F471802

General Info

Members Datasets Scaffolds Average Seq Length
641 389 1282 333

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0867129|Ga0436361_0867129_5953_7080
Length 375
Sequence MTALSILELARVAENTDARGALDNARDLAAHAEQWGYRRIWVAEHHNMPGIASAATSIVLAHIAAGTKTIRVGAGGIMLPNHAPYVIAEQFGTLARLFPGRIDLGLGRAPGADQLTLRALRRAPEAADTFPQDVLELQAFLAPAVPGQRIQAVPAAGTQVPLWILGSSNFGAMLAAELGLPYAFASHFAPELLIPALKIYRDRFKPSQQLDRPYAMVGVNIIAAETDEEAKRLATTQQMSFTNIFRGARGLSQPPIDDIETYWSPMEKAQAMRMLARSIVGSRDTVRAGIAALVAETAADELIVVSDVYDHAARLRSFELIAEAANADHSHSSIRGDPFVLTALWGAAAAASRDVLIAAARSAQLMARFLTYICQ

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
74 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
308 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
313 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
319 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
320 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
321 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
322 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
326 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
327 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
328 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
332 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
333 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
334 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
337 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
338 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
341 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
342 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
343 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
344 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
345 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
346 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
347 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
348 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
349 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
350 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
351 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
352 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
353 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
354 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
355 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
356 2738541293 Rhizobium sp. GV031 Isolate Unclassified
357 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
358 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
359 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
360 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
361 2857581216 Bacillus sp. R-71922 Isolate Unclassified
362 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
363 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
364 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
365 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
366 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
367 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
368 2904699407
369 2906610324
370 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
371 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
372 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
373 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
374 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
375 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
376 2922425934
377 2932401849 Devosia sp. 2618 Isolate Rhizosphere
378 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
379 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
380 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
381 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
382 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
383 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
384 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
385 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
386 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
387 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
388 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
389 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.63
Metatranscriptomes 0.16
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.54
Nodule 4.21
Rhizoplane 5.46
Rhizosphere 59.13
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0867129 3300039447 Bacteria 8742
2 SwRhRL3b_contig_2981330 2162886006 Bacteria 3172
3 JGI24736J21556_1000010 3300001904 Bacteria 34670
4 JGI24752J21851_1000101 3300001976 Bacteria 11390
5 JGI24740J21852_10015123 3300001979 Bacteria 2824
6 JGI24737J22298_10009994 3300001990 Bacteria 3141
7 JGI24738J21930_10000890 3300002075 Bacteria 8569
8 JGI24749J21850_1000094 3300002076 Bacteria 15838
9 JGI24749J21850_1003853 3300002076 Bacteria 2094
10 JGI24034J26672_10000007 3300002239 Bacteria 224370
11 JGI24742J22300_10001056 3300002244 Bacteria 4244
12 JGI24751J29686_10000093 3300002459 Bacteria 50074
13 JGI24751J29686_10008233 3300002459 Bacteria 2132
14 JGI24751J29686_10030675 3300002459 Bacteria 1115
15 JGI25152J39213_1000248 3300002773 Bacteria 36228
16 JGI25150J39212_1000017 3300002774 Bacteria 150316
17 JGI25151J46595_10000007 3300003187 Bacteria 411751
18 rootH1_10158182 3300003316 Bacteria 2213
19 Ga0065165_1000003 3300005262 Bacteria 390701
20 Ga0065704_10088746 3300005289 Bacteria 2914
21 Ga0065707_10082085 3300005295 Bacteria 22398
22 Ga0065707_10082467 3300005295 Bacteria 14795
23 Ga0070683_100079280 3300005329 Bacteria 3073
24 Ga0070690_100000220 3300005330 Bacteria 29743
25 Ga0070670_100000005 3300005331 Bacteria 351569
26 Ga0070670_100001742 3300005331 Bacteria 17720
27 Ga0070670_100159839 3300005331 Bacteria 1952
28 Ga0068869_100126576 3300005334 Bacteria 1960
29 Ga0070666_10000017 3300005335 Bacteria 190526
30 Ga0068868_100076952 3300005338 Bacteria 2668
31 Ga0070660_100188831 3300005339 Bacteria 1669
32 Ga0070660_100230379 3300005339 Bacteria 1507
33 Ga0070661_100028883 3300005344 Bacteria 4002
34 Ga0070668_100003872 3300005347 Bacteria 11047
35 Ga0070668_100214625 3300005347 Bacteria 1584
36 Ga0070669_100000117 3300005353 Bacteria 74010
37 Ga0070669_100000195 3300005353 Bacteria 53791
38 Ga0070671_100000957 3300005355 Bacteria 21153
39 Ga0070671_100038362 3300005355 Bacteria 3976
