F471836

General Info

Members Datasets Scaffolds Average Seq Length
641 496 1282 548

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016613128|8016619056
Length 595
Sequence SAKLCALLVGTAAALGASSASAVTMAEDADTVCKGLVGGTDAVKIDSATLQAPSQLAVAERGPTPSGRVTPANPGFCKVLGHIDPTDPKAPPIKFQVNLPVEWNGRSLQYGGGGFNGVLITGLTLPPAYPFDKPSPLARGFVTYGTDSGHESKPGEPPQLFALNDEAFENFAHRAYKKVRDVAVALMERAYGKRPEKIYFMGSSEGGREGLTMAQRYPDDFDGIFARVPVINWVGLQHAGTRSGLATMGDGWINPKQVKLVGDAVRAACDKADGSDDALVQDPVACKAAFKVETLRCTSGKTGDQCLTDAQIKAVDTLHTTYKFPFALANGLDDYPGWGVSGEDTPAVGPTGGWVAWWLGTAPPAQPPAANNGIAWIYGAGGIQYVFARDPKLDVTTYKPEQHKARLLEVSSLMDSTDPDLSRFRSRGGRLIMLEHMADYAQSPYAGIRYFESVERKLGKAETAEFARLYTAPGVDHVGSGAPANVDMLSALVDWVEKDKAPGDLEVAEQKVEAPSFATLRALPLCRWPAWPHYKSGSVTEGGKLHLRAVRSGDADRGCGGLIPPPSPVRLPATVHSAARRKTTCRPEPRRYRRK

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
95 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
96 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
97 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
161 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
162 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
163 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
195 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
283 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
293 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
294 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
295 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
296 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
297 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
298 2508501050 Microvirga lupini Lut6 Isolate Nodule
299 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
300 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
301 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
302 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
303 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
304 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
305 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
306 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
307 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
308 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
309 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
310 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
311 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
312 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
313 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
314 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
315 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
316 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
317 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
318 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
319 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
320 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
321 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
322 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
323 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
324 2791355199
325 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
326 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
327 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
328 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
329 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
330 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
331 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
332 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
333 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
334 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
335 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
336 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
337 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
338 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
339 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
340 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
341 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
342 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
343 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
344 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
345 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
346 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
347 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
348 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
349 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
350 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
351 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
352 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
353 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
354 2842677519 Variovorax sp. R-72495 Isolate Unclassified
355 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
356 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
357 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
358 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
359 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
360 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
361 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
362 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
363 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
364 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
365 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
366 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
367 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
368 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
369 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
370 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
371 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
372 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
373 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
374 2885198086 Variovorax sp. 679 Isolate Unclassified
375 2885211737 Variovorax sp. 553 Isolate Unclassified
376 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
377 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
378 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
379 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
380 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
381 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
382 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
383 2904456579 Variovorax sp. 2002 Isolate Unclassified
384 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
385 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
386 2904699407
387 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
388 2906610324
389 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
390 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
391 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
392 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
393 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
394 2922425934
395 2928070936 Variovorax gossypii 1167 Isolate Unclassified
396 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
397 2929520902 Variovorax beijingensis 502 Isolate Unclassified
