F471801

General Info

Members Datasets Scaffolds Average Seq Length
641 395 634 106

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0451316|Ga0436365_0451316_77_382
Length 101
Sequence MAAKIRKGDKVIVLAGRDKGRTGEVIQIMPKENRALVRGVNIVKRHQRQTANQEAGIINKEASVHLSNVAIVDKDGKPTRVGFKVVDGKKVRVAKRSGEVI

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
3 2909042592 Labrys sp. LIt4 Isolate Nodule
4 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
146 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
147 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
233 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
234 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
255 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
256 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
257 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
275 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
276 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
286 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
387 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 641522639 Methylobacterium sp. 4-46 Isolate Nodule
394 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
395 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 2.03
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0.78
Rhizoplane 9.83
Rhizosphere 83.93
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10158064 3300001979 Bacteria 562
2 JGI24737J22298_10002957 3300001990 Bacteria 6024
3 JGI24735J21928_10114903 3300002067 Bacteria 775
4 JGI24750J21931_1025865 3300002070 Bacteria 843
5 JGI24748J21848_1061909 3300002074 Bacteria 501
6 JGI24738J21930_10005208 3300002075 Bacteria 3137
7 JGI24744J21845_10030691 3300002077 Bacteria 1030
8 JGI24034J26672_10026547 3300002239 Bacteria 929
9 JGI24742J22300_10034521 3300002244 Bacteria 891
10 JGI24751J29686_10074257 3300002459 Bacteria 702
11 JGI25405J52794_10135021 3300003911 Bacteria 560
12 Ga0065712_10141376 3300005290 Bacteria 1447
13 Ga0065707_10838764 3300005295 Bacteria 586
14 Ga0070658_10012301 3300005327 Bacteria 6871
15 Ga0070676_10014395 3300005328 Bacteria 4347
16 Ga0070676_10357237 3300005328 Bacteria 1006
17 Ga0070683_100014681 3300005329 Bacteria 6861
18 Ga0070683_100565925 3300005329 Bacteria 1087
19 Ga0070690_100012397 3300005330 Bacteria 5017
20 Ga0070690_100137081 3300005330 Bacteria 1658
21 Ga0070670_100000376 3300005331 Bacteria 37212
22 Ga0070670_101001242 3300005331 Bacteria 760
23 Ga0068869_100003825 3300005334 Bacteria 9286
24 Ga0070666_10004644 3300005335 Bacteria 8386
25 Ga0070680_100008294 3300005336 Bacteria 7948
26 Ga0070680_100707378 3300005336 Bacteria 867
27 Ga0070682_100041295 3300005337 Bacteria 2843
28 Ga0068868_100010801 3300005338 Bacteria 6623
29 Ga0068868_100844818 3300005338 Bacteria 829
30 Ga0070660_100000686 3300005339 Bacteria 22383
31 Ga0070660_101541607 3300005339 Bacteria 565
32 Ga0070689_100000122 3300005340 Bacteria 44668
33 Ga0070691_10000273 3300005341 Bacteria 18063
34 Ga0070661_100000385 3300005344 Bacteria 34633
35 Ga0070692_10003072 3300005345 Bacteria 6671
36 Ga0070692_10701732 3300005345 Bacteria 681
37 Ga0070669_100002082 3300005353 Bacteria 14453
38 Ga0070675_100700921 3300005354 Bacteria 922
39 Ga0070671_100001283 3300005355 Bacteria 18858
40 Ga0070674_100000649 3300005356 Bacteria 17518
41 Ga0070674_100005343 3300005356 Bacteria 7407
42 Ga0070674_101674466 3300005356 Bacteria 575
43 Ga0070673_100002163 3300005364 Bacteria 11899
44 Ga0070688_100000217 3300005365 Bacteria 30556
45 Ga0070659_100003485 3300005366 Bacteria 11201
46 Ga0070667_100003614 3300005367 Bacteria 13156
47 Ga0070703_10217434 3300005406 Bacteria 759
48 Ga0070709_10001353 3300005434 Bacteria 13379
49 Ga0070709_11337907 3300005434 Bacteria 578
50 Ga0070714_100006925 3300005435 Bacteria 8788
51 Ga0070714_100050142 3300005435 Bacteria 3555
52 Ga0070714_101396830 3300005435 Bacteria 684
53 Ga0070713_101269131 3300005436 Bacteria 713