40 Ga0070674_100042247 3300005356 Bacteria 3095
41 Ga0070688_100009092 3300005365 Bacteria 5419
42 Ga0070667_100009319 3300005367 Bacteria 8139
43 Ga0070667_100040764 3300005367 Bacteria 3895
44 Ga0070667_100207690 3300005367 Bacteria 1740
45 Ga0070714_100168595 3300005435 Bacteria 1986
46 Ga0070710_10094702 3300005437 Bacteria 1767
47 Ga0070700_100036088 3300005441 Bacteria 2996
48 Ga0070663_100041853 3300005455 Bacteria 3216
49 Ga0070663_100334593 3300005455 Bacteria 1221
50 Ga0070678_100058366 3300005456 Bacteria 2832
51 Ga0070678_100136373 3300005456 Bacteria 1957
52 Ga0070662_100100596 3300005457 Bacteria 2187
53 Ga0070685_10000126 3300005466 Bacteria 48870
54 Ga0070685_10031974 3300005466 Bacteria 2944
55 Ga0070706_100005764 3300005467 Bacteria 11765
56 Ga0070698_100167700 3300005471 Bacteria 2137
57 Ga0070684_100042870 3300005535 Bacteria 3907
58 Ga0070684_100175915 3300005535 Bacteria 1945
59 Ga0068853_100371555 3300005539 Bacteria 1334
60 Ga0070686_100000014 3300005544 Bacteria 166729
61 Ga0070665_100000042 3300005548 Bacteria 292582
62 Ga0070665_100053493 3300005548 Bacteria 4049
63 Ga0070665_100065878 3300005548 Bacteria 3633
64 Ga0070665_100096540 3300005548 Bacteria 2960
65 Ga0070665_100650035 3300005548 Bacteria 1067
66 Ga0068857_100041508 3300005577 Bacteria 4080
67 Ga0068857_100274416 3300005577 Bacteria 1550
68 Ga0068854_100010329 3300005578 Bacteria 6049
69 Ga0068854_100053641 3300005578 Bacteria 2896
70 Ga0068856_100394527 3300005614 Bacteria 1403
71 Ga0068852_100306354 3300005616 Bacteria 1539
72 Ga0068859_100006154 3300005617 Bacteria 12201
73 Ga0068859_100007945 3300005617 Bacteria 10762
74 Ga0068859_100165529 3300005617 Bacteria 2291
75 Ga0068864_100000011 3300005618 Bacteria 350056
76 Ga0068864_100030017 3300005618 Bacteria 4608
77 Ga0068861_100016906 3300005719 Bacteria 5171
78 Ga0068861_100092651 3300005719 Bacteria 2387
79 Ga0068863_100000068 3300005841 Bacteria 117128
80 Ga0068863_100155653 3300005841 Bacteria 2188
81 Ga0068858_100007337 3300005842 Bacteria 10669
82 Ga0068860_100000062 3300005843 Bacteria 190526
83 Ga0068860_100001177 3300005843 Bacteria 28643
84 Ga0068862_100000011 3300005844 Bacteria 270105
85 Ga0068862_100000539 3300005844 Bacteria 39582
86 Ga0068862_100007709 3300005844 Bacteria 8903
87 Ga0068862_100196668 3300005844 Bacteria 1816
88 Ga0081540_1080548 3300005983 Bacteria 1467
89 Ga0075365_10010554 3300006038 Bacteria 5385
90 Ga0075365_10012009 3300006038 Bacteria 5120
91 Ga0075365_10055582 3300006038 Bacteria 2628
92 Ga0075365_10341917 3300006038 Bacteria 1054
93 Ga0075363_100029834 3300006048 Bacteria 2818
94 Ga0075364_10022338 3300006051 Bacteria 3994
95 Ga0070712_100423387 3300006175 Bacteria 1104
96 Ga0075362_10016045 3300006177 Bacteria 3060
97 Ga0075362_10090474 3300006177 Bacteria 1420
98 Ga0075367_10013857 3300006178 Bacteria 4349
99 Ga0075367_10123878 3300006178 Bacteria 1594
100 Ga0075367_10165173 3300006178 Bacteria 1377
101 Ga0075369_10028591 3300006186 Bacteria 2337
102 Ga0097621_100116417 3300006237 Bacteria 2263
103 Ga0075370_10042630 3300006353 Bacteria 2564
104 Ga0075370_10042729 3300006353 Bacteria 2560
105 Ga0075370_10107483 3300006353 Bacteria 1618
106 Ga0068871_100317134 3300006358 Bacteria 1372
107 Ga0075428_100015371 3300006844 Bacteria 8488
108 Ga0075430_100078929 3300006846 Bacteria 2759
109 Ga0075430_100192093 3300006846 Bacteria 1697
110 Ga0075431_100001670 3300006847 Bacteria 20815
111 Ga0075431_100011120 3300006847 Bacteria 9060
112 Ga0075429_100016750 3300006880 Bacteria 6347
113 Ga0097620_100006154 3300006931 Bacteria 12201
114 Ga0097620_100007945 3300006931 Bacteria 10762
115 Ga0097620_100165529 3300006931 Bacteria 2291
116 Ga0099824_1016589 3300006942 Bacteria 6634
117 Ga0099822_1000080 3300006943 Bacteria 54304
118 Ga0099794_10030922 3300007265 Bacteria 2503
119 Ga0099794_10113610 3300007265 Bacteria 1358
120 Ga0105250_10059382 3300009092 Bacteria 1536
121 Ga0105240_10099394 3300009093 Bacteria 3541
122 Ga0105240_10105725 3300009093 Bacteria 3416
123 Ga0105240_10297240 3300009093 Bacteria 1848
124 Ga0111539_10052231 3300009094 Bacteria 4866
125 Ga0105245_10255857 3300009098 Bacteria 1703
126 Ga0105247_10002648 3300009101 Bacteria 12061
127 Ga0105247_10056273 3300009101 Bacteria 2429
128 Ga0114129_10043198 3300009147 Bacteria 6342
129 Ga0114129_10189111 3300009147 Bacteria 2797
130 Ga0105243_10029573 3300009148 Bacteria 4214
131 Ga0105243_10117459 3300009148 Bacteria 2236
132 Ga0105248_10000069 3300009177 Bacteria 120989
133 Ga0105248_10075949 3300009177 Bacteria 3776
134 Ga0105237_10128438 3300009545 Bacteria 2529
135 Ga0105237_10205236 3300009545 Bacteria 1971
136 Ga0105238_10186071 3300009551 Bacteria 2053
137 Ga0105249_10000012 3300009553 Bacteria 292640
138 Ga0105249_10000417 3300009553 Bacteria 40603
139 Ga0105249_10532397 3300009553 Bacteria 1224
140 Ga0099796_10016094 3300010159 Bacteria 2202
141 Ga0157326_1000271 3300012513 Bacteria 6021
142 Ga0157369_10010862 3300013105 Bacteria 10373
143 Ga0157374_10004876 3300013296 Bacteria 11254
144 Ga0157378_10142310 3300013297 Bacteria 2228
145 Ga0157378_10199746 3300013297 Bacteria 1891
146 Ga0163162_10397312 3300013306 Bacteria 1511
147 Ga0163162_10467321 3300013306 Bacteria 1393
148 Ga0157375_10536893 3300013308 Bacteria 1332
149 Ga0163163_10146225 3300014325 Bacteria 2407
150 Ga0163163_10175652 3300014325 Bacteria 2188
151 Ga0157380_10000336 3300014326 Bacteria 28018
152 Ga0157380_10000363 3300014326 Bacteria 27231
153 Ga0157380_10001431 3300014326 Bacteria 15623
154 Ga0157380_10023613 3300014326 Bacteria 4641
155 Ga0157379_10047121 3300014968 Bacteria 3845
156 Ga0157376_10007594 3300014969 Bacteria 7757
157 Ga0157376_10099816 3300014969 Bacteria 2533
158 Ga0157376_10272418 3300014969 Unclassified 1591
159 Ga0163161_10000025 3300017792 Bacteria 201127
160 Ga0163161_10345614 3300017792 Bacteria 1181
161 Ga0213871_10001049 3300021441 Bacteria 4366
162 Ga0224572_1003894 3300024225 Bacteria 2556
163 Ga0207425_1000018 3300025245 Bacteria 411841
164 Ga0209129_1000026 3300025258 Bacteria 411839
165 Ga0209673_1002161 3300025273 Bacteria 14548
166 Ga0209130_1000036 3300025284 Bacteria 284111
167 Ga0209025_1000035 3300025294 Bacteria 411841
168 Ga0209564_1000687 3300025295 Bacteria 49778
169 Ga0209758_1000040 3300025297 Bacteria 411841
170 Ga0209758_1000580 3300025297 Bacteria 57122