398 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
399 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
400 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
401 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
402 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
403 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
404 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
405 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
406 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
407 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
408 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
409 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
410 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
411 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
412 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
413 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
414 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
415 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
416 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
417 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
418 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
419 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
420 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
421 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
422 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
423 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
424 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
425 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
426 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
427 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
428 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
429 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
430 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
431 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
432 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
433 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
434 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
435 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
436 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
437 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
438 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
439 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
440 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
441 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
442 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
443 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
444 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
445 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
446 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
447 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
448 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
449 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
450 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
451 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
452 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
453 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
454 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
455 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
456 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
457 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
458 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
459 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
460 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
461 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
462 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
463 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
464 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
465 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
466 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
467 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
468 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
469 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
470 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
471 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
472 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
473 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
474 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
475 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
476 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
477 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
478 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
479 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
480 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
481 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
482 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
483 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
484 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
485 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
486 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
487 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
488 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
489 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
490 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
491 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
492 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
493 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
494 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
495 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
496 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.6
Metatranscriptomes 0.16
Isolates 31.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.41
Nodule 23.71
Rhizoplane 3.9
Rhizosphere 38.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1004260 3300002773 Bacteria 4571
2 JGI25159J45721_1003932 3300002987 Bacteria 5076
3 JGI25151J46595_10002505 3300003187 Bacteria 10953
4 JGI25151J46595_10005576 3300003187 Bacteria 6476
5 JGI25151J46595_10009579 3300003187 Bacteria 4571
6 JGI25153J46596_10000287 3300003215 Bacteria 38425
7 JGI25153J46596_10000770 3300003215 Bacteria 19644
8 JGI25153J46596_10003355 3300003215 Bacteria 8990
9 JGI25153J46596_10009355 3300003215 Bacteria 4571
10 JGI25160J50197_1001377 3300003354 Bacteria 12233
11 JGI25160J50197_1001775 3300003354 Bacteria 10446
12 JGI25160J50197_1003278 3300003354 Bacteria 7292
13 JGI25160J50197_1005823 3300003354 Bacteria 5075
14 JGI25161J50226_1002265 3300003374 Bacteria 5046
15 Ga0006562J51391_1128434 3300003578 Bacteria 2600
16 JGI25404J52841_10005189 3300003659 Bacteria 2685
17 Ga0055526_1008564 3300003771 Bacteria 5075
18 Ga0055537_1000304 3300003773 Bacteria 34030
19 Ga0055537_1001934 3300003773 Bacteria 7407
20 Ga0055524_1006474 3300003775 Bacteria 5075
21 Ga0055536_1005926 3300003781 Bacteria 5846
22 Ga0055534_1000289 3300003784 Bacteria 34030
23 Ga0055534_1002126 3300003784 Bacteria 7111
24 Ga0055528_1001591 3300003790 Bacteria 13460
25 Ga0055528_1003827 3300003790 Bacteria 7407
26 Ga0055540_1001631 3300003792 Bacteria 13023