54 Ga0070710_10005298 3300005437 Bacteria 6115
55 Ga0070710_10297179 3300005437 Bacteria 1053
56 Ga0070701_10000897 3300005438 Bacteria 10740
57 Ga0070711_100000834 3300005439 Bacteria 16154
58 Ga0070711_100043033 3300005439 Bacteria 3056
59 Ga0070711_101003908 3300005439 Bacteria 716
60 Ga0070705_100001475 3300005440 Bacteria 12439
61 Ga0070705_100054734 3300005440 Bacteria 2342
62 Ga0070700_100001041 3300005441 Bacteria 13717
63 Ga0070700_100133165 3300005441 Bacteria 1680
64 Ga0070700_100271271 3300005441 Bacteria 1226
65 Ga0070694_100000195 3300005444 Bacteria 32086
66 Ga0070694_101306564 3300005444 Bacteria 610
67 Ga0070663_100000352 3300005455 Bacteria 24139
68 Ga0070663_100341785 3300005455 Bacteria 1209
69 Ga0070678_100001146 3300005456 Bacteria 14002
70 Ga0070678_100257457 3300005456 Bacteria 1466
71 Ga0070662_100000412 3300005457 Bacteria 25384
72 Ga0070662_100758779 3300005457 Bacteria 823
73 Ga0070681_10423869 3300005458 Bacteria 1243
74 Ga0068867_100042053 3300005459 Bacteria 3341
75 Ga0068867_100292281 3300005459 Bacteria 1340
76 Ga0070685_10155510 3300005466 Bacteria 1453
77 Ga0070699_100101221 3300005518 Bacteria 2526
78 Ga0070679_100103457 3300005530 Bacteria 2834
79 Ga0070684_100149269 3300005535 Bacteria 2117
80 Ga0070697_100000391 3300005536 Bacteria 34002
81 Ga0068853_100001082 3300005539 Bacteria 19264
82 Ga0068853_100908836 3300005539 Bacteria 846
83 Ga0070672_100002807 3300005543 Bacteria 11158
84 Ga0070672_100351224 3300005543 Bacteria 1257
85 Ga0070686_100001391 3300005544 Bacteria 13661
86 Ga0070686_101519100 3300005544 Bacteria 565
87 Ga0070695_100000238 3300005545 Bacteria 27265
88 Ga0070696_100000815 3300005546 Bacteria 20059
89 Ga0070696_100311884 3300005546 Bacteria 1208
90 Ga0070693_100000455 3300005547 Bacteria 18375
91 Ga0070693_100290171 3300005547 Bacteria 1099
92 Ga0070665_100008997 3300005548 Bacteria 10112
93 Ga0070704_100000124 3300005549 Bacteria 27978
94 Ga0070704_100675714 3300005549 Bacteria 914
95 Ga0068855_100002691 3300005563 Bacteria 21916
96 Ga0070664_100002450 3300005564 Bacteria 14942
97 Ga0068857_100008457 3300005577 Bacteria 8896
98 Ga0068857_100363422 3300005577 Bacteria 1342
99 Ga0068857_101329909 3300005577 Bacteria 698
100 Ga0068854_100004862 3300005578 Bacteria 8473
101 Ga0068854_100207540 3300005578 Bacteria 1544
102 Ga0068856_100005122 3300005614 Bacteria 12946
103 Ga0068856_100194610 3300005614 Bacteria 2041
104 Ga0068856_100937139 3300005614 Bacteria 885
105 Ga0068856_101631752 3300005614 Bacteria 658
106 Ga0070702_100000018 3300005615 Bacteria 47204
107 Ga0070702_100289754 3300005615 Bacteria 1128
108 Ga0070702_100451962 3300005615 Bacteria 932
109 Ga0068852_100010938 3300005616 Bacteria 6801
110 Ga0068852_101698313 3300005616 Bacteria 654
111 Ga0068859_100030651 3300005617 Bacteria 5398
112 Ga0068859_100076838 3300005617 Bacteria 3379
113 Ga0068864_100002243 3300005618 Bacteria 15978
114 Ga0068866_10001983 3300005718 Bacteria 8531
115 Ga0068866_10629037 3300005718 Bacteria 728
116 Ga0068861_100000942 3300005719 Bacteria 17675
117 Ga0068861_100039077 3300005719 Bacteria 3540
118 Ga0068861_101161056 3300005719 Bacteria 745
119 Ga0068863_100007838 3300005841 Bacteria 10440
120 Ga0068858_100016672 3300005842 Bacteria 6898
121 Ga0068860_100000598 3300005843 Bacteria 43069
122 Ga0068862_100002944 3300005844 Bacteria 14884
123 Ga0068862_100988163 3300005844 Bacteria 832
124 Ga0081455_10014358 3300005937 Bacteria 7770
125 Ga0081455_10020755 3300005937 Bacteria 6176
126 Ga0081540_1046399 3300005983 Bacteria 2194
127 Ga0081540_1077636 3300005983 Bacteria 1509
128 Ga0070717_10053359 3300006028 Bacteria 3332
129 Ga0070717_10326478 3300006028 Bacteria 1368
130 Ga0075365_10484677 3300006038 Bacteria 874
131 Ga0075363_100265443 3300006048 Bacteria 991
132 Ga0075432_10000910 3300006058 Bacteria 9311
133 Ga0070715_10003461 3300006163 Bacteria 5024
134 Ga0070715_10414604 3300006163 Bacteria 752
135 Ga0070716_100001603 3300006173 Bacteria 10188