171 Ga0207426_1022199 3300025302 Bacteria 2182
172 Ga0207656_10014803 3300025321 Bacteria 3013
173 Ga0207692_10052038 3300025898 Bacteria 2079
174 Ga0207642_10142581 3300025899 Bacteria 1265
175 Ga0207710_10006025 3300025900 Bacteria 5196
176 Ga0207710_10063277 3300025900 Bacteria 1683
177 Ga0207680_10000012 3300025903 Bacteria 293810
178 Ga0207647_10000205 3300025904 Bacteria 48382
179 Ga0207643_10051090 3300025908 Bacteria 2346
180 Ga0207684_10019211 3300025910 Bacteria 5846
181 Ga0207684_10377625 3300025910 Bacteria 1219
182 Ga0207695_10056865 3300025913 Bacteria 4068
183 Ga0207695_10059027 3300025913 Bacteria 3981
184 Ga0207695_10109750 3300025913 Bacteria 2740
185 Ga0207671_10079079 3300025914 Bacteria 2464
186 Ga0207671_10264200 3300025914 Bacteria 1355
187 Ga0207657_10103719 3300025919 Bacteria 2357
188 Ga0207649_10100142 3300025920 Bacteria 1916
189 Ga0207649_10309221 3300025920 Bacteria 1158
190 Ga0207681_10000001 3300025923 Bacteria 1105841
191 Ga0207681_10002813 3300025923 Bacteria 11012
192 Ga0207681_10119222 3300025923 Bacteria 1933
193 Ga0207694_10002672 3300025924 Bacteria 14432
194 Ga0207694_10333970 3300025924 Bacteria 1253
195 Ga0207650_10000018 3300025925 Bacteria 352120
196 Ga0207650_10000351 3300025925 Bacteria 44301
197 Ga0207650_10014735 3300025925 Bacteria 5434
198 Ga0207700_10108274 3300025928 Bacteria 2231
199 Ga0207644_10001121 3300025931 Bacteria 17196
200 Ga0207644_10138727 3300025931 Bacteria 1870
201 Ga0207706_10061848 3300025933 Bacteria 3298
202 Ga0207709_10019146 3300025935 Bacteria 3844
203 Ga0207670_10065835 3300025936 Bacteria 2488
204 Ga0207669_10003218 3300025937 Bacteria 7058
205 Ga0207669_10173849 3300025937 Bacteria 1536
206 Ga0207665_10076986 3300025939 Bacteria 2289
207 Ga0207711_10001064 3300025941 Bacteria 26287
208 Ga0207711_10018206 3300025941 Bacteria 5839
209 Ga0207711_10072585 3300025941 Bacteria 2990
210 Ga0207689_10002175 3300025942 Bacteria 18426
211 Ga0207689_10171488 3300025942 Bacteria 1788
212 Ga0207689_10288036 3300025942 Bacteria 1360
213 Ga0207661_10066191 3300025944 Bacteria 2935
214 Ga0207667_10044826 3300025949 Bacteria 4685
215 Ga0207667_10381121 3300025949 Bacteria 1437
216 Ga0207712_10000021 3300025961 Bacteria 292649
217 Ga0207712_10000308 3300025961 Bacteria 44940
218 Ga0207668_10002839 3300025972 Bacteria 10150
219 Ga0207668_10007464 3300025972 Bacteria 6503
220 Ga0207668_10140147 3300025972 Bacteria 1858
221 Ga0207658_10006231 3300025986 Bacteria 8152
222 Ga0207658_10011493 3300025986 Bacteria 6026
223 Ga0207703_10002599 3300026035 Bacteria 15584
224 Ga0207639_10079533 3300026041 Bacteria 2591
225 Ga0207639_10097219 3300026041 Bacteria 2371
226 Ga0207678_10007112 3300026067 Bacteria 9927
227 Ga0207678_10049471 3300026067 Bacteria 3633
228 Ga0207678_10360357 3300026067 Bacteria 1255
229 Ga0207708_10108433 3300026075 Bacteria 2154
230 Ga0207702_10004678 3300026078 Bacteria 12098
231 Ga0207702_10214867 3300026078 Bacteria 1789
232 Ga0207641_10000037 3300026088 Bacteria 206551
233 Ga0207641_10032573 3300026088 Bacteria 4327
234 Ga0207676_10000004 3300026095 Bacteria 725417
235 Ga0207676_10001393 3300026095 Bacteria 17980
236 Ga0207674_10092209 3300026116 Bacteria 3019
237 Ga0207674_10315790 3300026116 Bacteria 1512
238 Ga0207675_100000088 3300026118 Bacteria 71728
239 Ga0207675_100002743 3300026118 Bacteria 17329
240 Ga0207683_10038196 3300026121 Bacteria 4183
241 Ga0207683_10200465 3300026121 Bacteria 1814
242 Ga0207698_10476550 3300026142 Bacteria 1210
243 Ga0209589_1000003 3300027357 Bacteria 629130
244 Ga0209489_100003 3300027361 Bacteria 663105
245 Ga0209700_100003 3300027363 Bacteria 663105
246 Ga0209813_10007367 3300027866 Bacteria 2739
247 Ga0268266_10000054 3300028379 Bacteria 292717
248 Ga0268266_10001006 3300028379 Bacteria 35541
249 Ga0268266_10002199 3300028379 Bacteria 21331
250 Ga0268266_10085662 3300028379 Bacteria 2753
251 Ga0268265_10000002 3300028380 Bacteria 1035381
252 Ga0268265_10000092 3300028380 Bacteria 114086
253 Ga0268265_10001870 3300028380 Bacteria 16741
254 Ga0268265_10176345 3300028380 Bacteria 1832
255 Ga0268264_10000074 3300028381 Bacteria 259555
256 Ga0268264_10009761 3300028381 Bacteria 7947
257 Ga0265334_10000368 3300028573 Bacteria 24121
258 Ga0307517_10000436 3300028786 Bacteria 71537
259 Ga0307515_10086799 3300028794 Bacteria 3983
260 Ga0265338_10039958 3300028800 Bacteria 4414
261 Ga0307511_10157383 3300030521 Bacteria 1286
262 Ga0265762_1000856 3300030760 Bacteria 5419
263 Ga0265330_10025616 3300031235 Bacteria 2673
264 Ga0265330_10108874 3300031235 Bacteria 1184
265 Ga0265332_10014874 3300031238 Bacteria 3440
266 Ga0265332_10063930 3300031238 Bacteria 1572
267 Ga0265325_10035189 3300031241 Bacteria 2662
268 Ga0265325_10094152 3300031241 Bacteria 1473
269 Ga0265325_10136032 3300031241 Bacteria 1172
270 Ga0265316_10097184 3300031344 Bacteria 2242
271 Ga0307513_10098200 3300031456 Bacteria 2961
272 Ga0307513_10126261 3300031456 Bacteria 2513
273 Ga0307509_10202144 3300031507 Bacteria 1822
274 Ga0307408_100002351 3300031548 Bacteria 13357
275 Ga0307508_10004588 3300031616 Bacteria 13442
276 Ga0307508_10067357 3300031616 Bacteria 3149
277 Ga0307508_10151789 3300031616 Bacteria 1921
278 Ga0265314_10003102 3300031711 Bacteria 16352
279 Ga0265314_10003222 3300031711 Bacteria 15968
280 Ga0265314_10022562 3300031711 Bacteria 4821
281 Ga0307516_10121555 3300031730 Bacteria 2401
282 Ga0307518_10017160 3300031838 Bacteria 5194
283 Ga0307406_10032279 3300031901 Bacteria 3196
284 Ga0307406_10159037 3300031901 Bacteria 1621
285 Ga0307407_10111374 3300031903 Bacteria 1719
286 Ga0307412_10001600 3300031911 Bacteria 12476
287 Ga0307412_10017030 3300031911 Bacteria 4343
288 Ga0307412_10191457 3300031911 Bacteria 1547
289 Ga0307409_100118966 3300031995 Bacteria 2233
290 Ga0307409_100424110 3300031995 Bacteria 1277
291 Ga0307416_100076485 3300032002 Bacteria 2806
292 Ga0307416_100291692 3300032002 Bacteria 1615
293 Ga0307411_10134689 3300032005 Bacteria 1811
294 Ga0307510_10013323 3300033180 Bacteria 9751
295 Ga0307510_10060743 3300033180 Bacteria 3885
296 Ga0307510_10131153 3300033180 Bacteria 2179
297 Ga0307510_10184448 3300033180 Bacteria 1644
298 Ga0373923_0061221 3300035111 Bacteria 1599
299 Ga0373954_0100233 3300035118 Bacteria 1397
300 Ga0373924_0052421 3300035410 Bacteria 1693
301 Ga0373935_0053693 3300035692 Bacteria 2564
