300050495 nmdc:mga04h51_55743_c1 nmdc:mga04h51_55743_c1_439_1257 246
435 3300050496 nmdc:mga07m45_33_c1 nmdc:mga07m45_33_c1_27292_28110 246
436 3300050516 nmdc:mga0sz30_86882_c1 nmdc:mga0sz30_86882_c1_488_1300 246
437 3300050516 nmdc:mga0sz30_9117_c1 nmdc:mga0sz30_9117_c1_125_943 246
438 3300053080 Ga0500635_0000082 Ga0500635_0000082_26234_26980 246
439 3300053086 Ga0500578_0000023 Ga0500578_0000023_67418_68158 246
440 3300053087 Ga0500643_028141 Ga0500643_028141_70_825 246
441 3300053088 Ga0500644_0000005 Ga0500644_0000005_98975_99730 246
442 3300053093 Ga0500651_0002702 Ga0500651_0002702_6760_7506 246
443 3300053094 Ga0500566_0015011 Ga0500566_0015011_786_1532 246
444 3300053108 Ga0500562_001156 Ga0500562_001156_503_1261 246
445 3300053109 Ga0500569_000868 Ga0500569_000868_2750_3496 246
446 3300053118 Ga0500594_0000078 Ga0500594_0000078_25043_25783 246
447 3300053119 Ga0500595_002406 Ga0500595_002406_4063_4809 246
448 3300053122 Ga0500608_000054 Ga0500608_000054_31748_32560 246
449 3300053123 Ga0500614_001498 Ga0500614_001498_2088_2834 246
450 3300053136 Ga0500559_0013755 Ga0500559_0013755_692_1438 246
451 3300053138 Ga0500564_000100 Ga0500564_000100_21241_21981 246
452 3300053138 Ga0500564_186289 Ga0500564_186289_83_829 246
453 3300053148 Ga0500590_004891 Ga0500590_004891_2248_2994 246
454 3300053154 Ga0500619_021926 Ga0500619_021926_172_918 246
455 3300053156 Ga0500622_0002724 Ga0500622_0002724_54_794 246
456 3300053157 Ga0500624_024419 Ga0500624_024419_217_963 246
457 3300053162 Ga0500638_088017 Ga0500638_088017_46_792 246
458 3300053163 Ga0500639_123533 Ga0500639_123533_297_1043 246
459 3300053177 Ga0500636_0024519 Ga0500636_0024519_1620_2366 246
460 3300053177 Ga0500636_0036828 Ga0500636_0036828_324_1070 246
461 3300053729 Ga0500625_000002 Ga0500625_000002_181612_182424 246
462 3300053735 Ga0500596_000086 Ga0500596_000086_8548_9294 246
463 3300005289 Ga0065704_10075690 Ga0065704_100756902 247
464 3300005331 Ga0070670_100009012 Ga0070670_1000090123 247
465 3300005353 Ga0070669_100000840 Ga0070669_10000084012 247
466 3300005355 Ga0070671_100072784 Ga0070671_1000727841 247
467 3300005355 Ga0070671_100164519 Ga0070671_1001645191 247
468 3300005355 Ga0070671_100245732 Ga0070671_1002457322 247
469 3300005364 Ga0070673_100449055 Ga0070673_1004490552 247
470 3300005367 Ga0070667_100010698 Ga0070667_1000106982 247
471 3300005457 Ga0070662_100223071 Ga0070662_1002230712 247
472 3300005548 Ga0070665_100001223 Ga0070665_10000122311 247
473 3300005564 Ga0070664_100245591 Ga0070664_1002455912 247
474 3300005614 Ga0068856_100070294 Ga0068856_1000702943 247
475 3300005618 Ga0068864_100001967 Ga0068864_10000196720 247
476 3300005841 Ga0068863_100004317 Ga0068863_1000043177 247
477 3300005842 Ga0068858_100119048 Ga0068858_1001190482 247
478 3300005843 Ga0068860_100153815 Ga0068860_1001538152 247
479 3300005844 Ga0068862_100097097 Ga0068862_1000970972 247
480 3300006186 Ga0075369_10091205 Ga0075369_100912052 247
481 3300006237 Ga0097621_100219863 Ga0097621_1002198632 247
482 3300009011 Ga0105251_10001541 Ga0105251_1000154110 247
483 3300009093 Ga0105240_10442461 Ga0105240_104424612 247
484 3300009177 Ga0105248_10008987 Ga0105248_1000898715 247
485 3300009177 Ga0105248_10138720 Ga0105248_101387201 247
486 3300013105 Ga0157369_10493488 Ga0157369_104934882 247
487 3300013306 Ga0163162_10251112 Ga0163162_102511123 247
488 3300014325 Ga0163163_10074998 Ga0163163_100749982 247
489 3300014325 Ga0163163_10150187 Ga0163163_101501873 247
490 3300021384 Ga0213876_10075259 Ga0213876_100752593 247
491 3300025735 Ga0207713_1000412 Ga0207713_100041231 247