27 Ga0055531_10003804 3300003794 Bacteria 9471
28 Ga0055543_1004070 3300004625 Bacteria 4095
29 Ga0065165_1005230 3300005262 Bacteria 7445
30 Ga0065165_1005809 3300005262 Bacteria 6732
31 Ga0070676_10031697 3300005328 Bacteria 3024
32 Ga0070676_10038260 3300005328 Bacteria 2770
33 Ga0070683_100039305 3300005329 Bacteria 4342
34 Ga0070690_100023721 3300005330 Bacteria 3766
35 Ga0068869_100016949 3300005334 Bacteria 4926
36 Ga0068869_100080848 3300005334 Bacteria 2425
37 Ga0070666_10009437 3300005335 Bacteria 6082
38 Ga0068868_100162662 3300005338 Bacteria 1844
39 Ga0070689_100033073 3300005340 Bacteria 3938
40 Ga0070689_100044429 3300005340 Bacteria 3418
41 Ga0070691_10010541 3300005341 Bacteria 4220
42 Ga0070661_100045415 3300005344 Bacteria 3212
43 Ga0070675_100002125 3300005354 Bacteria 14641
44 Ga0070671_100001791 3300005355 Bacteria 16319
45 Ga0070671_100006964 3300005355 Bacteria 9055
46 Ga0070673_100023748 3300005364 Bacteria 4484
47 Ga0070667_100014856 3300005367 Bacteria 6433
48 Ga0070667_100041614 3300005367 Bacteria 3855
49 Ga0070710_10033043 3300005437 Bacteria 2807
50 Ga0070711_100030330 3300005439 Bacteria 3578
51 Ga0070694_100030553 3300005444 Bacteria 3525
52 Ga0070694_100097773 3300005444 Bacteria 2071
53 Ga0070663_100052123 3300005455 Bacteria 2917
54 Ga0070681_10000912 3300005458 Bacteria 24962
55 Ga0070681_10056927 3300005458 Bacteria 3890
56 Ga0068867_100060835 3300005459 Bacteria 2802
57 Ga0070698_100114301 3300005471 Bacteria 2664
58 Ga0070684_100003171 3300005535 Bacteria 12296
59 Ga0068853_100080029 3300005539 Bacteria 2858
60 Ga0068853_100122326 3300005539 Bacteria 2323
61 Ga0070695_100007971 3300005545 Bacteria 6272
62 Ga0070695_100066274 3300005545 Bacteria 2353
63 Ga0070665_100026129 3300005548 Bacteria 5879
64 Ga0070704_100016770 3300005549 Bacteria 4638
65 Ga0070704_100044906 3300005549 Bacteria 3073
66 Ga0070664_100175017 3300005564 Bacteria 1905
67 Ga0068856_100000985 3300005614 Bacteria 30399
68 Ga0068852_100068442 3300005616 Bacteria 3107
69 Ga0068859_100006102 3300005617 Bacteria 12239
70 Ga0068859_100162215 3300005617 Bacteria 2314
71 Ga0068864_100001399 3300005618 Bacteria 19954
72 Ga0068861_100108854 3300005719 Bacteria 2217
73 Ga0068858_100002055 3300005842 Bacteria 20491
74 Ga0068860_100000081 3300005843 Bacteria 170066
75 Ga0068862_100136177 3300005844 Bacteria 2176
76 Ga0081540_1000288 3300005983 Bacteria 52745
77 Ga0081540_1001736 3300005983 Bacteria 18346
78 Ga0081540_1008566 3300005983 Bacteria 7137
79 Ga0081540_1022190 3300005983 Bacteria 3752
80 Ga0081540_1024328 3300005983 Bacteria 3517
81 Ga0075365_10001357 3300006038 Bacteria 10977
82 Ga0075365_10003047 3300006038 Bacteria 8502
83 Ga0075368_10018402 3300006042 Bacteria 2625
84 Ga0075363_100051073 3300006048 Bacteria 2204
85 Ga0075364_10009520 3300006051 Bacteria 5832
86 Ga0070712_100069578 3300006175 Bacteria 2511
87 Ga0075362_10030080 3300006177 Bacteria 2344
88 Ga0075367_10027409 3300006178 Bacteria 3241
89 Ga0075369_10009185 3300006186 Bacteria 3832
90 Ga0075369_10026940 3300006186 Bacteria 2399
91 Ga0075366_10005798 3300006195 Bacteria 6709
92 Ga0075366_10010377 3300006195 Bacteria 5229
93 Ga0075370_10002672 3300006353 Bacteria 8336
94 Ga0075370_10005589 3300006353 Bacteria 6270
95 Ga0075370_10010790 3300006353 Bacteria 4790
96 Ga0075370_10049951 3300006353 Bacteria 2372
97 Ga0075431_100091691 3300006847 Bacteria 3135
98 Ga0075434_100038733 3300006871 Bacteria 4722
99 Ga0075429_100000009 3300006880 Bacteria 85110
100 Ga0097620_100006102 3300006931 Bacteria 12239
101 Ga0097620_100162206 3300006931 Bacteria 2314
102 Ga0099825_1026561 3300006941 Bacteria 3065
103 Ga0099824_1011197 3300006942 Bacteria 10247
104 Ga0099823_1030317 3300006944 Bacteria 4532
105 Ga0099826_10017992 3300006948 Bacteria 5339
106 Ga0099794_10036237 3300007265 Bacteria 2331
107 Ga0099794_10048591 3300007265 Bacteria 2037
108 Ga0105240_10041067 3300009093 Bacteria 5909
109 Ga0105245_10016774 3300009098 Bacteria 6395
110 Ga0105247_10005827 3300009101 Bacteria 7702
111 Ga0105247_10074363 3300009101 Bacteria 2131
112 Ga0114129_10000666 3300009147 Bacteria 43094
113 Ga0105243_10002379 3300009148 Bacteria 15749
114 Ga0105243_10021679 3300009148 Bacteria 4877
115 Ga0105241_10037608 3300009174 Bacteria 3647
116 Ga0105241_10072995 3300009174 Bacteria 2668
117 Ga0105248_10007761 3300009177 Bacteria 11776
118 Ga0105248_10019842 3300009177 Bacteria 7444
119 Ga0105248_10108910 3300009177 Bacteria 3124
120 Ga0105237_10027550 3300009545 Bacteria 5798
121 Ga0105239_10104555 3300010375 Bacteria 3135
122 Ga0105246_10017840 3300011119 Bacteria 4514
123 Ga0157373_10001556 3300013100 Bacteria 17499
124 Ga0157370_10031200 3300013104 Bacteria 5215
125 Ga0163162_10018492 3300013306 Bacteria 6828
126 Ga0163162_10081442 3300013306 Bacteria 3308
127 Ga0157375_10042884 3300013308 Bacteria 4383
128 Ga0163163_10027365 3300014325 Bacteria 5461
129 Ga0163163_10058463 3300014325 Bacteria 3813
130 Ga0163163_10068269 3300014325 Bacteria 3537
131 Ga0157380_10069921 3300014326 Bacteria 2834
132 Ga0182008_10010782 3300014497 Bacteria 4884
133 Ga0157379_10001791 3300014968 Bacteria 17740
134 Ga0157379_10067834 3300014968 Bacteria 3189
135 Ga0157376_10017651 3300014969 Bacteria 5450
136 Ga0182006_1012521 3300015261 Bacteria 3708
137 Ga0163161_10001728 3300017792 Bacteria 15997
138 Ga0214544_1000007 3300021320 Bacteria 379989
139 Ga0214542_1000007 3300021321 Bacteria 291816
140 Ga0214545_1000006 3300021324 Bacteria 291693
141 Ga0214543_1000009 3300021327 Bacteria 384302
142 Ga0213876_10003562 3300021384 Bacteria 8865
143 Ga0209436_105643 3300025208 Bacteria 2842
144 Ga0209563_101630 3300025230 Bacteria 5791
145 Ga0207425_1000355 3300025245 Bacteria 31804
146 Ga0209677_100280 3300025253 Bacteria 34034
147 Ga0209129_1000033 3300025258 Bacteria 336894
148 Ga0209233_1002614 3300025261 Bacteria 6539
149 Ga0209233_1005066 3300025261 Bacteria 4412
150 Ga0209233_1007767 3300025261 Bacteria 3370
151 Ga0209565_1000120 3300025263 Bacteria 111458
152 Ga0209565_1000586 3300025263 Bacteria 24589
153 Ga0209455_1000757 3300025272 Bacteria 18273
154 Ga0209455_1001166 3300025272 Bacteria 12650
155 Ga0209673_1000099 3300025273 Bacteria 193248
156 Ga0209673_1001345 3300025273 Bacteria 24589
157 Ga0209673_1002340 3300025273 Bacteria 13407
158 Ga0209130_1000736 3300025284 Bacteria 28751
159 Ga0209675_1000054 3300025291 Bacteria 193248
160 Ga0209675_1000539 3300025291 Bacteria 27695
161 Ga0209675_1001156 3300025291 Bacteria 16028
162 Ga0209676_1000896 3300025292 Bacteria 37733
163 Ga0209676_1014410 3300025292 Bacteria 2974
164 Ga0209025_1000743 3300025294 Bacteria 54915
165 Ga0209025_1001001 3300025294 Bacteria 41900
166 Ga0209025_1004122 3300025294 Bacteria 12910
167 Ga0209564_1000151 3300025295 Bacteria 168783
168 Ga0209758_1000015 3300025297 Bacteria 851943
169 Ga0209758_1000027 3300025297 Bacteria 549650
170 Ga0209758_1000161 3300025297 Bacteria 154278
171 Ga0209758_1008326 3300025297 Bacteria 6756
172 Ga0209758_1009956 3300025297 Bacteria 5785
173 Ga0209758_1012471 3300025297 Bacteria 4755
174 Ga0209256_1000161 3300025299 Bacteria 138270
175 Ga0207426_1000027 3300025302 Bacteria 513176
176 Ga0207426_1000186 3300025302 Bacteria 154130
177 Ga0207426_1014366 3300025302 Bacteria 2901