302 Ga0373927_0002643 3300035695 Bacteria 13052
303 Ga0373947_0049386 3300035725 Bacteria 2527
304 Ga0373937_0054468 3300036401 Bacteria 3671
305 Ga0373925_0054637 3300037068 Bacteria 2987
306 Ga0395898_0228495 3300037466 Bacteria 1775
307 Ga0395905_0075831 3300037471 Bacteria 3152
308 Ga0436365_0736289 3300039437 Bacteria 1508
309 Ga0436365_0811379 3300039437 Bacteria 2506
310 Ga0436365_0999681 3300039437 Bacteria 7441
311 Ga0436360_0111369 3300039438 Bacteria 1243
312 Ga0436362_0235327 3300039453 Bacteria 2559
313 Ga0451800_0309253 3300041459 Bacteria 2584
314 Ga0451807_1223198 3300041486 Bacteria 2672
315 Ga0466971_0093985 3300044719 Bacteria 1374
316 Ga0466957_0052561 3300044842 Bacteria 2481
317 Ga0495617_008389 3300046452 Bacteria 3563
318 Ga0495603_0076759 3300046455 Bacteria 1961
319 Ga0495629_0225896 3300046459 Bacteria 1291
320 Ga0495638_0005953 3300046460 Bacteria 8951
321 Ga0495650_0051062 3300046471 Bacteria 1706
322 Ga0495605_0021219 3300046474 Bacteria 3443
323 Ga0495662_0018094 3300046476 Bacteria 3409
324 Ga0495664_0051340 3300046477 Bacteria 2448
325 Ga0495584_0079845 3300046491 Bacteria 1646
326 Ga0495584_0101229 3300046491 Bacteria 1456
327 Ga0495594_0171530 3300046499 Bacteria 1234
328 Ga0495610_0022728 3300046512 Bacteria 3423
329 Ga0495616_0026150 3300046513 Bacteria 3111
330 Ga0495618_0101672 3300046514 Bacteria 1840
331 Ga0495620_0000739 3300046515 Bacteria 20090
332 Ga0495631_0033309 3300046518 Bacteria 2315
333 Ga0495632_0000688 3300046519 Bacteria 30781
334 Ga0495632_0095401 3300046519 Bacteria 1405
335 Ga0495632_0097102 3300046519 Bacteria 1391
336 Ga0495643_0063384 3300046522 Bacteria 1955
337 Ga0495644_0069694 3300046523 Bacteria 1321
338 Ga0495648_0002965 3300046524 Bacteria 15229
339 Ga0495648_0007680 3300046524 Bacteria 8597
340 Ga0495663_0038796 3300046525 Bacteria 1441
341 Ga0495654_0027265 3300046530 Bacteria 2930
342 Ga0495654_0070103 3300046530 Bacteria 1663
343 Ga0495640_0061098 3300046533 Bacteria 2561
344 Ga0495597_0009659 3300046542 Bacteria 4754
345 Ga0495622_0052172 3300046557 Bacteria 1897
346 Ga0495656_0007471 3300046615 Bacteria 3860
347 Ga0495656_0028533 3300046615 Bacteria 2239
348 Ga0495668_0009886 3300046616 Bacteria 5818
349 Ga0495668_0038281 3300046616 Bacteria 2681
350 Ga0495668_0151692 3300046616 Bacteria 1269
351 Ga0495611_0002438 3300046648 Bacteria 8502
352 Ga0495625_0007720 3300046660 Bacteria 9311
353 Ga0495625_0120674 3300046660 Bacteria 1784
354 Ga0495625_0132092 3300046660 Bacteria 1691
355 Ga0495625_0148670 3300046660 Bacteria 1576
356 Ga0495625_0166910 3300046660 Bacteria 1471
357 Ga0495625_0235212 3300046660 Bacteria 1195
358 Ga0495635_0062603 3300046663 Bacteria 2555
359 Ga0495659_0018040 3300046664 Bacteria 2347
360 Ga0495661_0032338 3300046665 Bacteria 3307
361 Ga0495588_0040513 3300046674 Bacteria 2376
362 Ga0495669_0015804 3300046684 Bacteria 3231
363 Ga0495669_0018337 3300046684 Bacteria 3008
364 Ga0495669_0063423 3300046684 Bacteria 1676
365 Ga0495669_0095960 3300046684 Bacteria 1373
366 Ga0495669_0115595 3300046684 Bacteria 1255
367 Ga0495671_0013991 3300046692 Bacteria 4327
368 Ga0495671_0138864 3300046692 Bacteria 1184
369 Ga0495649_0021647 3300046694 Bacteria 3602
370 Ga0495589_0090155 3300046794 Bacteria 1489
371 Ga0495660_0025973 3300046810 Bacteria 3323
372 Ga0495581_0092748 3300047315 Bacteria 1753
373 Ga0495604_0001148 3300047317 Bacteria 21939
374 Ga0495636_0001590 3300047318 Bacteria 8638
375 Ga0495674_0005562 3300047319 Bacteria 12082
376 Ga0495672_0044075 3300047320 Bacteria 2678
377 Ga0495672_0095891 3300047320 Bacteria 1618
378 Ga0495683_0115318 3300047323 Bacteria 1279
379 Ga0495685_029850 3300047447 Bacteria 1875
380 Ga0495673_0013800 3300047469 Bacteria 4222
381 Ga0495673_0084351 3300047469 Bacteria 1310
382 Ga0495681_0000880 3300047470 Bacteria 23185
383 Ga0495681_0011084 3300047470 Bacteria 5402
384 Ga0495684_0015766 3300047471 Bacteria 5815
385 Ga0495686_0000851 3300047472 Bacteria 39194
386 Ga0495593_0056787 3300047673 Bacteria 2057
387 Ga0495593_0123419 3300047673 Bacteria 1317
388 Ga0495615_0043346 3300048090 Bacteria 1132
389 Ga0496100_0062528 3300048903 Bacteria 2457
390 Ga0496100_0163474 3300048903 Bacteria 1597
391 Ga0496100_0266054 3300048903 Bacteria 1273
392 Ga0496101_0014617 3300048904 Bacteria 5279
393 Ga0496101_0160751 3300048904 Bacteria 1722
394 Ga0496102_0000284 3300048905 Bacteria 64681
395 Ga0496102_0006002 3300048905 Bacteria 10345
396 Ga0496102_0133211 3300048905 Bacteria 2327
397 Ga0496103_0000176 3300048906 Bacteria 65606
398 Ga0496103_0001763 3300048906 Bacteria 14111
399 Ga0496103_0144217 3300048906 Bacteria 1524
400 Ga0496104_0045751 3300048907 Bacteria 4117
401 Ga0496105_0100802 3300048908 Bacteria 2385
402 Ga0496105_0124229 3300048908 Bacteria 2127
403 Ga0496105_0168220 3300048908 Bacteria 1798
404 Ga0496106_0014209 3300048909 Bacteria 5880
405 Ga0496106_0256789 3300048909 Bacteria 1398
406 Ga0496106_0329949 3300048909 Bacteria 1225
407 Ga0496107_0015767 3300048910 Bacteria 5300
408 Ga0496107_0133168 3300048910 Bacteria 1836
409 Ga0496108_0095033 3300048911 Bacteria 2537
410 Ga0496109_0013715 3300048912 Bacteria 7039
411 Ga0496110_0016277 3300048913 Bacteria 6206
412 Ga0496111_0028273 3300048914 Bacteria 3973
413 Ga0496112_0022110 3300048915 Bacteria 6057
414 Ga0496112_0183086 3300048915 Bacteria 2059
415 Ga0496113_0009753 3300048916 Bacteria 6312
416 Ga0496113_0060064 3300048916 Bacteria 2865
417 Ga0496115_0000888 3300048918 Bacteria 21711
418 Ga0496115_0063242 3300048918 Bacteria 2986
419 Ga0496115_0181964 3300048918 Bacteria 1737
420 Ga0496116_0001246 3300048919 Bacteria 29566
421 Ga0496116_0001650 3300048919 Bacteria 24541
422 Ga0496116_0002228 3300048919 Bacteria 20615
423 Ga0496117_0000501 3300048920 Bacteria 64696
424 Ga0496117_0003659 3300048920 Bacteria 17683
425 Ga0496117_0010578 3300048920 Bacteria 8383
426 Ga0496117_0012465 3300048920 Bacteria 7486
427 Ga0496117_0059876 3300048920 Bacteria 2627
428 Ga0496117_0082097 3300048920 Bacteria 2112
429 Ga0496118_0000503 3300048921 Bacteria 64696
430 Ga0496118_0002287 3300048921 Bacteria 26125
431 Ga0496118_0005690 3300048921 Bacteria 14042
432 Ga0496118_0008413 3300048921 Bacteria 10670
433 Ga0496118_0025922 3300048921 Bacteria 5011
434 Ga0496118_0032521 3300048921 Bacteria 4295
435 Ga0496118_0064598 3300048921 Bacteria 2684