136 Ga0070716_100170814 3300006173 Bacteria 1418
137 Ga0070712_100006515 3300006175 Bacteria 7246
138 Ga0070712_100130538 3300006175 Bacteria 1903
139 Ga0070712_100175321 3300006175 Bacteria 1667
140 Ga0075369_10023039 3300006186 Bacteria 2571
141 Ga0075366_10640271 3300006195 Bacteria 659
142 Ga0097621_100240950 3300006237 Bacteria 1581
143 Ga0097621_102315546 3300006237 Bacteria 514
144 Ga0075428_100133606 3300006844 Bacteria 2698
145 Ga0075431_100003503 3300006847 Bacteria 15211
146 Ga0075433_10023032 3300006852 Bacteria 5237
147 Ga0075434_100069351 3300006871 Bacteria 3515
148 Ga0075429_100041550 3300006880 Bacteria 4005
149 Ga0068865_100005623 3300006881 Bacteria 7609
150 Ga0068865_100110847 3300006881 Bacteria 2024
151 Ga0068865_100592701 3300006881 Bacteria 936
152 Ga0075436_100002180 3300006914 Bacteria 13503
153 Ga0075436_100027159 3300006914 Bacteria 3940
154 Ga0097620_100030651 3300006931 Bacteria 5398
155 Ga0097620_100076839 3300006931 Bacteria 3379
156 Ga0075435_100065482 3300007076 Bacteria 2954
157 Ga0075435_100087765 3300007076 Bacteria 2563
158 Ga0099795_10001948 3300007788 Bacteria 4692
159 Ga0105251_10071832 3300009011 Bacteria 1610
160 Ga0105251_10121149 3300009011 Bacteria 1188
161 Ga0105244_10048677 3300009036 Bacteria 2169
162 Ga0105250_10076922 3300009092 Bacteria 1351
163 Ga0105240_10039464 3300009093 Bacteria 6047
164 Ga0111539_10341243 3300009094 Bacteria 1744
165 Ga0111539_11038987 3300009094 Bacteria 952
166 Ga0105245_10000718 3300009098 Bacteria 29853
167 Ga0105245_10796709 3300009098 Bacteria 983
168 Ga0105245_13295271 3300009098 Bacteria 500
169 Ga0105247_10001104 3300009101 Bacteria 20096
170 Ga0105247_10418328 3300009101 Bacteria 959
171 Ga0105247_10965182 3300009101 Bacteria 663
172 Ga0114129_10051465 3300009147 Bacteria 5782
173 Ga0105243_10001752 3300009148 Bacteria 18680
174 Ga0105243_10183090 3300009148 Bacteria 1823
175 Ga0105243_10593114 3300009148 Bacteria 1065
176 Ga0105243_11128866 3300009148 Bacteria 794
177 Ga0105243_11638009 3300009148 Bacteria 671
178 Ga0105241_10003357 3300009174 Bacteria 11919
179 Ga0105241_11794485 3300009174 Bacteria 598
180 Ga0105242_10757195 3300009176 Bacteria 957
181 Ga0105248_10002832 3300009177 Bacteria 19248
182 Ga0105248_10049856 3300009177 Bacteria 4694
183 Ga0105237_10001618 3300009545 Bacteria 29243
184 Ga0105238_10007984 3300009551 Bacteria 10588
185 Ga0105238_12781241 3300009551 Bacteria 526
186 Ga0105249_10002122 3300009553 Bacteria 17209
187 Ga0105249_10019915 3300009553 Bacteria 5991
188 Ga0105249_10513588 3300009553 Bacteria 1245
189 Ga0105249_12662686 3300009553 Bacteria 572
190 Ga0105249_12989881 3300009553 Bacteria 543
191 Ga0099796_10051000 3300010159 Bacteria 1436
192 Ga0105239_10002536 3300010375 Bacteria 23214
193 Ga0105239_10067735 3300010375 Bacteria 3922
194 Ga0105246_10002439 3300011119 Bacteria 11222
195 Ga0105246_10291090 3300011119 Bacteria 1314
196 Ga0157373_10048800 3300013100 Bacteria 3018
197 Ga0157371_10018898 3300013102 Bacteria 5090
198 Ga0157370_11293650 3300013104 Bacteria 657
199 Ga0157369_10001227 3300013105 Bacteria 31941
200 Ga0157374_10028235 3300013296 Bacteria 5068
201 Ga0157378_10000470 3300013297 Bacteria 38483
202 Ga0157378_10813982 3300013297 Bacteria 960
203 Ga0157378_11215857 3300013297 Bacteria 793
204 Ga0163162_10136124 3300013306 Bacteria 2567
205 Ga0163162_10765479 3300013306 Bacteria 1084
206 Ga0163162_11247194 3300013306 Bacteria 844
207 Ga0157372_10001215 3300013307 Bacteria 27865
208 Ga0157372_12050085 3300013307 Bacteria 657
209 Ga0157375_10001640 3300013308 Bacteria 19249
210 Ga0157375_10007439 3300013308 Bacteria 9585
211 Ga0157375_13130304 3300013308 Bacteria 552
212 Ga0163163_10002310 3300014325 Bacteria 16099
213 Ga0163163_10005311 3300014325 Bacteria 11124
214 Ga0157380_10076160 3300014326 Bacteria 2729
215 Ga0157380_10143061 3300014326 Bacteria 2057
216 Ga0182008_10107640 3300014497 Bacteria 1380