178 Ga0209051_1000483 3300025303 Bacteria 51423
179 Ga0209051_1000762 3300025303 Bacteria 34275
180 Ga0209051_1006592 3300025303 Bacteria 6512
181 Ga0209257_1000982 3300025304 Bacteria 38708
182 Ga0209257_1004586 3300025304 Bacteria 10543
183 Ga0207710_10005351 3300025900 Bacteria 5539
184 Ga0207680_10065495 3300025903 Bacteria 2231
185 Ga0207647_10009699 3300025904 Bacteria 6830
186 Ga0207645_10002792 3300025907 Bacteria 13590
187 Ga0207645_10043844 3300025907 Bacteria 2863
188 Ga0207707_10000088 3300025912 Bacteria 90991
189 Ga0207671_10044266 3300025914 Bacteria 3292
190 Ga0207693_10003980 3300025915 Bacteria 12554
191 Ga0207693_10073789 3300025915 Bacteria 2671
192 Ga0207681_10088988 3300025923 Bacteria 2200
193 Ga0207659_10001206 3300025926 Bacteria 15435
194 Ga0207700_10094455 3300025928 Bacteria 2369
195 Ga0207644_10003942 3300025931 Bacteria 9628
196 Ga0207706_10091654 3300025933 Bacteria 2672
197 Ga0207706_10139194 3300025933 Bacteria 2135
198 Ga0207709_10000319 3300025935 Bacteria 52470
199 Ga0207670_10021485 3300025936 Bacteria 3983
200 Ga0207711_10015310 3300025941 Bacteria 6366
201 Ga0207711_10106780 3300025941 Bacteria 2485
202 Ga0207661_10003596 3300025944 Bacteria 10780
203 Ga0207667_10060343 3300025949 Bacteria 3970
204 Ga0207703_10005187 3300026035 Bacteria 10527
205 Ga0207678_10022304 3300026067 Bacteria 5547
206 Ga0207702_10000101 3300026078 Bacteria 99845
207 Ga0207702_10067604 3300026078 Bacteria 3067
208 Ga0207641_10086148 3300026088 Bacteria 2738
209 Ga0207648_10005766 3300026089 Bacteria 12405
210 Ga0207648_10075423 3300026089 Bacteria 2940
211 Ga0207676_10002950 3300026095 Bacteria 12130
212 Ga0207674_10139426 3300026116 Bacteria 2385
213 Ga0207683_10023216 3300026121 Bacteria 5332
214 Ga0207683_10114047 3300026121 Bacteria 2421
215 Ga0207683_10126795 3300026121 Bacteria 2294
216 Ga0207698_10014298 3300026142 Bacteria 5272
217 Ga0209389_1000062 3300027296 Bacteria 102842
218 Ga0209589_1000270 3300027357 Bacteria 65577
219 Ga0209489_100160 3300027361 Bacteria 102842
220 Ga0209489_100206 3300027361 Bacteria 96866
221 Ga0209700_101128 3300027363 Bacteria 54168
222 Ga0209282_1008510 3300027666 Bacteria 6476
223 Ga0209813_10014859 3300027866 Bacteria 2102
224 Ga0268266_10026609 3300028379 Bacteria 4922
225 Ga0268265_10005022 3300028380 Bacteria 9079
226 Ga0268264_10000048 3300028381 Bacteria 334457
227 Ga0265337_1003981 3300028556 Bacteria 6251
228 Ga0265334_10002493 3300028573 Bacteria 8604
229 Ga0265323_10004871 3300028653 Bacteria 5741
230 Ga0265336_10000063 3300028666 Bacteria 98413
231 Ga0307517_10000858 3300028786 Bacteria 51951
232 Ga0307517_10004361 3300028786 Bacteria 21778
233 Ga0307517_10071894 3300028786 Bacteria 3093
234 Ga0307515_10006133 3300028794 Bacteria 24177
235 Ga0307515_10006378 3300028794 Bacteria 23616
236 Ga0307515_10051562 3300028794 Bacteria 6130
237 Ga0307515_10104312 3300028794 Bacteria 3389
238 Ga0265338_10000154 3300028800 Bacteria 125708
239 Ga0265324_10004487 3300029957 Bacteria 6282
240 Ga0316179_1080326 3300030734 Bacteria 2530
241 Ga0316178_1056355 3300030735 Bacteria 3852
242 Ga0316180_1104778 3300030736 Bacteria 2471
243 Ga0265325_10050829 3300031241 Bacteria 2133
244 Ga0265339_10011726 3300031249 Bacteria 5380
245 Ga0265339_10017132 3300031249 Bacteria 4297
246 Ga0307513_10000006 3300031456 Bacteria 470848
247 Ga0307513_10012594 3300031456 Bacteria 10427
248 Ga0307509_10006573 3300031507 Bacteria 15576
249 Ga0307509_10008338 3300031507 Bacteria 13237
250 Ga0307509_10131197 3300031507 Bacteria 2461
251 Ga0307408_100012560 3300031548 Bacteria 5613
252 Ga0307508_10000096 3300031616 Bacteria 103730
253 Ga0307508_10000282 3300031616 Bacteria 62510
254 Ga0307508_10043133 3300031616 Bacteria 4042
255 Ga0307514_10001887 3300031649 Bacteria 23094
256 Ga0307516_10000394 3300031730 Bacteria 57048
257 Ga0307516_10009880 3300031730 Bacteria 10581
258 Ga0307516_10094260 3300031730 Bacteria 2818
259 Ga0307405_10000862 3300031731 Bacteria 11976
260 Ga0307406_10001703 3300031901 Bacteria 12091
261 Ga0307412_10015746 3300031911 Bacteria 4488
262 Ga0307412_10087555 3300031911 Bacteria 2170
263 Ga0307416_100034644 3300032002 Bacteria 3845
264 Ga0307415_100016647 3300032126 Bacteria 4388
265 Ga0307510_10001691 3300033180 Bacteria 24508
266 Ga0373939_0009925 3300035114 Bacteria 2370
267 Ga0373954_0044276 3300035118 Bacteria 2076
268 Ga0373956_0048657 3300035119 Bacteria 1899
269 Ga0373943_0007430 3300035170 Bacteria 4922
270 Ga0373962_0005947 3300035242 Bacteria 2944
271 Ga0373935_0069006 3300035692 Bacteria 2275
272 Ga0373947_0063769 3300035725 Bacteria 2245
273 Ga0373937_0038661 3300036401 Bacteria 4348
274 Ga0373925_0075488 3300037068 Bacteria 2554
275 Ga0395899_0063452 3300037312 Bacteria 2718
276 Ga0395900_0000982 3300037418 Bacteria 37090
277 Ga0395898_0007529 3300037466 Bacteria 11570
278 Ga0395905_0009385 3300037471 Bacteria 9569
279 Ga0436364_0987862 3300037853 Bacteria 3131
280 Ga0395901_0198516 3300038443 Bacteria 2103
281 Ga0436365_0467329 3300039437 Bacteria 3685
282 Ga0436365_0523972 3300039437 Bacteria 7205
283 Ga0436365_0900223 3300039437 Bacteria 2632
284 Ga0436365_1554337 3300039437 Bacteria 1876
285 Ga0439442_009893 3300042002 Bacteria 1929
286 Ga0450906_003335 3300042145 Bacteria 3463
287 Ga0439434_0001812 3300042435 Bacteria 6209
288 Ga0466972_0000389 3300044658 Bacteria 23455
289 Ga0466972_0016682 3300044658 Bacteria 3671
290 Ga0466965_0019002 3300044683 Bacteria 3297
291 Ga0466957_0081077 3300044842 Bacteria 2021
292 Ga0466960_0003626 3300044901 Bacteria 5958
293 Ga0466960_0027138 3300044901 Bacteria 2609
294 Ga0466959_0001041 3300045049 Bacteria 16601
295 Ga0466959_0094016 3300045049 Bacteria 2151
296 Ga0495627_006187 3300046453 Bacteria 4716
297 Ga0495592_0045582 3300046454 Bacteria 3271
298 Ga0495603_0004846 3300046455 Bacteria 8044
299 Ga0495603_0105223 3300046455 Bacteria 1647
300 Ga0495629_0062637 3300046459 Bacteria 2598
301 Ga0495629_0116528 3300046459 Bacteria 1862
302 Ga0495638_0008040 3300046460 Bacteria 7511
303 Ga0495638_0010722 3300046460 Bacteria 6343
304 Ga0495651_0001368 3300046462 Bacteria 18876
305 Ga0495651_0015758 3300046462 Bacteria 5854
306 Ga0495580_0023923 3300046472 Bacteria 4479
307 Ga0495582_0015480 3300046473 Bacteria 4189
308 Ga0495639_0019481 3300046475 Bacteria 2963
309 Ga0495639_0020690 3300046475 Bacteria 2875
310 Ga0495606_0006211 3300046507 Bacteria 11104
311 Ga0495606_0043038 3300046507 Bacteria 3016
312 Ga0495610_0049057 3300046512 Bacteria 2069
313 Ga0495628_0065645 3300046516 Bacteria 2838
314 Ga0495628_0135879 3300046516 Bacteria 1879
315 Ga0495632_0024422 3300046519 Bacteria 3210
316 Ga0495637_0007902 3300046520 Bacteria 5245
317 Ga0495652_0002998 3300046529 Bacteria 16944
318 Ga0495652_0125912 3300046529 Bacteria 2035
319 Ga0495640_0017677 3300046533 Bacteria 5307
320 Ga0495587_0028787 3300046536 Bacteria 3376
321 Ga0495667_0021301 3300046559 Bacteria 4374
322 Ga0495667_0053032 3300046559 Bacteria 2671
323 Ga0495667_0076937 3300046559 Bacteria 2171
324 Ga0495656_0014494 3300046615 Bacteria 2957
325 Ga0495668_0052203 3300046616 Bacteria 2262
326 Ga0495625_0004404 3300046660 Bacteria 13347
327 Ga0495635_0084320 3300046663 Bacteria 2174
328 Ga0495588_0016410 3300046674 Bacteria 3578