436 Ga0496118_0068336 3300048921 Bacteria 2581
437 Ga0496118_0084086 3300048921 Bacteria 2222
438 Ga0496119_0002817 3300048922 Bacteria 18600
439 Ga0496119_0013881 3300048922 Bacteria 6360
440 Ga0496119_0026220 3300048922 Bacteria 4046
441 Ga0496119_0034644 3300048922 Bacteria 3320
442 Ga0496120_0074866 3300048923 Bacteria 1849
443 Ga0496121_0000839 3300048924 Bacteria 55686
444 Ga0496121_0006214 3300048924 Bacteria 14969
445 Ga0496121_0007261 3300048924 Bacteria 13411
446 Ga0496121_0027794 3300048924 Bacteria 5283
447 Ga0496121_0049112 3300048924 Bacteria 3582
448 Ga0496121_0055032 3300048924 Bacteria 3319
449 Ga0496121_0074624 3300048924 Bacteria 2712
450 Ga0496121_0188143 3300048924 Bacteria 1483
451 Ga0496121_0274191 3300048924 Bacteria 1158
452 Ga0496122_0000287 3300048925 Bacteria 112404
453 Ga0496122_0003833 3300048925 Bacteria 19330
454 Ga0496122_0016586 3300048925 Bacteria 6955
455 Ga0496122_0027067 3300048925 Bacteria 4916
456 Ga0496122_0159066 3300048925 Bacteria 1381
457 Ga0496123_0038286 3300048926 Bacteria 3373
458 Ga0496123_0053897 3300048926 Bacteria 2653
459 Ga0496124_0000534 3300048927 Bacteria 64668
460 Ga0496124_0002304 3300048927 Bacteria 25197
461 Ga0496124_0019664 3300048927 Bacteria 6273
462 Ga0496124_0100119 3300048927 Bacteria 2350
463 Ga0496125_0000164 3300048928 Bacteria 147789
464 Ga0496125_0001698 3300048928 Bacteria 30725
465 Ga0496125_0002221 3300048928 Bacteria 25866
466 Ga0496125_0055315 3300048928 Bacteria 3234
467 Ga0496126_0001787 3300048929 Bacteria 31720
468 Ga0496126_0009836 3300048929 Bacteria 10122
469 Ga0496126_0011198 3300048929 Bacteria 9308
470 Ga0496126_0014894 3300048929 Bacteria 7842
471 Ga0496126_0020880 3300048929 Bacteria 6411
472 Ga0496126_0025897 3300048929 Bacteria 5634
473 Ga0496126_0102941 3300048929 Bacteria 2495
474 Ga0496126_0162941 3300048929 Bacteria 1904
475 Ga0496126_0198259 3300048929 Bacteria 1696
476 Ga0496126_0322556 3300048929 Bacteria 1269
477 Ga0496126_0401989 3300048929 Bacteria 1111
478 Ga0495678_046109 3300049459 Bacteria 1715
479 Ga0501032_0035108 3300049569 Bacteria 3430
480 Ga0501034_0007769 3300049571 Bacteria 11409
481 Ga0501034_0216914 3300049571 Bacteria 1867
482 Ga0501034_0371260 3300049571 Bacteria 1357
483 Ga0501036_0016062 3300049572 Bacteria 6255
484 Ga0501038_0039194 3300049574 Bacteria 4145
485 Ga0501038_0104098 3300049574 Bacteria 2359
486 Ga0501038_0186214 3300049574 Bacteria 1673
487 Ga0501039_0071608 3300049575 Bacteria 2694
488 Ga0501043_0018999 3300049579 Bacteria 5395
489 Ga0501047_0043634 3300049581 Bacteria 4331
490 Ga0501047_0287739 3300049581 Bacteria 1487
491 Ga0501048_0000625 3300049582 Bacteria 25248
492 Ga0501070_0035035 3300049586 Bacteria 4195
493 Ga0501070_0191834 3300049586 Bacteria 1679
494 Ga0501072_0094167 3300049588 Bacteria 2380
495 Ga0501073_0018994 3300049589 Bacteria 4966
496 Ga0501073_0241972 3300049589 Bacteria 1246
497 Ga0501074_0169719 3300049590 Bacteria 1557
498 Ga0501076_0418130 3300049592 Bacteria 1103
499 Ga0501257_000031 3300049686 Bacteria 40822
500 Ga0501080_0010167 3300049742 Bacteria 8603
501 Ga0501080_0016515 3300049742 Bacteria 6819
502 Ga0501080_0073002 3300049742 Bacteria 3192
503 Ga0501035_0286312 3300049822 Bacteria 1391
504 Ga0501044_0062630 3300049823 Bacteria 3802
505 Ga0501044_0072783 3300049823 Bacteria 3494
506 Ga0501044_0121886 3300049823 Bacteria 2607
507 Ga0501044_0171493 3300049823 Bacteria 2141
508 nmdc:mga03683_29809_c1 3300050489 Bacteria 2179
509 nmdc:mga03n38_6704_c1 3300050490 Bacteria 4024
510 nmdc:mga00v17_186821_c1 3300050491 Bacteria 1338
511 nmdc:mga00v17_24280_c1 3300050491 Bacteria 3514
512 nmdc:mga0yw44_105127_c1 3300050492 Bacteria 1803
513 nmdc:mga0yw44_16493_c1 3300050492 Bacteria 3991
514 nmdc:mga0yw44_18141_c1 3300050492 Bacteria 3848
515 nmdc:mga0yw44_4081_c1 3300050492 Bacteria 6619
516 nmdc:mga06z11_2973_c1 3300050494 Bacteria 6527
517 nmdc:mga06z11_5322_c1 3300050494 Bacteria 5156
518 nmdc:mga04h51_20306_c1 3300050495 Bacteria 1981
519 nmdc:mga04h51_42081_c1 3300050495 Bacteria 1496
520 nmdc:mga07m45_1496_c1 3300050496 Bacteria 10726
521 nmdc:mga07m45_25430_c1 3300050496 Bacteria 3246
522 nmdc:mga07m45_30872_c1 3300050496 Bacteria 2969
523 nmdc:mga05p37_200856_c1 3300050507 Bacteria 2415
524 nmdc:mga09592_3899_c1 3300050508 Bacteria 6283
525 nmdc:mga0qj67_2858_c1 3300050509 Bacteria 12389
526 nmdc:mga06r32_16308_c1 3300050510 Bacteria 6766
527 nmdc:mga06r32_8574_c1 3300050510 Bacteria 9216
528 nmdc:mga08y16_117883_c1 3300050511 Bacteria 2763
529 nmdc:mga0sz30_32033_c1 3300050516 Bacteria 2178
530 Ga0495619_0217618 3300053085 Bacteria 1323
531 Ga0500578_0002540 3300053086 Bacteria 15034
532 Ga0500578_0070624 3300053086 Bacteria 2226
533 Ga0500643_000153 3300053087 Bacteria 69793
534 Ga0500647_0026648 3300053091 Bacteria 2727
535 Ga0500583_0001587 3300053092 Bacteria 6591
536 Ga0500583_0049323 3300053092 Bacteria 1947
537 Ga0500651_0044292 3300053093 Bacteria 2802
538 Ga0500566_0000463 3300053094 Bacteria 22603
539 Ga0500566_0003680 3300053094 Bacteria 9155
540 Ga0500641_0005032 3300053096 Bacteria 4688
541 Ga0500650_0000464 3300053098 Bacteria 10143
542 Ga0500554_078664 3300053102 Bacteria 1083
543 Ga0500556_0000051 3300053104 Bacteria 119031
544 Ga0500556_0000052 3300053104 Bacteria 117825
545 Ga0500556_0000228 3300053104 Bacteria 45509
546 Ga0500569_046301 3300053109 Bacteria 1296
547 Ga0500592_000113 3300053116 Bacteria 17406
548 Ga0500595_000348 3300053119 Bacteria 30151
549 Ga0500595_025631 3300053119 Bacteria 2041
550 Ga0500608_001212 3300053122 Bacteria 9215
551 Ga0500618_000212 3300053125 Bacteria 45838
552 Ga0500618_000349 3300053125 Bacteria 32348
553 Ga0500618_003208 3300053125 Bacteria 5711
554 Ga0500618_017695 3300053125 Bacteria 1771
555 Ga0500642_0000041 3300053130 Bacteria 89564
556 Ga0500642_0004468 3300053130 Bacteria 4381
557 Ga0500652_000513 3300053131 Bacteria 13653
558 Ga0500655_000227 3300053133 Bacteria 13536
559 Ga0500559_0000110 3300053136 Bacteria 64409
560 Ga0500559_0001229 3300053136 Bacteria 15171
561 Ga0500568_0000116 3300053139 Bacteria 71883
562 Ga0500568_0006128 3300053139 Bacteria 6092
563 Ga0500568_0025200 3300053139 Bacteria 2512
564 Ga0500574_004343 3300053141 Bacteria 2635
565 Ga0500577_0000290 3300053142 Bacteria 13103
566 Ga0500586_012928 3300053145 Bacteria 2444
567 Ga0500590_027436 3300053148 Bacteria 2953