217 Ga0157377_10006965 3300014745 Bacteria 5428
218 Ga0157379_10001927 3300014968 Bacteria 17169
219 Ga0157376_10000606 3300014969 Bacteria 23175
220 Ga0157376_10197722 3300014969 Bacteria 1848
221 Ga0163161_10005439 3300017792 Bacteria 8844
222 Ga0163161_10008942 3300017792 Bacteria 6925
223 Ga0163161_11899609 3300017792 Bacteria 530
224 Ga0206356_11650643 3300020070 Bacteria 1133
225 Ga0213873_10035050 3300021358 Bacteria 1268
226 Ga0213875_10123121 3300021388 Bacteria 1212
227 Ga0213875_10173164 3300021388 Bacteria 1014
228 Ga0213875_10258435 3300021388 Bacteria 822
229 Ga0213871_10124014 3300021441 Bacteria 772
230 Ga0224712_10068907 3300022467 Bacteria 1431
231 Ga0224570_109993 3300022730 Bacteria 596
232 Ga0224572_1054657 3300024225 Bacteria 742
233 Ga0228598_1020778 3300024227 Bacteria 1293
234 Ga0207656_10287146 3300025321 Bacteria 812
235 Ga0207713_1196988 3300025735 Bacteria 620
236 Ga0207653_10051268 3300025885 Bacteria 1374
237 Ga0207692_10024037 3300025898 Bacteria 2827
238 Ga0207692_10249418 3300025898 Bacteria 1063
239 Ga0207692_10391785 3300025898 Bacteria 864
240 Ga0207642_10002270 3300025899 Bacteria 5983
241 Ga0207642_10122545 3300025899 Bacteria 1344
242 Ga0207710_10003497 3300025900 Bacteria 6990
243 Ga0207688_10002614 3300025901 Bacteria 9749
244 Ga0207688_10654957 3300025901 Bacteria 663
245 Ga0207688_11077438 3300025901 Bacteria 507
246 Ga0207680_10114735 3300025903 Bacteria 1753
247 Ga0207647_10001458 3300025904 Bacteria 18183
248 Ga0207685_10000290 3300025905 Bacteria 7986
249 Ga0207685_10034041 3300025905 Bacteria 1847
250 Ga0207699_10002558 3300025906 Bacteria 8581
251 Ga0207645_10043754 3300025907 Bacteria 2866
252 Ga0207705_10154032 3300025909 Bacteria 1723
253 Ga0207654_10003285 3300025911 Bacteria 8172
254 Ga0207695_10425048 3300025913 Bacteria 1213
255 Ga0207671_10077044 3300025914 Bacteria 2496
256 Ga0207693_10000493 3300025915 Bacteria 35669
257 Ga0207693_10113345 3300025915 Bacteria 2127
258 Ga0207693_10125438 3300025915 Bacteria 2018
259 Ga0207663_10001067 3300025916 Bacteria 12565
260 Ga0207663_10804423 3300025916 Bacteria 749
261 Ga0207660_10034333 3300025917 Bacteria 3515
262 Ga0207660_10365717 3300025917 Bacteria 1158
263 Ga0207662_10045568 3300025918 Bacteria 2592
264 Ga0207657_10000282 3300025919 Bacteria 54101
265 Ga0207657_10738995 3300025919 Bacteria 763
266 Ga0207649_10001010 3300025920 Bacteria 17375
267 Ga0207649_10907252 3300025920 Bacteria 691
268 Ga0207652_10141055 3300025921 Bacteria 2155
269 Ga0207681_10033396 3300025923 Bacteria 3373
270 Ga0207694_10019951 3300025924 Bacteria 5071
271 Ga0207659_10005250 3300025926 Bacteria 7843
272 Ga0207659_10162871 3300025926 Bacteria 1753
273 Ga0207700_10712302 3300025928 Bacteria 896
274 Ga0207700_11099447 3300025928 Bacteria 711
275 Ga0207664_10012756 3300025929 Bacteria 6015
276 Ga0207664_10133566 3300025929 Bacteria 2092
277 Ga0207664_10354751 3300025929 Bacteria 1298
278 Ga0207664_11294975 3300025929 Bacteria 648
279 Ga0207644_10017754 3300025931 Bacteria 4810
280 Ga0207706_10000270 3300025933 Bacteria 56584
281 Ga0207706_10732870 3300025933 Bacteria 843
282 Ga0207686_10075628 3300025934 Bacteria 2181
283 Ga0207709_10032580 3300025935 Bacteria 3053
284 Ga0207709_10133493 3300025935 Bacteria 1695
285 Ga0207709_10588937 3300025935 Bacteria 879
286 Ga0207670_10025739 3300025936 Bacteria 3698
287 Ga0207669_10075263 3300025937 Bacteria 2138
288 Ga0207669_10811320 3300025937 Bacteria 777
289 Ga0207704_10018065 3300025938 Bacteria 3672
290 Ga0207704_10680210 3300025938 Bacteria 850
291 Ga0207665_10001538 3300025939 Bacteria 15513
292 Ga0207665_10007579 3300025939 Bacteria 7172
293 Ga0207691_10010501 3300025940 Bacteria 8885
294 Ga0207691_10497050 3300025940 Bacteria 1036
295 Ga0207711_10013882 3300025941 Bacteria 6690
296 Ga0207711_10747109 3300025941 Bacteria 912
297 Ga0207689_10006518 3300025942 Bacteria 10303
298 Ga0207661_10022097 3300025944 Bacteria 4783
299 Ga0207661_11139378 3300025944 Bacteria 718