329 Ga0495588_0067528 3300046674 Bacteria 1856
330 Ga0495599_0030863 3300046678 Bacteria 3364
331 Ga0495599_0048050 3300046678 Bacteria 2675
332 Ga0495623_0002315 3300046679 Bacteria 12695
333 Ga0495646_0063010 3300046680 Bacteria 2203
334 Ga0495647_0003961 3300046681 Bacteria 4777
335 Ga0495658_0057622 3300046683 Bacteria 2220
336 Ga0495658_0077153 3300046683 Bacteria 1948
337 Ga0495624_0074594 3300046690 Bacteria 2107
338 Ga0495670_0033558 3300046691 Bacteria 2554
339 Ga0495649_0057416 3300046694 Bacteria 2099
340 Ga0495600_0022223 3300046809 Bacteria 4071
341 Ga0495600_0025430 3300046809 Bacteria 3816
342 Ga0495581_0017913 3300047315 Bacteria 4116
343 Ga0495604_0006550 3300047317 Bacteria 9233
344 Ga0495604_0012111 3300047317 Bacteria 6858
345 Ga0495674_0032543 3300047319 Bacteria 4729
346 Ga0495676_0020791 3300047321 Bacteria 5751
347 Ga0495676_0039036 3300047321 Bacteria 3938
348 Ga0495687_046600 3300047443 Bacteria 1870
349 Ga0495675_0057141 3300047444 Bacteria 2474
350 Ga0495684_0004001 3300047471 Bacteria 11497
351 Ga0495602_0003127 3300048088 Bacteria 17037
352 Ga0495602_0022173 3300048088 Bacteria 6224
353 Ga0496100_0022825 3300048903 Bacteria 3791
354 Ga0496101_0041168 3300048904 Bacteria 3293
355 Ga0496102_0016990 3300048905 Bacteria 6367
356 Ga0496102_0158402 3300048905 Bacteria 2129
357 Ga0496102_0165405 3300048905 Bacteria 2081
358 Ga0496104_0002216 3300048907 Bacteria 16802
359 Ga0496104_0056314 3300048907 Bacteria 3717
360 Ga0496104_0101883 3300048907 Bacteria 2750
361 Ga0496105_0001007 3300048908 Bacteria 19467
362 Ga0496105_0013889 3300048908 Bacteria 6399
363 Ga0496105_0095140 3300048908 Bacteria 2460
364 Ga0496106_0105512 3300048909 Bacteria 2189
365 Ga0496107_0023473 3300048910 Bacteria 4361
366 Ga0496108_0066102 3300048911 Bacteria 3049
367 Ga0496108_0107372 3300048911 Bacteria 2384
368 Ga0496110_0074838 3300048913 Bacteria 3008
369 Ga0496111_0097149 3300048914 Bacteria 2162
370 Ga0496112_0177218 3300048915 Bacteria 2096
371 Ga0496113_0096581 3300048916 Bacteria 2285
372 Ga0496114_0032491 3300048917 Bacteria 4296
373 Ga0496114_0056558 3300048917 Bacteria 3274
374 Ga0496114_0110802 3300048917 Bacteria 2352
375 Ga0496116_0018549 3300048919 Bacteria 5358
376 Ga0496117_0057133 3300048920 Bacteria 2713
377 Ga0496118_0001892 3300048921 Bacteria 29856
378 Ga0496118_0014666 3300048921 Bacteria 7324
379 Ga0496118_0059557 3300048921 Bacteria 2842
380 Ga0496118_0073321 3300048921 Bacteria 2453
381 Ga0496119_0029936 3300048922 Bacteria 3679
382 Ga0496119_0049999 3300048922 Bacteria 2580
383 Ga0496120_0005154 3300048923 Bacteria 10556
384 Ga0496121_0000041 3300048924 Bacteria 346686
385 Ga0496121_0001954 3300048924 Bacteria 32835
386 Ga0496121_0002323 3300048924 Bacteria 29460
387 Ga0496121_0004971 3300048924 Bacteria 17427
388 Ga0496121_0044035 3300048924 Bacteria 3857
389 Ga0496121_0072021 3300048924 Bacteria 2776
390 Ga0496121_0111238 3300048924 Bacteria 2089
391 Ga0496124_0001646 3300048927 Bacteria 31986
392 Ga0496124_0076359 3300048927 Bacteria 2766
393 Ga0496124_0173209 3300048927 Bacteria 1669
394 Ga0496125_0000407 3300048928 Bacteria 80570
395 Ga0496126_0002010 3300048929 Bacteria 28750
396 Ga0496126_0044068 3300048929 Bacteria 4111
397 Ga0496126_0045529 3300048929 Bacteria 4031
398 Ga0496126_0154074 3300048929 Bacteria 1968
399 Ga0495682_0021388 3300049460 Bacteria 2424
400 Ga0501249_008119 3300049679 Bacteria 2178
401 nmdc:mga03683_2061_c2 3300050489 Bacteria 5731
402 nmdc:mga03683_4926_c2 3300050489 Bacteria 2550
403 nmdc:mga03n38_36618_c1 3300050490 Bacteria 2111
404 nmdc:mga00v17_3531_c1 3300050491 Bacteria 8079
405 nmdc:mga0yw44_13387_c1 3300050492 Bacteria 4319
406 nmdc:mga0yw44_1964_c1 3300050492 Bacteria 8524
407 nmdc:mga0k408_206_c1 3300050493 Bacteria 31456
408 nmdc:mga0k408_9177_c1 3300050493 Bacteria 5331
409 nmdc:mga06z11_10033_c1 3300050494 Bacteria 4016
410 nmdc:mga06z11_38736_c1 3300050494 Bacteria 2369
411 nmdc:mga07m45_24537_c1 3300050496 Bacteria 3305
412 nmdc:mga07m45_357_c1 3300050496 Bacteria 18685
413 nmdc:mga07m45_48578_c1 3300050496 Bacteria 2387
414 nmdc:mga05p37_103_c1 3300050507 Bacteria 76610
415 nmdc:mga09592_9_c1 3300050508 Bacteria 108110
416 nmdc:mga08y16_285914_c1 3300050511 Bacteria 1700
417 nmdc:mga0n895_44827_c1 3300050512 Bacteria 4313
418 nmdc:mga0sz30_19991_c1 3300050516 Bacteria 2697
419 nmdc:mga0sz30_20530_c2 3300050516 Bacteria 2211
420 Ga0495601_0064344 3300053077 Bacteria 2332
421 Ga0500610_0000858 3300053079 Bacteria 9747
422 Ga0500610_0002041 3300053079 Bacteria 7246
423 Ga0500643_000048 3300053087 Bacteria 147879
424 Ga0500566_0000660 3300053094 Bacteria 19323
425 Ga0500557_000034 3300053105 Bacteria 71225
426 Ga0500593_000730 3300053117 Bacteria 12447
427 Ga0500595_003027 3300053119 Bacteria 7989
428 Ga0500595_004399 3300053119 Bacteria 6330
429 Ga0500595_006348 3300053119 Bacteria 5024
430 Ga0500607_002971 3300053121 Bacteria 12883
431 Ga0500642_0000053 3300053130 Bacteria 71632
432 Ga0500559_0015410 3300053136 Bacteria 3227
433 Ga0500589_034531 3300053147 Bacteria 2360
434 Ga0500590_019230 3300053148 Bacteria 3539
435 Ga0500622_0004177 3300053156 Bacteria 9228
436 Ga0500636_0000016 3300053177 Bacteria 123469
437 Ga0500625_001084 3300053729 Bacteria 8815
438 Ga0500601_000151 3300053737 Bacteria 14438
439 8016619056 8016613128 Bacteria 8794220
440 2507504613 2507262055 Bacteria 8048963
441 2508546041 2508501009 Bacteria 7784016
442 2508694893 2508501042 Bacteria 8719808
443 2508726267 2508501050 Bacteria 9633614
444 2511393299 2511231028 Bacteria 8046582
445 2513626516 2513237092 Bacteria 8341956
446 2513638488 2513237094 Bacteria 8789602
447 2513652379 2513237095 Bacteria 8976980
448 2513699413 2513237102 Bacteria 7703324
449 2513714793 2513237104 Bacteria 10034502
450 2513875593 2513237139 Bacteria 8737671
451 2513893823 2513237141 Bacteria 8496279
452 2514011015 2513237161 Bacteria 8871253
453 2515624175 2515154112 Bacteria 8294334
454 2517102876 2517093001 Bacteria 9002274
455 2524438691 2524023205 Bacteria 8918781
456 2524539541 2524023228 Bacteria 10118060
457 2528851423 2528768022 Bacteria 10457665
458 2587756657 2585428062 Bacteria 6842168
459 2599624229 2599185214 Bacteria 8209958
460 2599672241 2599185226 Bacteria 8233575
461 2599681675 2599185227 Bacteria 8246414
462 2599693689 2599185229 Bacteria 8216126
463 2617347560 2617270735 Bacteria 9163226
464 2617377027 2617270741 Bacteria 8201522
465 2644162702 2643221628 Bacteria 5745828
466 2745080520 2744054633 Bacteria 8678936
467 2793063539 2791355196 Bacteria 7323613
468 2793070448 2791355197 Bacteria 8420563
469 2793077379
470 2805919269 2802429603 Bacteria 8777136
471 2818240748 2816332527 Bacteria 8933356
472 2824608767 2824600985 Bacteria 8488197
473 2824612047 2824609381 Bacteria 8672835
474 2824619251 2824617872 Bacteria 8814715
475 2824628100 2824626560 Bacteria 8813858
476 2824643099 2824635225 Bacteria 8785348
477 2824650518 2824644064 Bacteria 8743947
478 2824657113 2824653114 Bacteria 8493680
479 2824666323 2824661429 Bacteria 9877870
480 2824678694 2824671348 Bacteria 8369588
481 2824695150 2824687955 Bacteria 8360029
482 2824703610 2824696289 Bacteria 8335049
483 2824712408 2824704595 Bacteria 9667483
484 2824723397 2824714736 Bacteria 8717648