568 Ga0500590_087848 3300053148 Bacteria 1515
569 Ga0500616_0000150 3300053153 Bacteria 117918
570 Ga0500616_0014171 3300053153 Bacteria 4591
571 Ga0500616_0102023 3300053153 Bacteria 1401
572 Ga0500622_0000502 3300053156 Bacteria 36464
573 Ga0500622_0009745 3300053156 Bacteria 5307
574 Ga0500622_0055061 3300053156 Bacteria 2039
575 Ga0500622_0158377 3300053156 Bacteria 1064
576 Ga0500624_000890 3300053157 Bacteria 6425
577 Ga0500627_0000104 3300053158 Bacteria 28060
578 Ga0500627_0023664 3300053158 Bacteria 2506
579 Ga0500627_0047842 3300053158 Bacteria 1857
580 Ga0500627_0069981 3300053158 Bacteria 1553
581 Ga0500638_025937 3300053162 Bacteria 2804
582 Ga0500638_036929 3300053162 Bacteria 2370
583 Ga0500639_093939 3300053163 Bacteria 1489
584 Ga0500636_0000511 3300053177 Bacteria 21124
585 Ga0500636_0000824 3300053177 Bacteria 16693
586 Ga0500636_0019470 3300053177 Bacteria 4017
587 Ga0500637_0000110 3300053178 Bacteria 29626
588 Ga0500570_000354 3300053724 Bacteria 16855
589 Ga0500609_007412 3300053731 Bacteria 1483
590 Ga0500609_009300 3300053731 Bacteria 1325
591 Ga0501084_0241226 3300054114 Bacteria 1526
592 Ga0500661_000464 3300055283 Bacteria 7496
593 2513654705 2513237096 Bacteria 8722461
594 2513674488 2513237098 Bacteria 9902361
595 2513855874 2513237137 Bacteria 9558895
596 2513894732 2513237141 Bacteria 8496279
597 2513915115 2513237145 Bacteria 8979722
598 2517892412 2517572143 Bacteria 9484767
599 2523469135 2523231067 Bacteria 5230452
600 2524538494 2524023228 Bacteria 10118060
601 2585263532 2582581305 Bacteria 4895574
602 2585842816 2585427594 Bacteria 6180594
603 2585903266 2585427609 Bacteria 6667127
604 2587978693 2585428125 Bacteria 6662905
605 2603862362 2602042107 Bacteria 6226103
606 2671120340 2667528175 Bacteria 7532676
607 2728751201 2728368998 Bacteria 8720350
608 2738799679 2738541293 Bacteria 7065685
609 2739347375 2738543031 Bacteria 5769731
610 2793072111 2791355197 Bacteria 8420563
611 2854896676 2854896431 Bacteria 5869725
612 2857525748 2857524615 Bacteria 6615449
613 2857582855 2857581216 Bacteria 5522813
614 2885380595 2885374607 Bacteria 8927485
615 2885410904 2885409591 Bacteria 9235467
616 2893067958 2893066018 Bacteria 6158120
617 2898799007 2898795034 Bacteria 4294459
618 2903751045 2903748898 Bacteria 9972761
619 2904698438 2904690495 Bacteria 9412302
620 2904703417
621 2906618609
622 2906635759 2906635258 Bacteria 8601019
623 2906666394 2906660503 Bacteria 8595048
624 2908742708 2908739725 Bacteria 8628932
625 2908761102 2908756301 Bacteria 8864324
626 2919074388 2919073203 Bacteria 6531949
627 2919455084 2919450847 Bacteria 5631160
628 2922430271
629 2932404713 2932401849 Bacteria 4262978
630 2935631680 2935630451 Bacteria 8169952
631 2939672433 2939669807 Bacteria 5028511
632 2941511474 2941507105 Bacteria 8166816
633 2941519175 2941515067 Bacteria 8166720
634 2941526245 2941523033 Bacteria 8169134
635 3005480196 3005474847 Bacteria 9259049
636 8001849381 8001845381 Bacteria 5804942
637 8006940691 8006933436 Bacteria 10410654
638 8006980381 8006973647 Bacteria 10679141
639 8019556763 8019555841 Bacteria 9642137
640 8019568543 8019565922 Bacteria 9639779
641 8056693555 8056689827 Bacteria 6712655
642 Ga0436361_0867129
643 SwRhRL3b_contig_2981330
644 JGI24736J21556_1000010
645 JGI24752J21851_1000101
646 JGI24740J21852_10015123
647 JGI24737J22298_10009994
648 JGI24738J21930_10000890
649 JGI24749J21850_1000094
650 JGI24749J21850_1003853
651 JGI24034J26672_10000007
652 JGI24742J22300_10001056
653 JGI24751J29686_10000093
654 JGI24751J29686_10008233
655 JGI24751J29686_10030675
656 JGI25152J39213_1000248
657 JGI25150J39212_1000017
658 JGI25151J46595_10000007
659 rootH1_10158182
660 Ga0065165_1000003
661 Ga0065704_10088746
662 Ga0065707_10082085
663 Ga0065707_10082467
664 Ga0070683_100079280
665 Ga0070690_100000220
666 Ga0070670_100000005
667 Ga0070670_100001742
668 Ga0070670_100159839
669 Ga0068869_100126576
670 Ga0070666_10000017
671 Ga0068868_100076952
672 Ga0070660_100188831
673 Ga0070660_100230379
674 Ga0070661_100028883
675 Ga0070668_100003872
676 Ga0070668_100214625
677 Ga0070669_100000117
678 Ga0070669_100000195
679 Ga0070671_100000957
680 Ga0070671_100038362
681 Ga0070674_100042247
682 Ga0070688_100009092
683 Ga0070667_100009319
684 Ga0070667_100040764
685 Ga0070667_100207690
686 Ga0070714_100168595
687 Ga0070710_10094702
688 Ga0070700_100036088
689 Ga0070663_100041853
690 Ga0070663_100334593
691 Ga0070678_100058366
692 Ga0070678_100136373
693 Ga0070662_100100596
694 Ga0070685_10000126
695 Ga0070685_10031974
696 Ga0070706_100005764
697 Ga0070698_100167700
698 Ga0070684_100042870
699 Ga0070684_100175915
700 Ga0068853_100371555
701 Ga0070686_100000014
702 Ga0070665_100000042
703 Ga0070665_100053493
704 Ga0070665_100065878
705 Ga0070665_100096540
706 Ga0070665_100650035
707 Ga0068857_100041508
708 Ga0068857_100274416
709 Ga0068854_100010329
710 Ga0068854_100053641
711 Ga0068856_100394527
712 Ga0068852_100306354
713 Ga0068859_100006154
714 Ga0068859_100007945
715 Ga0068859_100165529
716 Ga0068864_100000011
717 Ga0068864_100030017
718 Ga0068861_100016906
719 Ga0068861_100092651
720 Ga0068863_100000068
721 Ga0068863_100155653
722 Ga0068858_100007337
723 Ga0068860_100000062
724 Ga0068860_100001177
725 Ga0068862_100000011
726 Ga0068862_100000539
727 Ga0068862_100007709
728 Ga0068862_100196668
729 Ga0081540_1080548
730 Ga0075365_10010554
731 Ga0075365_10012009
732 Ga0075365_10055582
733 Ga0075365_10341917
734 Ga0075363_100029834
735 Ga0075364_10022338
736 Ga0070712_100423387
737 Ga0075362_10016045
738 Ga0075362_10090474
739 Ga0075367_10013857
740 Ga0075367_10123878
741 Ga0075367_10165173
742 Ga0075369_10028591
743 Ga0097621_100116417
744 Ga0075370_10042630
745 Ga0075370_10042729
746 Ga0075370_10107483
747 Ga0068871_100317134
748 Ga0075428_100015371
749 Ga0075430_100078929
750 Ga0075430_100192093
751 Ga0075431_100001670
752 Ga0075431_100011120
753 Ga0075429_100016750
754 Ga0097620_100006154
755 Ga0097620_100007945
756 Ga0097620_100165529
757 Ga0099824_1016589
758 Ga0099822_1000080
759 Ga0099794_10030922
760 Ga0099794_10113610
761 Ga0105250_10059382
762 Ga0105240_10099394
763 Ga0105240_10105725
764 Ga0105240_10297240
765 Ga0111539_10052231
766 Ga0105245_10255857
767 Ga0105247_10002648
768 Ga0105247_10056273
769 Ga0114129_10043198
770 Ga0114129_10189111