300 Ga0207667_10011595 3300025949 Bacteria 10234
301 Ga0207651_10006413 3300025960 Bacteria 6156
302 Ga0207712_10042972 3300025961 Bacteria 3115
303 Ga0207712_11861607 3300025961 Bacteria 539
304 Ga0207668_10001057 3300025972 Bacteria 16415
305 Ga0207668_10114869 3300025972 Bacteria 2027
306 Ga0207640_10507893 3300025981 Bacteria 1005
307 Ga0207658_10007478 3300025986 Bacteria 7442
308 Ga0207677_10046226 3300026023 Bacteria 2913
309 Ga0207677_11450404 3300026023 Bacteria 633
310 Ga0207703_10010584 3300026035 Bacteria 7208
311 Ga0207639_11436428 3300026041 Bacteria 647
312 Ga0207678_10000477 3300026067 Bacteria 36336
313 Ga0207708_10000337 3300026075 Bacteria 36962
314 Ga0207708_10016146 3300026075 Bacteria 5609
315 Ga0207708_10081269 3300026075 Bacteria 2491
316 Ga0207702_10102306 3300026078 Bacteria 2531
317 Ga0207702_10196753 3300026078 Bacteria 1866
318 Ga0207702_10630702 3300026078 Bacteria 1053
319 Ga0207702_12429892 3300026078 Bacteria 511
320 Ga0207641_10017486 3300026088 Bacteria 5870
321 Ga0207648_10055524 3300026089 Bacteria 3457
322 Ga0207648_11188403 3300026089 Bacteria 716
323 Ga0207676_10028077 3300026095 Bacteria 4199
324 Ga0207676_10059434 3300026095 Bacteria 3019
325 Ga0207674_10002865 3300026116 Bacteria 21427
326 Ga0207674_10644903 3300026116 Bacteria 1023
327 Ga0207675_100002251 3300026118 Bacteria 19192
328 Ga0207675_100022526 3300026118 Bacteria 5865
329 Ga0207675_101300612 3300026118 Bacteria 747
330 Ga0207675_101718610 3300026118 Bacteria 647
331 Ga0207683_10000681 3300026121 Bacteria 31192
332 Ga0207683_11828352 3300026121 Bacteria 556
333 Ga0207698_11464924 3300026142 Bacteria 698
334 Ga0207428_10008303 3300027907 Bacteria 9386
335 Ga0207428_10860386 3300027907 Bacteria 642
336 Ga0265357_1001191 3300028023 Bacteria 1834
337 Ga0268266_10746671 3300028379 Bacteria 944
338 Ga0268265_10182679 3300028380 Bacteria 1803
339 Ga0268265_10820856 3300028380 Bacteria 908
340 Ga0268264_10020640 3300028381 Bacteria 5382
341 Ga0268264_10638707 3300028381 Bacteria 1052
342 Ga0265338_10660267 3300028800 Bacteria 724
343 Ga0265762_1017824 3300030760 Bacteria 1294
344 Ga0265760_10028793 3300031090 Bacteria 1631
345 Ga0265760_10091826 3300031090 Bacteria 951
346 Ga0265331_10041152 3300031250 Bacteria 2246
347 Ga0265316_10132279 3300031344 Bacteria 1878
348 Ga0265316_11101272 3300031344 Bacteria 551
349 Ga0307408_100430244 3300031548 Bacteria 1140
350 Ga0307408_100769660 3300031548 Bacteria 871
351 Ga0316575_10000986 3300031665 Bacteria 8786
352 Ga0316579_10016915 3300031691 Bacteria 3193
353 Ga0265342_10180624 3300031712 Bacteria 1156
354 Ga0316576_10005834 3300031727 Bacteria 7592
355 Ga0307405_10252139 3300031731 Bacteria 1314
356 Ga0307405_10324581 3300031731 Bacteria 1177
357 Ga0316577_10009939 3300031733 Bacteria 5131
358 Ga0307413_10068491 3300031824 Bacteria 2223
359 Ga0307413_10779066 3300031824 Bacteria 802
360 Ga0307413_10792958 3300031824 Bacteria 795
361 Ga0307406_10395799 3300031901 Bacteria 1093
362 Ga0307406_10845824 3300031901 Bacteria 775
363 Ga0307412_10030283 3300031911 Bacteria 3406
364 Ga0307409_100224075 3300031995 Bacteria 1700
365 Ga0307416_100111845 3300032002 Bacteria 2409
366 Ga0307416_101274431 3300032002 Bacteria 841
367 Ga0307411_10316917 3300032005 Bacteria 1258
368 Ga0307411_10390912 3300032005 Bacteria 1147
369 Ga0307411_10430887 3300032005 Bacteria 1098
370 Ga0307415_100454199 3300032126 Bacteria 1108
371 Ga0307415_100796194 3300032126 Bacteria 862
372 Ga0316583_10054181 3300032133 Bacteria 1410
373 Ga0316585_10002061 3300032137 Bacteria 5391
374 Ga0316580_10015499 3300032139 Bacteria 2332
375 Ga0316593_10000349 3300032168 Bacteria 8071
376 Ga0316592_1003508 3300033524 Bacteria 2833
377 Ga0316586_1009630 3300033527 Bacteria 1450
378 Ga0316588_1003356 3300033528 Bacteria 2911
379 Ga0316596_1000615 3300033541 Bacteria 6324
380 Ga0316596_1093529 3300033541 Bacteria 811
381 Ga0373930_0121500 3300034816 Bacteria 636