492 3300025909 Ga0207705_10275280 Ga0207705_102752802 247
493 3300025923 Ga0207681_10000499 Ga0207681_1000049912 247
494 3300025924 Ga0207694_10099616 Ga0207694_100996163 247
495 3300025925 Ga0207650_10063546 Ga0207650_100635462 247
496 3300025933 Ga0207706_10031012 Ga0207706_100310122 247
497 3300025941 Ga0207711_10000625 Ga0207711_100006253 247
498 3300025941 Ga0207711_10003070 Ga0207711_1000307013 247
499 3300025944 Ga0207661_10655415 Ga0207661_106554151 247
500 3300025945 Ga0207679_10285997 Ga0207679_102859972 247
501 3300025960 Ga0207651_10218156 Ga0207651_102181562 247
502 3300025986 Ga0207658_10004668 Ga0207658_100046687 247
503 3300026023 Ga0207677_10135899 Ga0207677_101358993 247
504 3300026078 Ga0207702_10105004 Ga0207702_101050042 247
505 3300026088 Ga0207641_10022336 Ga0207641_100223363 247
506 3300026095 Ga0207676_10001962 Ga0207676_100019627 247
507 3300028379 Ga0268266_10001277 Ga0268266_1000127722 247
508 3300028379 Ga0268266_10013343 Ga0268266_100133436 247
509 3300028381 Ga0268264_10071206 Ga0268264_100712062 247
510 3300028786 Ga0307517_10017137 Ga0307517_1001713710 247
511 3300031456 Ga0307513_10007192 Ga0307513_1000719210 247
512 3300031456 Ga0307513_10007802 Ga0307513_100078025 247
513 3300031616 Ga0307508_10144165 Ga0307508_101441652 247
514 3300037471 Ga0395905_0102109 Ga0395905_0102109_85_840 247
515 3300038443 Ga0395901_0031434 Ga0395901_0031434_1728_2483 247
516 3300039437 Ga0436365_1596297 Ga0436365_1596297_273_1016 247
517 3300039438 Ga0436360_0837528 Ga0436360_0837528_604_1359 247
518 3300046616 Ga0495668_0079102 Ga0495668_0079102_859_1608 247
519 3300046616 Ga0495668_0135715 Ga0495668_0135715_29_772 247
520 3300046648 Ga0495611_0002548 Ga0495611_0002548_1616_2359 247
521 3300046660 Ga0495625_0018621 Ga0495625_0018621_137_898 247
522 3300046684 Ga0495669_0019239 Ga0495669_0019239_228_971 247
523 3300046684 Ga0495669_0129071 Ga0495669_0129071_39_782 247
524 3300046689 Ga0495613_0002308 Ga0495613_0002308_2078_2833 247
525 3300047320 Ga0495672_0052681 Ga0495672_0052681_1192_1935 247
526 3300048909 Ga0496106_0168234 Ga0496106_0168234_671_1414 247
527 3300048911 Ga0496108_0076213 Ga0496108_0076213_83_826 247
528 3300048912 Ga0496109_0010443 Ga0496109_0010443_6291_7034 247
529 3300048913 Ga0496110_0154844 Ga0496110_0154844_281_1024 247
530 3300048915 Ga0496112_0032793 Ga0496112_0032793_3358_4101 247
531 3300048916 Ga0496113_0078572 Ga0496113_0078572_83_826 247
532 3300048917 Ga0496114_0320881 Ga0496114_0320881_136_879 247
533 3300048919 Ga0496116_0140391 Ga0496116_0140391_379_1200 247
534 3300048920 Ga0496117_0011327 Ga0496117_0011327_4459_5280 247
535 3300048924 Ga0496121_0007757 Ga0496121_0007757_1567_2388 247
536 3300048928 Ga0496125_0037095 Ga0496125_0037095_3276_4097 247
537 3300049581 Ga0501047_0101781 Ga0501047_0101781_610_1368 247
538 3300049823 Ga0501044_0221897 Ga0501044_0221897_1000_1749 247
539 3300050516 nmdc:mga0sz30_161874_c1 nmdc:mga0sz30_161874_c1_98_850 247
540 3300053103 Ga0500555_001298 Ga0500555_001298_4473_5222 247
541 3300053111 Ga0500572_001158 Ga0500572_001158_1539_2291 247
542 3300053148 Ga0500590_107421 Ga0500590_107421_459_1211 247
543 3300053151 Ga0500604_0064831 Ga0500604_0064831_25_768 247
544 3300009093 Ga0105240_10599993 Ga0105240_105999932 248
545 3300028800 Ga0265338_10012856 Ga0265338_100128563 248
546 3300046506 Ga0495583_0128094 Ga0495583_0128094_81_827 248
547 3300046794 Ga0495589_0013489 Ga0495589_0013489_391_1137 248
548 3300006881 Ga0068865_100013238 Ga0068865_1000132383 249
549 3300025938 Ga0207704_10001576 Ga0207704_1000157612 249