771 Ga0105243_10029573
772 Ga0105243_10117459
773 Ga0105248_10000069
774 Ga0105248_10075949
775 Ga0105237_10128438
776 Ga0105237_10205236
777 Ga0105238_10186071
778 Ga0105249_10000012
779 Ga0105249_10000417
780 Ga0105249_10532397
781 Ga0099796_10016094
782 Ga0157326_1000271
783 Ga0157369_10010862
784 Ga0157374_10004876
785 Ga0157378_10142310
786 Ga0157378_10199746
787 Ga0163162_10397312
788 Ga0163162_10467321
789 Ga0157375_10536893
790 Ga0163163_10146225
791 Ga0163163_10175652
792 Ga0157380_10000336
793 Ga0157380_10000363
794 Ga0157380_10001431
795 Ga0157380_10023613
796 Ga0157379_10047121
797 Ga0157376_10007594
798 Ga0157376_10099816
799 Ga0157376_10272418
800 Ga0163161_10000025
801 Ga0163161_10345614
802 Ga0213871_10001049
803 Ga0224572_1003894
804 Ga0207425_1000018
805 Ga0209129_1000026
806 Ga0209673_1002161
807 Ga0209130_1000036
808 Ga0209025_1000035
809 Ga0209564_1000687
810 Ga0209758_1000040
811 Ga0209758_1000580
812 Ga0207426_1022199
813 Ga0207656_10014803
814 Ga0207692_10052038
815 Ga0207642_10142581
816 Ga0207710_10006025
817 Ga0207710_10063277
818 Ga0207680_10000012
819 Ga0207647_10000205
820 Ga0207643_10051090
821 Ga0207684_10019211
822 Ga0207684_10377625
823 Ga0207695_10056865
824 Ga0207695_10059027
825 Ga0207695_10109750
826 Ga0207671_10079079
827 Ga0207671_10264200
828 Ga0207657_10103719
829 Ga0207649_10100142
830 Ga0207649_10309221
831 Ga0207681_10000001
832 Ga0207681_10002813
833 Ga0207681_10119222
834 Ga0207694_10002672
835 Ga0207694_10333970
836 Ga0207650_10000018
837 Ga0207650_10000351
838 Ga0207650_10014735
839 Ga0207700_10108274
840 Ga0207644_10001121
841 Ga0207644_10138727
842 Ga0207706_10061848
843 Ga0207709_10019146
844 Ga0207670_10065835
845 Ga0207669_10003218
846 Ga0207669_10173849
847 Ga0207665_10076986
848 Ga0207711_10001064
849 Ga0207711_10018206
850 Ga0207711_10072585
851 Ga0207689_10002175
852 Ga0207689_10171488
853 Ga0207689_10288036
854 Ga0207661_10066191
855 Ga0207667_10044826
856 Ga0207667_10381121
857 Ga0207712_10000021
858 Ga0207712_10000308
859 Ga0207668_10002839
860 Ga0207668_10007464
861 Ga0207668_10140147
862 Ga0207658_10006231
863 Ga0207658_10011493
864 Ga0207703_10002599
865 Ga0207639_10079533
866 Ga0207639_10097219
867 Ga0207678_10007112
868 Ga0207678_10049471
869 Ga0207678_10360357
870 Ga0207708_10108433
871 Ga0207702_10004678
872 Ga0207702_10214867
873 Ga0207641_10000037
874 Ga0207641_10032573
875 Ga0207676_10000004
876 Ga0207676_10001393
877 Ga0207674_10092209
878 Ga0207674_10315790
879 Ga0207675_100000088
880 Ga0207675_100002743
881 Ga0207683_10038196
882 Ga0207683_10200465
883 Ga0207698_10476550
884 Ga0209589_1000003
885 Ga0209489_100003
886 Ga0209700_100003
887 Ga0209813_10007367
888 Ga0268266_10000054
889 Ga0268266_10001006
890 Ga0268266_10002199
891 Ga0268266_10085662
892 Ga0268265_10000002
893 Ga0268265_10000092
894 Ga0268265_10001870
895 Ga0268265_10176345
896 Ga0268264_10000074
897 Ga0268264_10009761
898 Ga0265334_10000368
899 Ga0307517_10000436
900 Ga0307515_10086799
901 Ga0265338_10039958
902 Ga0307511_10157383
903 Ga0265762_1000856
904 Ga0265330_10025616
905 Ga0265330_10108874
906 Ga0265332_10014874
907 Ga0265332_10063930
908 Ga0265325_10035189
909 Ga0265325_10094152
910 Ga0265325_10136032
911 Ga0265316_10097184
912 Ga0307513_10098200
913 Ga0307513_10126261
914 Ga0307509_10202144
915 Ga0307408_100002351
916 Ga0307508_10004588
917 Ga0307508_10067357
918 Ga0307508_10151789
919 Ga0265314_10003102
920 Ga0265314_10003222
921 Ga0265314_10022562
922 Ga0307516_10121555
923 Ga0307518_10017160
924 Ga0307406_10032279
925 Ga0307406_10159037
926 Ga0307407_10111374
927 Ga0307412_10001600
928 Ga0307412_10017030
929 Ga0307412_10191457
930 Ga0307409_100118966
931 Ga0307409_100424110
932 Ga0307416_100076485
933 Ga0307416_100291692
934 Ga0307411_10134689
935 Ga0307510_10013323
936 Ga0307510_10060743
937 Ga0307510_10131153
938 Ga0307510_10184448
939 Ga0373923_0061221
940 Ga0373954_0100233
941 Ga0373924_0052421
942 Ga0373935_0053693
943 Ga0373927_0002643
944 Ga0373947_0049386
945 Ga0373937_0054468
946 Ga0373925_0054637
947 Ga0395898_0228495
948 Ga0395905_0075831
949 Ga0436365_0736289
950 Ga0436365_0811379
951 Ga0436365_0999681
952 Ga0436360_0111369
953 Ga0436362_0235327
954 Ga0451800_0309253
955 Ga0451807_1223198
956 Ga0466971_0093985
957 Ga0466957_0052561
958 Ga0495617_008389
959 Ga0495603_0076759
960 Ga0495629_0225896
961 Ga0495638_0005953
962 Ga0495650_0051062
963 Ga0495605_0021219
964 Ga0495662_0018094
965 Ga0495664_0051340
966 Ga0495584_0079845
967 Ga0495584_0101229
968 Ga0495594_0171530
969 Ga0495610_0022728
970 Ga0495616_0026150
971 Ga0495618_0101672
972 Ga0495620_0000739
973 Ga0495631_0033309
974 Ga0495632_0000688
975 Ga0495632_0095401
976 Ga0495632_0097102
977 Ga0495643_0063384
978 Ga0495644_0069694
979 Ga0495648_0002965
980 Ga0495648_0007680
981 Ga0495663_0038796
982 Ga0495654_0027265
983 Ga0495654_0070103
984 Ga0495640_0061098
985 Ga0495597_0009659
986 Ga0495622_0052172
987 Ga0495656_0007471
988 Ga0495656_0028533
989 Ga0495668_0009886
990 Ga0495668_0038281
991 Ga0495668_0151692
992 Ga0495611_0002438
993 Ga0495625_0007720
994 Ga0495625_0120674
995 Ga0495625_0132092
996 Ga0495625_0148670
997 Ga0495625_0166910
998 Ga0495625_0235212
999 Ga0495635_0062603
1000 Ga0495659_0018040
1001 Ga0495661_0032338
1002 Ga0495588_0040513
1003 Ga0495669_0015804
1004 Ga0495669_0018337
1005 Ga0495669_0063423
1006 Ga0495669_0095960
1007 Ga0495669_0115595
1008 Ga0495671_0013991
1009 Ga0495671_0138864
1010 Ga0495649_0021647
1011 Ga0495589_0090155
1012 Ga0495660_0025973
1013 Ga0495581_0092748
1014 Ga0495604_0001148
1015 Ga0495636_0001590
1016 Ga0495674_0005562
1017 Ga0495672_0044075
1018 Ga0495672_0095891
1019 Ga0495683_0115318
1020 Ga0495685_029850
1021 Ga0495673_0013800
1022 Ga0495673_0084351
1023 Ga0495681_0000880
1024 Ga0495681_0011084
1025 Ga0495684_0015766
1026 Ga0495686_0000851
1027 Ga0495593_0056787
1028 Ga0495593_0123419
1029 Ga0495615_0043346
1030 Ga0496100_0062528
1031 Ga0496100_0163474
1032 Ga0496100_0266054
1033 Ga0496101_0014617
1034 Ga0496101_0160751
1035 Ga0496102_0000284
1036 Ga0496102_0006002
1037 Ga0496102_0133211
1038 Ga0496103_0000176
1039 Ga0496103_0001763
1040 Ga0496103_0144217
1041 Ga0496104_0045751
1042 Ga0496105_0100802
1043 Ga0496105_0124229
1044 Ga0496105_0168220
1045 Ga0496106_0014209
1046 Ga0496106_0256789
1047 Ga0496106_0329949
1048 Ga0496107_0015767