485 2824732666 2824723954 Bacteria 8758240
486 2824739628 2824732956 Bacteria 7810675
487 2824747564 2824746037 Bacteria 7911610
488 2824759778 2824753945 Bacteria 9787441
489 2824767713 2824763712 Bacteria 9792355
490 2838129150 2838122688 Bacteria 8803140
491 2841944223 2841941048 Bacteria 8688029
492 2841954603 2841949485 Bacteria 8680857
493 2841963031 2841957949 Bacteria 8652217
494 2841969004 2841966195 Bacteria 8673214
495 2841979779 2841974524 Bacteria 8931498
496 2841989626 2841983080 Bacteria 8395090
497 2842044144 2842038055 Bacteria 8002051
498 2842051867 2842045827 Bacteria 8006841
499 2842677899 2842677519 Bacteria 5615038
500 2847941518 2847939898 Bacteria 8606328
501 2849082426 2849076700 Bacteria 7039503
502 2857516565 2857509624 Bacteria 7472071
503 2874595540 2874590934 Bacteria 8299676
504 2874610312 2874604998 Bacteria 7834745
505 2874615935 2874612657 Bacteria 8252029
506 2874621487 2874620515 Bacteria 8290088
507 2874632996 2874628541 Bacteria 8630250
508 2874647085 2874645413 Bacteria 8214782
509 2876763324 2876761206 Bacteria 10111113
510 2876775734 2876771140 Bacteria 8287509
511 2876823726 2876818435 Bacteria 8274608
512 2879079825 2879074833 Bacteria 8279565
513 2879091294 2879083081 Bacteria 8587928
514 2879102351 2879099564 Bacteria 10442239
515 2879111631 2879110137 Bacteria 8907982
516 2879131096 2879127579 Bacteria 8294491
517 2879150303 2879142872 Bacteria 8267021
518 2881668611 2881665667 Bacteria 8175609
519 2885199313 2885198086 Bacteria 7212419
520 2885212964 2885211737 Bacteria 7212420
521 2885368236 2885366525 Bacteria 8326213
522 2888378764 2888378607 Bacteria 9652610
523 2888391247 2888388044 Bacteria 7304136
524 2888427193 2888419890 Bacteria 7857137
525 2889035024 2889033259 Bacteria 9099371
526 2894233596 2894232714 Bacteria 8834183
527 2904450174 2904449895 Bacteria 6927402
528 2904457003 2904456579 Bacteria 6819253
529 2904544030 2904541872 Bacteria 8915136
530 2904668156 2904666416 Bacteria 8226587
531 2904709410
532 2904719936 2904711408 Bacteria 9771557
533 2906613034
534 2906650004 2906643746 Bacteria 8722424
535 2908746182 2908739725 Bacteria 8628932
536 2908782936 2908775508 Bacteria 8092255
537 2919464813 2919462493 Bacteria 5817112
538 2922366911 2922361189 Bacteria 7436256
539 2922433503
540 2928076836 2928070936 Bacteria 8062541
541 2929162411 2929160207 Bacteria 9075316
542 2929525509 2929520902 Bacteria 6765052
543 2929623724 2929615660 Bacteria 9193770
544 2929632932 2929624759 Bacteria 9339455
545 2932789817 2932784394 Bacteria 9704911
546 2932799596 2932794094 Bacteria 7915132
547 2932805117 2932801729 Bacteria 7987968
548 2932816951 2932809354 Bacteria 9135765
549 2932825592 2932818245 Bacteria 9955613
550 2932829356 2932828146 Bacteria 9745859
551 2933585628 2933577622 Bacteria 9116884
552 2935614185 2935608549 Bacteria 8203142
553 2935617788 2935616580 Bacteria 9032984
554 2935643833 2935638405 Bacteria 10015038
555 2935651446 2935648319 Bacteria 8801166
556 2935659786 2935656913 Bacteria 8965014
557 2935670857 2935665750 Bacteria 9571747
558 2935678190 2935675223 Bacteria 9928132
559 2935692477 2935684952 Bacteria 9590419
560 2935699308 2935694250 Bacteria 9291695
561 2935710115 2935703347 Bacteria 10242284
562 2935721095 2935713505 Bacteria 9608509
563 2935722920 2935722832 Bacteria 9608746
564 2935739784 2935732158 Bacteria 9706831
565 2935748822 2935741537 Bacteria 9707219
566 2935758692 2935750917 Bacteria 9590372
567 2935769074 2935760218 Bacteria 9817913
568 2935775548 2935769743 Bacteria 7878163
569 2935779805 2935777560 Bacteria 8077691
570 2935790076 2935785616 Bacteria 7962367
571 2935798511 2935793552 Bacteria 8012592
572 2935806720 2935801545 Bacteria 9301974
573 2935819197 2935810662 Bacteria 9401221
574 2935826436 2935819856 Bacteria 8261050
575 2935834518 2935827899 Bacteria 10038562
576 2935843757 2935837841 Bacteria 9454360
577 2935851369 2935847175 Bacteria 8228321
578 2935856713 2935855204 Bacteria 9035059
579 2935868192 2935864058 Bacteria 9784707
580 2935879550 2935873716 Bacteria 9632195
581 2935890396 2935883170 Bacteria 7964738
582 2935913333 2935908558 Bacteria 8568796
583 2935922737 2935916978 Bacteria 9113783
584 2935930742 2935926038 Bacteria 8601059
585 2935939924 2935934488 Bacteria 8602579
586 2935946873 2935942939 Bacteria 8599779
587 2935955926 2935951376 Bacteria 8602333
588 2935966220 2935959822 Bacteria 7869783
589 2935972719 2935967501 Bacteria 8603075
590 2935982508 2935975950 Bacteria 8347125
591 2935984551 2935984226 Bacteria 8302647
592 2935997056 2935992306 Bacteria 9802711
593 2936014202 2936011229 Bacteria 8801034
594 2936022889 2936019824 Bacteria 8804134
595 2936031026 2936028420 Bacteria 8965941
596 2936045801 2936037263 Bacteria 9446081
597 2936049147 2936046547 Bacteria 8903709
598 2936055594 2936055302 Bacteria 8785755
599 2940564718 2940556831 Bacteria 9590747
600 2941534884 2941531003 Bacteria 7653939
601 2941545005 2941538514 Bacteria 9402094
602 2945913268 2945909444 Bacteria 7065066
603 2945948834 2945945610 Bacteria 5951079
604 2945972954 2945972063 Bacteria 6086495
605 2945984507 2945984333 Bacteria 7358892
606 2954772969 2954767861 Bacteria 5535784
607 3005490423 3005483717 Bacteria 7877331
608 3005509773 3005506211 Bacteria 6943378
609 3005591126 3005587118 Bacteria 7794411
610 3005595687 3005594810 Bacteria 8716512
611 8006935558 8006933436 Bacteria 10410654
612 8006971543 8006964411 Bacteria 8966052
613 8006975484 8006973647 Bacteria 10679141
614 8006985885 8006984368 Bacteria 9651211
615 8016525576 8016522445 Bacteria 8156687
616 8016539171 8016530956 Bacteria 8155261
617 8016549839 8016548790 Bacteria 8155074
618 8016558247 8016557553 Bacteria 8154380
619 8016568859 8016566248 Bacteria 8158151
620 8016581504 8016575299 Bacteria 8154085
621 8016587161 8016583857 Bacteria 10421953
622 8016596248 8016595262 Bacteria 8149947
623 8016607156 8016603502 Bacteria 8731218
624 8016630526 8016622563 Bacteria 7999408
625 8016636559 8016630954 Bacteria 9217207
626 8017057798 8017057580 Bacteria 10023680
627 8019538838 8019530166 Bacteria 8155624
628 8019549476 8019547302 Bacteria 7996444
629 8019563253 8019555841 Bacteria 9642137
630 8019596033 8019586578 Bacteria 10212056
631 8019612856 8019608314 Bacteria 10042931
632 8019623543 8019619141 Bacteria 9218857
633 8019638607 8019629233 Bacteria 8687553
634 8019641138 8019638758 Bacteria 9062356
635 8019653267 8019648815 Bacteria 10014479
636 8019666407 8019659431 Bacteria 8577854
637 8019676070 8019668869 Bacteria 8791617
638 8019693447 8019687851 Bacteria 8712826
639 8055750768 8055742211 Bacteria 9226248
640 8056677775 8056673599 Bacteria 7871253
641 8056970592 8056967851 Bacteria 9038162
642 JGI25152J39213_1004260
643 JGI25159J45721_1003932
644 JGI25151J46595_10002505
645 JGI25151J46595_10005576
646 JGI25151J46595_10009579
647 JGI25153J46596_10000287
648 JGI25153J46596_10000770
649 JGI25153J46596_10003355
650 JGI25153J46596_10009355
651 JGI25160J50197_1001377
652 JGI25160J50197_1001775
653 JGI25160J50197_1003278
654 JGI25160J50197_1005823
655 JGI25161J50226_1002265
656 Ga0006562J51391_1128434
657 JGI25404J52841_10005189
658 Ga0055526_1008564
659 Ga0055537_1000304
660 Ga0055537_1001934
661 Ga0055524_1006474