382 Ga0373926_0013170 3300035083 Bacteria 2802
383 Ga0373928_0167210 3300035084 Bacteria 618
384 Ga0373929_0030267 3300035085 Bacteria 1153
385 Ga0373929_0048974 3300035085 Bacteria 961
386 Ga0373940_0062626 3300035088 Bacteria 1067
387 Ga0373944_0199632 3300035089 Bacteria 724
388 Ga0373951_0008546 3300035091 Bacteria 2309
389 Ga0373923_0125153 3300035111 Bacteria 1151
390 Ga0373936_0315257 3300035113 Bacteria 708
391 Ga0373939_0011947 3300035114 Bacteria 2204
392 Ga0373941_0330837 3300035115 Bacteria 615
393 Ga0373945_0084273 3300035116 Bacteria 1222
394 Ga0373953_0468572 3300035117 Bacteria 557
395 Ga0373957_0202794 3300035120 Bacteria 827
396 Ga0373943_0006870 3300035170 Bacteria 5105
397 Ga0373943_0538662 3300035170 Bacteria 684
398 Ga0373946_0474182 3300035171 Bacteria 639
399 Ga0373942_0038211 3300035207 Bacteria 1301
400 Ga0373961_0157303 3300035241 Bacteria 778
401 Ga0316574_0001643 3300035398 Bacteria 10749
402 Ga0316574_0217715 3300035398 Bacteria 1224
403 Ga0316574_0924778 3300035398 Bacteria 527
404 Ga0373924_0006164 3300035410 Bacteria 4285
405 Ga0373924_0237454 3300035410 Bacteria 806
406 Ga0373931_0004918 3300035691 Bacteria 6144
407 Ga0373931_0049119 3300035691 Bacteria 2239
408 Ga0373935_0057637 3300035692 Bacteria 2478
409 Ga0373927_0050141 3300035695 Bacteria 2698
410 Ga0373927_0384791 3300035695 Bacteria 925
411 Ga0373933_0183660 3300035724 Bacteria 1334
412 Ga0373933_0194007 3300035724 Bacteria 1298
413 Ga0373947_0006238 3300035725 Bacteria 6931
414 Ga0373947_0177399 3300035725 Bacteria 1385
415 Ga0373947_0960300 3300035725 Bacteria 583
416 Ga0373937_0311322 3300036401 Bacteria 1489
417 Ga0373937_2139227 3300036401 Bacteria 505
418 Ga0316582_0009543 3300036647 Bacteria 5271
419 Ga0316584_0001849 3300036712 Bacteria 13108
420 Ga0373925_0167807 3300037068 Bacteria 1732
421 Ga0373925_1292678 3300037068 Bacteria 599
422 Ga0395900_0032155 3300037418 Bacteria 5394
423 Ga0395898_0639728 3300037466 Bacteria 1006
424 Ga0395905_0002506 3300037471 Bacteria 20297
425 Ga0395905_0319671 3300037471 Bacteria 1442
426 Ga0316581_0000487 3300037588 Bacteria 7649
427 Ga0436364_0565626 3300037853 Bacteria 555
428 Ga0436364_0927931 3300037853 Bacteria 1329
429 Ga0436364_0997073 3300037853 Bacteria 2123
430 Ga0395901_0151090 3300038443 Bacteria 2440
431 Ga0400490_42780 3300038726 Bacteria 1517
432 Ga0400486_04379 3300038742 Bacteria 2620
433 Ga0400486_08264 3300038742 Bacteria 1833
434 Ga0400487_10011 3300039110 Bacteria 1112
435 Ga0436365_0451316 3300039437 Bacteria 564
436 Ga0436365_1570347 3300039437 Bacteria 1106
437 Ga0436365_1727234 3300039437 Bacteria 663
438 Ga0436360_0846530 3300039438 Bacteria 557
439 Ga0436361_0930690 3300039447 Bacteria 2179
440 Ga0436363_0889443 3300039450 Bacteria 1025
441 Ga0436363_1571548 3300039450 Bacteria 7951
442 Ga0436362_0675540 3300039453 Bacteria 2436
443 Ga0439465_0013112 3300041413 Bacteria 2588
444 Ga0451794_27367 3300041446 Bacteria 547
445 Ga0451839_0361652 3300041496 Bacteria 628
446 Ga0439431_0095110 3300041997 Bacteria 815
447 Ga0439431_0250195 3300041997 Bacteria 526
448 Ga0439454_048333 3300042011 Bacteria 713
449 Ga0439457_186150 3300042014 Bacteria 508
450 Ga0495617_052691 3300046452 Bacteria 1352
451 Ga0495603_0000280 3300046455 Bacteria 27139
452 Ga0495629_0000177 3300046459 Bacteria 56906
453 Ga0495638_0279683 3300046460 Bacteria 907
454 Ga0495641_0029673 3300046461 Bacteria 2633
455 Ga0495580_0000498 3300046472 Bacteria 32908
456 Ga0495582_0000185 3300046473 Bacteria 34065
457 Ga0495639_0001788 3300046475 Bacteria 9521
458 Ga0495664_0072642 3300046477 Bacteria 2056
459 Ga0495594_0000224 3300046499 Bacteria 27588
460 Ga0495608_0626772 3300046511 Bacteria 644
461 Ga0495608_0884773 3300046511 Bacteria 523
462 Ga0495618_0239954 3300046514 Bacteria 1140
463 Ga0495666_0020979 3300046526 Bacteria 3235
464 Ga0495652_0198733 3300046529 Bacteria 1523
465 Ga0495665_0048045 3300046531 Bacteria 2263
466 Ga0495622_0000916 3300046557 Bacteria 15986