1049 Ga0496107_0133168
1050 Ga0496108_0095033
1051 Ga0496109_0013715
1052 Ga0496110_0016277
1053 Ga0496111_0028273
1054 Ga0496112_0022110
1055 Ga0496112_0183086
1056 Ga0496113_0009753
1057 Ga0496113_0060064
1058 Ga0496115_0000888
1059 Ga0496115_0063242
1060 Ga0496115_0181964
1061 Ga0496116_0001246
1062 Ga0496116_0001650
1063 Ga0496116_0002228
1064 Ga0496117_0000501
1065 Ga0496117_0003659
1066 Ga0496117_0010578
1067 Ga0496117_0012465
1068 Ga0496117_0059876
1069 Ga0496117_0082097
1070 Ga0496118_0000503
1071 Ga0496118_0002287
1072 Ga0496118_0005690
1073 Ga0496118_0008413
1074 Ga0496118_0025922
1075 Ga0496118_0032521
1076 Ga0496118_0064598
1077 Ga0496118_0068336
1078 Ga0496118_0084086
1079 Ga0496119_0002817
1080 Ga0496119_0013881
1081 Ga0496119_0026220
1082 Ga0496119_0034644
1083 Ga0496120_0074866
1084 Ga0496121_0000839
1085 Ga0496121_0006214
1086 Ga0496121_0007261
1087 Ga0496121_0027794
1088 Ga0496121_0049112
1089 Ga0496121_0055032
1090 Ga0496121_0074624
1091 Ga0496121_0188143
1092 Ga0496121_0274191
1093 Ga0496122_0000287
1094 Ga0496122_0003833
1095 Ga0496122_0016586
1096 Ga0496122_0027067
1097 Ga0496122_0159066
1098 Ga0496123_0038286
1099 Ga0496123_0053897
1100 Ga0496124_0000534
1101 Ga0496124_0002304
1102 Ga0496124_0019664
1103 Ga0496124_0100119
1104 Ga0496125_0000164
1105 Ga0496125_0001698
1106 Ga0496125_0002221
1107 Ga0496125_0055315
1108 Ga0496126_0001787
1109 Ga0496126_0009836
1110 Ga0496126_0011198
1111 Ga0496126_0014894
1112 Ga0496126_0020880
1113 Ga0496126_0025897
1114 Ga0496126_0102941
1115 Ga0496126_0162941
1116 Ga0496126_0198259
1117 Ga0496126_0322556
1118 Ga0496126_0401989
1119 Ga0495678_046109
1120 Ga0501032_0035108
1121 Ga0501034_0007769
1122 Ga0501034_0216914
1123 Ga0501034_0371260
1124 Ga0501036_0016062
1125 Ga0501038_0039194
1126 Ga0501038_0104098
1127 Ga0501038_0186214
1128 Ga0501039_0071608
1129 Ga0501043_0018999
1130 Ga0501047_0043634
1131 Ga0501047_0287739
1132 Ga0501048_0000625
1133 Ga0501070_0035035
1134 Ga0501070_0191834
1135 Ga0501072_0094167
1136 Ga0501073_0018994
1137 Ga0501073_0241972
1138 Ga0501074_0169719
1139 Ga0501076_0418130
1140 Ga0501257_000031
1141 Ga0501080_0010167
1142 Ga0501080_0016515
1143 Ga0501080_0073002
1144 Ga0501035_0286312
1145 Ga0501044_0062630
1146 Ga0501044_0072783
1147 Ga0501044_0121886
1148 Ga0501044_0171493
1149 nmdc:mga03683_29809_c1
1150 nmdc:mga03n38_6704_c1
1151 nmdc:mga00v17_186821_c1
1152 nmdc:mga00v17_24280_c1
1153 nmdc:mga0yw44_105127_c1
1154 nmdc:mga0yw44_16493_c1
1155 nmdc:mga0yw44_18141_c1
1156 nmdc:mga0yw44_4081_c1
1157 nmdc:mga06z11_2973_c1
1158 nmdc:mga06z11_5322_c1
1159 nmdc:mga04h51_20306_c1
1160 nmdc:mga04h51_42081_c1
1161 nmdc:mga07m45_1496_c1
1162 nmdc:mga07m45_25430_c1
1163 nmdc:mga07m45_30872_c1
1164 nmdc:mga05p37_200856_c1
1165 nmdc:mga09592_3899_c1
1166 nmdc:mga0qj67_2858_c1
1167 nmdc:mga06r32_16308_c1
1168 nmdc:mga06r32_8574_c1
1169 nmdc:mga08y16_117883_c1
1170 nmdc:mga0sz30_32033_c1
1171 Ga0495619_0217618
1172 Ga0500578_0002540
1173 Ga0500578_0070624
1174 Ga0500643_000153
1175 Ga0500647_0026648
1176 Ga0500583_0001587
1177 Ga0500583_0049323
1178 Ga0500651_0044292
1179 Ga0500566_0000463
1180 Ga0500566_0003680
1181 Ga0500641_0005032
1182 Ga0500650_0000464
1183 Ga0500554_078664
1184 Ga0500556_0000051
1185 Ga0500556_0000052
1186 Ga0500556_0000228
1187 Ga0500569_046301
1188 Ga0500592_000113
1189 Ga0500595_000348
1190 Ga0500595_025631
1191 Ga0500608_001212
1192 Ga0500618_000212
1193 Ga0500618_000349
1194 Ga0500618_003208
1195 Ga0500618_017695
1196 Ga0500642_0000041
1197 Ga0500642_0004468
1198 Ga0500652_000513
1199 Ga0500655_000227
1200 Ga0500559_0000110
1201 Ga0500559_0001229
1202 Ga0500568_0000116
1203 Ga0500568_0006128
1204 Ga0500568_0025200
1205 Ga0500574_004343
1206 Ga0500577_0000290
1207 Ga0500586_012928
1208 Ga0500590_027436
1209 Ga0500590_087848
1210 Ga0500616_0000150
1211 Ga0500616_0014171
1212 Ga0500616_0102023
1213 Ga0500622_0000502
1214 Ga0500622_0009745
1215 Ga0500622_0055061
1216 Ga0500622_0158377
1217 Ga0500624_000890
1218 Ga0500627_0000104
1219 Ga0500627_0023664
1220 Ga0500627_0047842
1221 Ga0500627_0069981
1222 Ga0500638_025937
1223 Ga0500638_036929
1224 Ga0500639_093939
1225 Ga0500636_0000511
1226 Ga0500636_0000824
1227 Ga0500636_0019470
1228 Ga0500637_0000110
1229 Ga0500570_000354
1230 Ga0500609_007412
1231 Ga0500609_009300
1232 Ga0501084_0241226
1233 Ga0500661_000464
1234 2513654705
1235 2513674488
1236 2513855874
1237 2513894732
1238 2513915115
1239 2517892412
1240 2523469135
1241 2524538494
1242 2585263532
1243 2585842816
1244 2585903266
1245 2587978693
1246 2603862362
1247 2671120340
1248 2728751201
1249 2738799679
1250 2739347375
1251 2793072111
1252 2854896676
1253 2857525748
1254 2857582855
1255 2885380595
1256 2885410904
1257 2893067958
1258 2898799007
1259 2903751045
1260 2904698438
1261 2904703417
1262 2906618609
1263 2906635759
1264 2906666394
1265 2908742708
1266 2908761102
1267 2919074388
1268 2919455084
1269 2922430271
1270 2932404713
1271 2935631680
1272 2939672433
1273 2941511474
1274 2941519175
1275 2941526245
1276 3005480196
1277 8001849381
1278 8006940691
1279 8006980381
1280 8019556763
1281 8019568543
1282 8056693555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

2

319

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8947 1 330
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8928 1 330
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.892 1 330
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8882 2 330
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.885 1 330
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9763 1 324 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9676 1 324 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9616 1 324 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9504 1 324 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8972 1 324 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A840IEP6-F1-model_v4 Luciferase family oxidoreductase group 1 0.9935 1 328 GO:0005829
GO:0016705
AF-A0A2I6S7K1-F1-model_v4 Alkane 1-monooxygenase 0.9906 1 323 GO:0004497
GO:0005829
GO:0016020
GO:0016705
AF-A0A1E3VAH4-F1-model_v4 Luciferase-like domain-containing protein 0.9906 1 325 GO:0005829
GO:0016705
AF-A0A149RGW7-F1-model_v4 deleted 0.9894 1 106
AF-A0A562C0B1-F1-model_v4 Luciferase family oxidoreductase group 1 0.9881 2 324 GO:0005829
GO:0016705

Map