662 Ga0055536_1005926
663 Ga0055534_1000289
664 Ga0055534_1002126
665 Ga0055528_1001591
666 Ga0055528_1003827
667 Ga0055540_1001631
668 Ga0055531_10003804
669 Ga0055543_1004070
670 Ga0065165_1005230
671 Ga0065165_1005809
672 Ga0070676_10031697
673 Ga0070676_10038260
674 Ga0070683_100039305
675 Ga0070690_100023721
676 Ga0068869_100016949
677 Ga0068869_100080848
678 Ga0070666_10009437
679 Ga0068868_100162662
680 Ga0070689_100033073
681 Ga0070689_100044429
682 Ga0070691_10010541
683 Ga0070661_100045415
684 Ga0070675_100002125
685 Ga0070671_100001791
686 Ga0070671_100006964
687 Ga0070673_100023748
688 Ga0070667_100014856
689 Ga0070667_100041614
690 Ga0070710_10033043
691 Ga0070711_100030330
692 Ga0070694_100030553
693 Ga0070694_100097773
694 Ga0070663_100052123
695 Ga0070681_10000912
696 Ga0070681_10056927
697 Ga0068867_100060835
698 Ga0070698_100114301
699 Ga0070684_100003171
700 Ga0068853_100080029
701 Ga0068853_100122326
702 Ga0070695_100007971
703 Ga0070695_100066274
704 Ga0070665_100026129
705 Ga0070704_100016770
706 Ga0070704_100044906
707 Ga0070664_100175017
708 Ga0068856_100000985
709 Ga0068852_100068442
710 Ga0068859_100006102
711 Ga0068859_100162215
712 Ga0068864_100001399
713 Ga0068861_100108854
714 Ga0068858_100002055
715 Ga0068860_100000081
716 Ga0068862_100136177
717 Ga0081540_1000288
718 Ga0081540_1001736
719 Ga0081540_1008566
720 Ga0081540_1022190
721 Ga0081540_1024328
722 Ga0075365_10001357
723 Ga0075365_10003047
724 Ga0075368_10018402
725 Ga0075363_100051073
726 Ga0075364_10009520
727 Ga0070712_100069578
728 Ga0075362_10030080
729 Ga0075367_10027409
730 Ga0075369_10009185
731 Ga0075369_10026940
732 Ga0075366_10005798
733 Ga0075366_10010377
734 Ga0075370_10002672
735 Ga0075370_10005589
736 Ga0075370_10010790
737 Ga0075370_10049951
738 Ga0075431_100091691
739 Ga0075434_100038733
740 Ga0075429_100000009
741 Ga0097620_100006102
742 Ga0097620_100162206
743 Ga0099825_1026561
744 Ga0099824_1011197
745 Ga0099823_1030317
746 Ga0099826_10017992
747 Ga0099794_10036237
748 Ga0099794_10048591
749 Ga0105240_10041067
750 Ga0105245_10016774
751 Ga0105247_10005827
752 Ga0105247_10074363
753 Ga0114129_10000666
754 Ga0105243_10002379
755 Ga0105243_10021679
756 Ga0105241_10037608
757 Ga0105241_10072995
758 Ga0105248_10007761
759 Ga0105248_10019842
760 Ga0105248_10108910
761 Ga0105237_10027550
762 Ga0105239_10104555
763 Ga0105246_10017840
764 Ga0157373_10001556
765 Ga0157370_10031200
766 Ga0163162_10018492
767 Ga0163162_10081442
768 Ga0157375_10042884
769 Ga0163163_10027365
770 Ga0163163_10058463
771 Ga0163163_10068269
772 Ga0157380_10069921
773 Ga0182008_10010782
774 Ga0157379_10001791
775 Ga0157379_10067834
776 Ga0157376_10017651
777 Ga0182006_1012521
778 Ga0163161_10001728
779 Ga0214544_1000007
780 Ga0214542_1000007
781 Ga0214545_1000006
782 Ga0214543_1000009
783 Ga0213876_10003562
784 Ga0209436_105643
785 Ga0209563_101630
786 Ga0207425_1000355
787 Ga0209677_100280
788 Ga0209129_1000033
789 Ga0209233_1002614
790 Ga0209233_1005066
791 Ga0209233_1007767
792 Ga0209565_1000120
793 Ga0209565_1000586
794 Ga0209455_1000757
795 Ga0209455_1001166
796 Ga0209673_1000099
797 Ga0209673_1001345
798 Ga0209673_1002340
799 Ga0209130_1000736
800 Ga0209675_1000054
801 Ga0209675_1000539
802 Ga0209675_1001156
803 Ga0209676_1000896
804 Ga0209676_1014410
805 Ga0209025_1000743
806 Ga0209025_1001001
807 Ga0209025_1004122
808 Ga0209564_1000151
809 Ga0209758_1000015
810 Ga0209758_1000027
811 Ga0209758_1000161
812 Ga0209758_1008326
813 Ga0209758_1009956
814 Ga0209758_1012471
815 Ga0209256_1000161
816 Ga0207426_1000027
817 Ga0207426_1000186
818 Ga0207426_1014366
819 Ga0209051_1000483
820 Ga0209051_1000762
821 Ga0209051_1006592
822 Ga0209257_1000982
823 Ga0209257_1004586
824 Ga0207710_10005351
825 Ga0207680_10065495
826 Ga0207647_10009699
827 Ga0207645_10002792
828 Ga0207645_10043844
829 Ga0207707_10000088
830 Ga0207671_10044266
831 Ga0207693_10003980
832 Ga0207693_10073789
833 Ga0207681_10088988
834 Ga0207659_10001206
835 Ga0207700_10094455
836 Ga0207644_10003942
837 Ga0207706_10091654
838 Ga0207706_10139194
839 Ga0207709_10000319
840 Ga0207670_10021485
841 Ga0207711_10015310
842 Ga0207711_10106780
843 Ga0207661_10003596
844 Ga0207667_10060343
845 Ga0207703_10005187
846 Ga0207678_10022304
847 Ga0207702_10000101
848 Ga0207702_10067604
849 Ga0207641_10086148
850 Ga0207648_10005766
851 Ga0207648_10075423
852 Ga0207676_10002950
853 Ga0207674_10139426
854 Ga0207683_10023216
855 Ga0207683_10114047
856 Ga0207683_10126795
857 Ga0207698_10014298
858 Ga0209389_1000062
859 Ga0209589_1000270
860 Ga0209489_100160
861 Ga0209489_100206
862 Ga0209700_101128
863 Ga0209282_1008510
864 Ga0209813_10014859
865 Ga0268266_10026609
866 Ga0268265_10005022
867 Ga0268264_10000048
868 Ga0265337_1003981
869 Ga0265334_10002493
870 Ga0265323_10004871
871 Ga0265336_10000063
872 Ga0307517_10000858
873 Ga0307517_10004361
874 Ga0307517_10071894
875 Ga0307515_10006133
876 Ga0307515_10006378
877 Ga0307515_10051562
878 Ga0307515_10104312
879 Ga0265338_10000154
880 Ga0265324_10004487
881 Ga0316179_1080326
882 Ga0316178_1056355
883 Ga0316180_1104778
884 Ga0265325_10050829
885 Ga0265339_10011726
886 Ga0265339_10017132
887 Ga0307513_10000006
888 Ga0307513_10012594
889 Ga0307509_10006573
890 Ga0307509_10008338
891 Ga0307509_10131197
892 Ga0307408_100012560
893 Ga0307508_10000096
894 Ga0307508_10000282
895 Ga0307508_10043133
896 Ga0307514_10001887
897 Ga0307516_10000394
898 Ga0307516_10009880
899 Ga0307516_10094260
900 Ga0307405_10000862
901 Ga0307406_10001703
902 Ga0307412_10015746
903 Ga0307412_10087555
904 Ga0307416_100034644
905 Ga0307415_100016647
906 Ga0307510_10001691
907 Ga0373939_0009925
908 Ga0373954_0044276
909 Ga0373956_0048657
910 Ga0373943_0007430
911 Ga0373962_0005947
912 Ga0373935_0069006
913 Ga0373947_0063769
914 Ga0373937_0038661
915 Ga0373925_0075488
916 Ga0395899_0063452
917 Ga0395900_0000982
918 Ga0395898_0007529
919 Ga0395905_0009385
920 Ga0436364_0987862
921 Ga0395901_0198516
922 Ga0436365_0467329
923 Ga0436365_0523972
924 Ga0436365_0900223
925 Ga0436365_1554337
926 Ga0439442_009893
927 Ga0450906_003335
928 Ga0439434_0001812
929 Ga0466972_0000389
930 Ga0466972_0016682
931 Ga0466965_0019002
932 Ga0466957_0081077
933 Ga0466960_0003626
934 Ga0466960_0027138
935 Ga0466959_0001041
936 Ga0466959_0094016
937 Ga0495627_006187
938 Ga0495592_0045582
939 Ga0495603_0004846
940 Ga0495603_0105223
941 Ga0495629_0062637
942 Ga0495629_0116528
943 Ga0495638_0008040
944 Ga0495638_0010722
945 Ga0495651_0001368
946 Ga0495651_0015758
947 Ga0495580_0023923
948 Ga0495582_0015480
949 Ga0495639_0019481
950 Ga0495639_0020690
951 Ga0495606_0006211
952 Ga0495606_0043038
953 Ga0495610_0049057
954 Ga0495628_0065645
955 Ga0495628_0135879
956 Ga0495632_0024422
957 Ga0495637_0007902
958 Ga0495652_0002998
959 Ga0495652_0125912
960 Ga0495640_0017677
961 Ga0495587_0028787
962 Ga0495667_0021301
963 Ga0495667_0053032
964 Ga0495667_0076937
965 Ga0495656_0014494
966 Ga0495668_0052203
967 Ga0495625_0004404
968 Ga0495635_0084320
969 Ga0495588_0016410
970 Ga0495588_0067528
971 Ga0495599_0030863
972 Ga0495599_0048050
973 Ga0495623_0002315
974 Ga0495646_0063010
975 Ga0495647_0003961
976 Ga0495658_0057622
977 Ga0495658_0077153
978 Ga0495624_0074594
979 Ga0495670_0033558