467 Ga0495667_0391434 3300046559 Bacteria 876
468 Ga0495668_0167441 3300046616 Bacteria 1204
469 Ga0495634_0003557 3300046642 Bacteria 12469
470 Ga0495588_0000617 3300046674 Bacteria 16755
471 Ga0495588_0238940 3300046674 Bacteria 958
472 Ga0495657_0165545 3300046675 Bacteria 1365
473 Ga0495647_0001129 3300046681 Bacteria 8180
474 Ga0495658_0399130 3300046683 Bacteria 876
475 Ga0495613_0037438 3300046689 Bacteria 3596
476 Ga0495624_0330223 3300046690 Bacteria 918
477 Ga0495649_0119724 3300046694 Bacteria 1393
478 Ga0495581_0001367 3300047315 Bacteria 13506
479 Ga0495604_0815245 3300047317 Bacteria 587
480 Ga0495674_0240554 3300047319 Bacteria 1492
481 Ga0495676_0437059 3300047321 Bacteria 864
482 Ga0495680_0079783 3300047322 Bacteria 2474
483 Ga0495673_0087438 3300047469 Bacteria 1279
484 Ga0495684_0351441 3300047471 Bacteria 1046
485 Ga0495593_0001943 3300047673 Bacteria 12328
486 Ga0495602_0354855 3300048088 Bacteria 1057
487 Ga0495614_0000618 3300048089 Bacteria 14895
488 Ga0495626_0174901 3300048091 Bacteria 893
489 Ga0496101_0077258 3300048904 Bacteria 2454
490 Ga0496101_0117548 3300048904 Bacteria 2007
491 Ga0496101_0234802 3300048904 Bacteria 1426
492 Ga0496101_0397399 3300048904 Bacteria 1085
493 Ga0496101_1531599 3300048904 Bacteria 519
494 Ga0496102_0024862 3300048905 Bacteria 5327
495 Ga0496102_0033525 3300048905 Bacteria 4616
496 Ga0496102_0223736 3300048905 Bacteria 1774
497 Ga0496102_0519856 3300048905 Bacteria 1113
498 Ga0496103_0136822 3300048906 Bacteria 1565
499 Ga0496104_0017958 3300048907 Bacteria 6448
500 Ga0496104_0045259 3300048907 Bacteria 4138
501 Ga0496104_0052296 3300048907 Bacteria 3857
502 Ga0496104_0131885 3300048907 Bacteria 2400
503 Ga0496104_0142115 3300048907 Bacteria 2306
504 Ga0496104_0416930 3300048907 Bacteria 1255
505 Ga0496104_0499920 3300048907 Bacteria 1127
506 Ga0496104_0945468 3300048907 Bacteria 766
507 Ga0496105_0006441 3300048908 Bacteria 9025
508 Ga0496105_0151616 3300048908 Bacteria 1905
509 Ga0496105_0499518 3300048908 Bacteria 955
510 Ga0496106_0091723 3300048909 Bacteria 2346
511 Ga0496106_0094349 3300048909 Bacteria 2313
512 Ga0496106_0498618 3300048909 Bacteria 978
513 Ga0496107_0003748 3300048910 Bacteria 10211
514 Ga0496107_0024386 3300048910 Bacteria 4278
515 Ga0496107_0055486 3300048910 Bacteria 2862
516 Ga0496107_0075028 3300048910 Bacteria 2461
517 Ga0496107_0378806 3300048910 Bacteria 1052
518 Ga0496108_0001133 3300048911 Bacteria 20819
519 Ga0496108_0021902 3300048911 Bacteria 5253
520 Ga0496108_0180575 3300048911 Bacteria 1827
521 Ga0496108_0449363 3300048911 Bacteria 1126
522 Ga0496108_0844396 3300048911 Bacteria 788
523 Ga0496108_0976407 3300048911 Bacteria 724
524 Ga0496109_0000583 3300048912 Bacteria 30510
525 Ga0496109_0078261 3300048912 Bacteria 3044
526 Ga0496109_0148378 3300048912 Bacteria 2195
527 Ga0496109_0162674 3300048912 Bacteria 2091
528 Ga0496109_0186745 3300048912 Bacteria 1947
529 Ga0496109_0283421 3300048912 Bacteria 1562
530 Ga0496109_1059183 3300048912 Bacteria 748
531 Ga0496110_0014672 3300048913 Bacteria 6512
532 Ga0496110_0062981 3300048913 Bacteria 3277
533 Ga0496110_0162976 3300048913 Bacteria 2021
534 Ga0496111_0002980 3300048914 Bacteria 10376
535 Ga0496111_0010039 3300048914 Bacteria 6336
536 Ga0496112_0000884 3300048915 Bacteria 21517
537 Ga0496112_0005326 3300048915 Bacteria 11105
538 Ga0496112_0040118 3300048915 Bacteria 4577
539 Ga0496112_0105310 3300048915 Bacteria 2790
540 Ga0496112_0119156 3300048915 Bacteria 2609
541 Ga0496113_0000351 3300048916 Bacteria 22021
542 Ga0496113_0016963 3300048916 Bacteria 5042
543 Ga0496113_0066735 3300048916 Bacteria 2726
544 Ga0496113_0116789 3300048916 Bacteria 2082
545 Ga0496114_0003614 3300048917 Bacteria 11884
546 Ga0496114_0033385 3300048917 Bacteria 4240
547 Ga0496114_0114919 3300048917 Bacteria 2309
548 Ga0496115_0004536 3300048918 Bacteria 10046
549 Ga0496115_0107641 3300048918 Bacteria 2289
550 Ga0496115_0112724 3300048918 Bacteria 2234