550 3300026088 Ga0207641_10775560 Ga0207641_107755601 249
551 3300046516 Ga0495628_0123718 Ga0495628_0123718_592_1350 249
552 3300046535 Ga0495586_0298947 Ga0495586_0298947_51_809 249
553 3300047319 Ga0495674_0127193 Ga0495674_0127193_1021_1779 249
554 3300048915 Ga0496112_0257185 Ga0496112_0257185_248_1000 249
555 3300049581 Ga0501047_0225927 Ga0501047_0225927_275_1048 249
556 3300017792 Ga0163161_10001996 Ga0163161_100019964 250
557 3300005563 Ga0068855_100523808 Ga0068855_1005238082 251
558 3300013307 Ga0157372_10152059 Ga0157372_101520593 251
559 3300025949 Ga0207667_10490065 Ga0207667_104900652 251
560 3300046506 Ga0495583_0000001 Ga0495583_0000001_141894_142667 251
561 3300031247 Ga0265340_10030466 Ga0265340_100304663 252
562 3300046460 Ga0495638_0031759 Ga0495638_0031759_129_905 252
563 iso_pu_bacteria 2510917020 2511123107 252
564 3300053177 Ga0500636_0044953 Ga0500636_0044953_966_1736 254
565 iso_pu_bacteria 2643221583 2643926447 254
566 3300003773 Ga0055537_1001890 Ga0055537_10018903 255
567 3300003775 Ga0055524_1020919 Ga0055524_10209193 255
568 3300003775 Ga0055524_1025148 Ga0055524_10251483 255
569 3300003790 Ga0055528_1014364 Ga0055528_10143642 255
570 3300025263 Ga0209565_1000466 Ga0209565_100046622 255
571 3300025273 Ga0209673_1000722 Ga0209673_100072233 255
572 3300025291 Ga0209675_1010065 Ga0209675_10100653 255
573 3300025297 Ga0209758_1003007 Ga0209758_10030076 255
574 3300025299 Ga0209256_1001877 Ga0209256_10018773 255
575 3300025299 Ga0209256_1010502 Ga0209256_10105022 255
576 3300046460 Ga0495638_0001122 Ga0495638_0001122_12658_13425 255
577 3300048918 Ga0496115_0018435 Ga0496115_0018435_1922_2689 255
578 3300053087 Ga0500643_018127 Ga0500643_018127_1491_2258 255
579 3300053156 Ga0500622_0007734 Ga0500622_0007734_244_1011 255
580 3300047469 Ga0495673_0000305 Ga0495673_0000305_51614_52384 256
581 3300053142 Ga0500577_0001328 Ga0500577_0001328_2130_2900 256
582 3300046457 Ga0495590_0112293 Ga0495590_0112293_117_890 257
583 3300046460 Ga0495638_0001193 Ga0495638_0001193_3564_4337 257
584 3300046520 Ga0495637_0013209 Ga0495637_0013209_762_1535 257
585 3300047320 Ga0495672_0001176 Ga0495672_0001176_4910_5683 257
586 3300053104 Ga0500556_0001541 Ga0500556_0001541_3584_4357 257
587 3300053730 Ga0500645_037537 Ga0500645_037537_474_1247 257
588 3300028794 Ga0307515_10139358 Ga0307515_101393583 258
589 3300042156 Ga0439446_0018177 Ga0439446_0018177_67_843 258
590 3300046471 Ga0495650_0000020 Ga0495650_0000020_387032_387808 258
591 3300046507 Ga0495606_0022286 Ga0495606_0022286_1154_1930 258
592 3300046512 Ga0495610_0000218 Ga0495610_0000218_24200_24976 258
593 3300046512 Ga0495610_0003224 Ga0495610_0003224_1602_2378 258
594 3300046522 Ga0495643_0031859 Ga0495643_0031859_1521_2297 258
595 3300046530 Ga0495654_0000139 Ga0495654_0000139_37157_37933 258
596 3300046660 Ga0495625_0000165 Ga0495625_0000165_3840_4616 258
597 3300046660 Ga0495625_0020407 Ga0495625_0020407_3519_4295 258
598 3300046660 Ga0495625_0088733 Ga0495625_0088733_592_1368 258
599 3300046691 Ga0495670_0163271 Ga0495670_0163271_226_1002 258
600 3300046810 Ga0495660_0145642 Ga0495660_0145642_234_1010 258
601 3300047446 Ga0495679_011751 Ga0495679_011751_519_1295 258
602 3300047469 Ga0495673_0001209 Ga0495673_0001209_3555_4331 258
603 3300047472 Ga0495686_0004871 Ga0495686_0004871_5305_6081 258
604 3300047472 Ga0495686_0033861 Ga0495686_0033861_1971_2747 258
605 3300047472 Ga0495686_0181389 Ga0495686_0181389_234_1010 258
606 3300048909 Ga0496106_0069223 Ga0496106_0069223_651_1427 258
607 3300048910 Ga0496107_0000050 Ga0496107_0000050_58689_59465 258
608 3300048924 Ga0496121_0019233 Ga0496121_0019233_1776_2552 258