980 Ga0495649_0057416
981 Ga0495600_0022223
982 Ga0495600_0025430
983 Ga0495581_0017913
984 Ga0495604_0006550
985 Ga0495604_0012111
986 Ga0495674_0032543
987 Ga0495676_0020791
988 Ga0495676_0039036
989 Ga0495687_046600
990 Ga0495675_0057141
991 Ga0495684_0004001
992 Ga0495602_0003127
993 Ga0495602_0022173
994 Ga0496100_0022825
995 Ga0496101_0041168
996 Ga0496102_0016990
997 Ga0496102_0158402
998 Ga0496102_0165405
999 Ga0496104_0002216
1000 Ga0496104_0056314
1001 Ga0496104_0101883
1002 Ga0496105_0001007
1003 Ga0496105_0013889
1004 Ga0496105_0095140
1005 Ga0496106_0105512
1006 Ga0496107_0023473
1007 Ga0496108_0066102
1008 Ga0496108_0107372
1009 Ga0496110_0074838
1010 Ga0496111_0097149
1011 Ga0496112_0177218
1012 Ga0496113_0096581
1013 Ga0496114_0032491
1014 Ga0496114_0056558
1015 Ga0496114_0110802
1016 Ga0496116_0018549
1017 Ga0496117_0057133
1018 Ga0496118_0001892
1019 Ga0496118_0014666
1020 Ga0496118_0059557
1021 Ga0496118_0073321
1022 Ga0496119_0029936
1023 Ga0496119_0049999
1024 Ga0496120_0005154
1025 Ga0496121_0000041
1026 Ga0496121_0001954
1027 Ga0496121_0002323
1028 Ga0496121_0004971
1029 Ga0496121_0044035
1030 Ga0496121_0072021
1031 Ga0496121_0111238
1032 Ga0496124_0001646
1033 Ga0496124_0076359
1034 Ga0496124_0173209
1035 Ga0496125_0000407
1036 Ga0496126_0002010
1037 Ga0496126_0044068
1038 Ga0496126_0045529
1039 Ga0496126_0154074
1040 Ga0495682_0021388
1041 Ga0501249_008119
1042 nmdc:mga03683_2061_c2
1043 nmdc:mga03683_4926_c2
1044 nmdc:mga03n38_36618_c1
1045 nmdc:mga00v17_3531_c1
1046 nmdc:mga0yw44_13387_c1
1047 nmdc:mga0yw44_1964_c1
1048 nmdc:mga0k408_206_c1
1049 nmdc:mga0k408_9177_c1
1050 nmdc:mga06z11_10033_c1
1051 nmdc:mga06z11_38736_c1
1052 nmdc:mga07m45_24537_c1
1053 nmdc:mga07m45_357_c1
1054 nmdc:mga07m45_48578_c1
1055 nmdc:mga05p37_103_c1
1056 nmdc:mga09592_9_c1
1057 nmdc:mga08y16_285914_c1
1058 nmdc:mga0n895_44827_c1
1059 nmdc:mga0sz30_19991_c1
1060 nmdc:mga0sz30_20530_c2
1061 Ga0495601_0064344
1062 Ga0500610_0000858
1063 Ga0500610_0002041
1064 Ga0500643_000048
1065 Ga0500566_0000660
1066 Ga0500557_000034
1067 Ga0500593_000730
1068 Ga0500595_003027
1069 Ga0500595_004399
1070 Ga0500595_006348
1071 Ga0500607_002971
1072 Ga0500642_0000053
1073 Ga0500559_0015410
1074 Ga0500589_034531
1075 Ga0500590_019230
1076 Ga0500622_0004177
1077 Ga0500636_0000016
1078 Ga0500625_001084
1079 Ga0500601_000151
1080 8016619056
1081 2507504613
1082 2508546041
1083 2508694893
1084 2508726267
1085 2511393299
1086 2513626516
1087 2513638488
1088 2513652379
1089 2513699413
1090 2513714793
1091 2513875593
1092 2513893823
1093 2514011015
1094 2515624175
1095 2517102876
1096 2524438691
1097 2524539541
1098 2528851423
1099 2587756657
1100 2599624229
1101 2599672241
1102 2599681675
1103 2599693689
1104 2617347560
1105 2617377027
1106 2644162702
1107 2745080520
1108 2793063539
1109 2793070448
1110 2793077379
1111 2805919269
1112 2818240748
1113 2824608767
1114 2824612047
1115 2824619251
1116 2824628100
1117 2824643099
1118 2824650518
1119 2824657113
1120 2824666323
1121 2824678694
1122 2824695150
1123 2824703610
1124 2824712408
1125 2824723397
1126 2824732666
1127 2824739628
1128 2824747564
1129 2824759778
1130 2824767713
1131 2838129150
1132 2841944223
1133 2841954603
1134 2841963031
1135 2841969004
1136 2841979779
1137 2841989626
1138 2842044144
1139 2842051867
1140 2842677899
1141 2847941518
1142 2849082426
1143 2857516565
1144 2874595540
1145 2874610312
1146 2874615935
1147 2874621487
1148 2874632996
1149 2874647085
1150 2876763324
1151 2876775734
1152 2876823726
1153 2879079825
1154 2879091294
1155 2879102351
1156 2879111631
1157 2879131096
1158 2879150303
1159 2881668611
1160 2885199313
1161 2885212964
1162 2885368236
1163 2888378764
1164 2888391247
1165 2888427193
1166 2889035024
1167 2894233596
1168 2904450174
1169 2904457003
1170 2904544030
1171 2904668156
1172 2904709410
1173 2904719936
1174 2906613034
1175 2906650004
1176 2908746182
1177 2908782936
1178 2919464813
1179 2922366911
1180 2922433503
1181 2928076836
1182 2929162411
1183 2929525509
1184 2929623724
1185 2929632932
1186 2932789817
1187 2932799596
1188 2932805117
1189 2932816951
1190 2932825592
1191 2932829356
1192 2933585628
1193 2935614185
1194 2935617788
1195 2935643833
1196 2935651446
1197 2935659786
1198 2935670857
1199 2935678190
1200 2935692477
1201 2935699308
1202 2935710115
1203 2935721095
1204 2935722920
1205 2935739784
1206 2935748822
1207 2935758692
1208 2935769074
1209 2935775548
1210 2935779805
1211 2935790076
1212 2935798511
1213 2935806720
1214 2935819197
1215 2935826436
1216 2935834518
1217 2935843757
1218 2935851369
1219 2935856713
1220 2935868192
1221 2935879550
1222 2935890396
1223 2935913333
1224 2935922737
1225 2935930742
1226 2935939924
1227 2935946873
1228 2935955926
1229 2935966220
1230 2935972719
1231 2935982508
1232 2935984551
1233 2935997056
1234 2936014202
1235 2936022889
1236 2936031026
1237 2936045801
1238 2936049147
1239 2936055594
1240 2940564718
1241 2941534884
1242 2941545005
1243 2945913268
1244 2945948834
1245 2945972954
1246 2945984507
1247 2954772969
1248 3005490423
1249 3005509773
1250 3005591126
1251 3005595687
1252 8006935558
1253 8006971543
1254 8006975484
1255 8006985885
1256 8016525576
1257 8016539171
1258 8016549839
1259 8016558247
1260 8016568859
1261 8016581504
1262 8016587161
1263 8016596248
1264 8016607156
1265 8016630526
1266 8016636559
1267 8017057798
1268 8019538838
1269 8019549476
1270 8019563253
1271 8019596033
1272 8019612856
1273 8019623543
1274 8019638607
1275 8019641138
1276 8019653267
1277 8019666407
1278 8019676070
1279 8019693447
1280 8055750768
1281 8056677775
1282 8056970592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07519

Tannase

Tannase and feruloyl esterase

77

545

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fat-assembly2.cif.gz_B the crystal structure of a feruloyl esterase c from fusarium oxysporum. 0.8614 59 531
8ekg-assembly6.cif.gz_F mhetase variant thr159val, met192tyr, tyr252phe, tyr503trp 0.8552 56 531
6qga-assembly5.cif.gz_E crystal structure of ideonella sakaiensis mhetase bound to the non-hydrolyzable ligand mheta 0.8548 56 530
6g21-assembly2.cif.gz_B crystal structure of an esterase from aspergillus oryzae 0.8546 59 530
6jtt-assembly1.cif.gz_A mhetase in complex with bhet 0.8542 56 531
ID Description Score Start End Superfamily
af_A0A0R0KP61_46_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7445 148 212 3.40.50.1820
af_Q0J1A5_6_193_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.69 160 221 3.40.50.1820
af_A0A1P8BB23_1_78_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.67 58 81 2.20.25.80
af_C6KSP1_662_765_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6683 58 82 2.60.40.10
af_Q8R1G2_23_244_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6648 76 210 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A809XGI0-F1-model_v4 Feruloyl esterase 0.9938 43 531 GO:0046872
GO:0052689
AF-A0A7Z2Q221-F1-model_v4 Tannase/feruloyl esterase family alpha/beta hydrolase 0.9935 43 531 GO:0046872
GO:0052689
AF-A0A7W6WY54-F1-model_v4 Feruloyl esterase (EC 3.1.1.73) 0.9928 43 531 GO:0030600
GO:0046872
AF-A0A317HQA1-F1-model_v4 deleted 0.9922 43 442
AF-M4ZBS0-F1-model_v4 Feruloyl esterase 0.9916 46 531 GO:0046872
GO:0052689

Map