609 3300053123 Ga0500614_055042 Ga0500614_055042_10_786 258
610 3300053125 Ga0500618_000195 Ga0500618_000195_15249_16025 258
611 3300053134 Ga0500658_0002785 Ga0500658_0002785_1433_2209 258
612 3300053136 Ga0500559_0000024 Ga0500559_0000024_67489_68265 258
613 3300053158 Ga0500627_0005963 Ga0500627_0005963_983_1759 258
614 3300053108 Ga0500562_000372 Ga0500562_000372_7883_8668 259
615 3300053136 Ga0500559_0010593 Ga0500559_0010593_1263_2042 259
616 iso_pu_bacteria 2582581280 2585150580 259
617 iso_pu_bacteria 2582581293 2585198098 259
618 iso_pu_bacteria 2643221545 2643751007 259
619 iso_pu_bacteria 2643221552 2643782733 259
620 iso_pu_bacteria 2643221584 2643928042 259
621 iso_pu_bacteria 2643221691 2644510975 259
622 iso_pu_bacteria 2818991435 2819539792 259
623 iso_pu_bacteria 2818991454 2819648929 259
624 3300003771 Ga0055526_1017218 Ga0055526_10172182 263
625 3300003794 Ga0055531_10001970 Ga0055531_1000197014 263
626 3300025295 Ga0209564_1010672 Ga0209564_10106722 263
627 3300025297 Ga0209758_1005171 Ga0209758_100517113 263
628 3300025298 Ga0209050_1015693 Ga0209050_10156933 263
629 3300025304 Ga0209257_1000066 Ga0209257_1000066244 263
630 3300041512 Ga0451853_0416643 Ga0451853_0416643_1115_1906 263
631 3300042001 Ga0439441_016409 Ga0439441_016409_472_1263 263
632 3300042436 Ga0439435_0007978 Ga0439435_0007978_1594_2385 263
633 3300046460 Ga0495638_0005052 Ga0495638_0005052_670_1461 263
634 3300046513 Ga0495616_0001067 Ga0495616_0001067_8460_9251 263
635 3300046515 Ga0495620_0077725 Ga0495620_0077725_91_882 263
636 3300046519 Ga0495632_0002715 Ga0495632_0002715_4012_4803 263
637 3300046538 Ga0495609_0050970 Ga0495609_0050970_56_847 263
638 3300046616 Ga0495668_0031580 Ga0495668_0031580_916_1707 263
639 3300046616 Ga0495668_0038680 Ga0495668_0038680_108_899 263
640 3300046660 Ga0495625_0002840 Ga0495625_0002840_3706_4497 263
641 3300046810 Ga0495660_0024954 Ga0495660_0024954_596_1387 263
642 3300053731 Ga0500609_000114 Ga0500609_000114_7709_8500 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

64

237

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2goy-assembly2.cif.gz_E crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps 0.9299 29 237
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9026 20 224
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9012 20 225
7lhs-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9006 20 225
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.89 20 224
ID Description Score Start End Superfamily
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9299 29 237 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8994 23 248 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8824 27 248 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8735 29 237 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8727 19 219 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1F3AF67-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9892 26 248 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814
AF-A0A7T7Y7U0-F1-model_v4 deleted 0.989 29 248
AF-A0A537PT52-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9885 29 248 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814
AF-A0A0R3MAL9-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9877 32 248 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814
AF-A0A1M3C8K2-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9876 29 248 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814

Feature Viewer

pLDDT pTM Quality
84.83 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map