551 Ga0496124_0095308 3300048927 Bacteria 2419
552 Ga0501307_017947 3300049162 Bacteria 895
553 Ga0501031_0142725 3300049568 Bacteria 1565
554 Ga0501032_0106312 3300049569 Bacteria 1859
555 Ga0501032_0262477 3300049569 Bacteria 1120
556 Ga0501033_0082000 3300049570 Bacteria 2365
557 Ga0501034_0014685 3300049571 Bacteria 8064
558 Ga0501034_0014987 3300049571 Bacteria 7973
559 Ga0501034_0172892 3300049571 Bacteria 2126
560 Ga0501034_0584983 3300049571 Bacteria 1023
561 Ga0501034_0799191 3300049571 Bacteria 836
562 Ga0501036_0916616 3300049572 Bacteria 719
563 Ga0501036_1539035 3300049572 Bacteria 538
564 Ga0501038_0672149 3300049574 Bacteria 778
565 Ga0501039_0600033 3300049575 Bacteria 863
566 Ga0501039_0770615 3300049575 Bacteria 751
567 Ga0501040_0378075 3300049576 Bacteria 1016
568 Ga0501040_0550422 3300049576 Bacteria 833
569 Ga0501043_0979874 3300049579 Bacteria 603
570 Ga0501046_0139696 3300049580 Bacteria 1834
571 Ga0501046_0506808 3300049580 Bacteria 864
572 Ga0501047_0023054 3300049581 Bacteria 5976
573 Ga0501047_0557336 3300049581 Bacteria 970
574 Ga0501047_0639715 3300049581 Bacteria 883
575 Ga0501048_0058389 3300049582 Bacteria 2735
576 Ga0501048_0401596 3300049582 Bacteria 980
577 Ga0501067_0260490 3300049583 Bacteria 965
578 Ga0501068_0012735 3300049584 Bacteria 4774
579 Ga0501068_0377864 3300049584 Bacteria 912
580 Ga0501069_0004928 3300049585 Bacteria 6923
581 Ga0501070_0017027 3300049586 Bacteria 6099
582 Ga0501071_0368191 3300049587 Bacteria 1095
583 Ga0501071_1047662 3300049587 Bacteria 630
584 Ga0501073_0043526 3300049589 Bacteria 3166
585 Ga0501074_0110773 3300049590 Bacteria 1964
586 Ga0501076_1710880 3300049592 Bacteria 516
587 Ga0501079_0080947 3300049741 Bacteria 2511
588 Ga0501080_0009625 3300049742 Bacteria 8822
589 Ga0501080_0379929 3300049742 Bacteria 1273
590 Ga0501081_0786268 3300049743 Bacteria 716
591 Ga0501081_1100213 3300049743 Bacteria 601
592 Ga0501081_1509009 3300049743 Bacteria 510
593 Ga0501083_0086253 3300049744 Bacteria 2076
594 Ga0501035_0091548 3300049822 Bacteria 2676
595 Ga0501035_0760537 3300049822 Bacteria 777
596 Ga0501035_0907568 3300049822 Bacteria 697
597 Ga0501044_0106357 3300049823 Bacteria 2818
598 Ga0501044_0107329 3300049823 Bacteria 2803
599 Ga0501044_0888318 3300049823 Bacteria 766
600 nmdc:mga03n38_300102_c1 3300050490 Bacteria 862
601 nmdc:mga0yw44_1045237_c1 3300050492 Bacteria 552
602 nmdc:mga0yw44_1239015_c1 3300050492 Bacteria 503
603 nmdc:mga0yw44_698944_c1 3300050492 Bacteria 689
604 nmdc:mga0yw44_798739_c1 3300050492 Bacteria 641
605 nmdc:mga05p37_543913_c1 3300050507 Bacteria 1323
606 nmdc:mga05p37_815531_c1 3300050507 Bacteria 1019
607 nmdc:mga09592_38412_c1 3300050508 Bacteria 4019
608 nmdc:mga0qj67_119451_c1 3300050509 Bacteria 1516
609 nmdc:mga06r32_82733_c1 3300050510 Bacteria 3128
610 nmdc:mga08y16_1396023_c1 3300050511 Bacteria 664
611 nmdc:mga08y16_270689_c1 3300050511 Bacteria 1754
612 nmdc:mga0n895_189011_c1 3300050512 Bacteria 2091
613 nmdc:mga0rr50_40885_c1 3300050513 Bacteria 3374
614 nmdc:mga0rr50_88314_c1 3300050513 Bacteria 2408
615 nmdc:mga08x19_187071_c1 3300050514 Bacteria 1416
616 nmdc:mga08x19_41905_c1 3300050514 Bacteria 2917
617 nmdc:mga0a205_179499_c1 3300050515 Bacteria 2012
618 nmdc:mga0sz30_15776_c1 3300050516 Bacteria 2990
619 Ga0495601_0030907 3300053077 Bacteria 3327
620 Ga0495612_0058802 3300053078 Bacteria 1589
621 Ga0495655_0216010 3300053083 Bacteria 633
622 Ga0495595_0063731 3300053084 Bacteria 1731
623 Ga0495595_0686740 3300053084 Bacteria 524
624 Ga0495619_0001164 3300053085 Bacteria 17272
625 Ga0495619_0296822 3300053085 Bacteria 1119
626 Ga0500651_0630558 3300053093 Bacteria 579
627 Ga0500556_0000636 3300053104 Bacteria 22036
628 Ga0500562_036758 3300053108 Bacteria 1299
629 Ga0500616_0003259 3300053153 Bacteria 12557
630 Ga0500616_0065923 3300053153 Bacteria 1861
631 Ga0500645_115075 3300053730 Bacteria 753
632 Ga0501084_0039158 3300054114 Bacteria 3965
633 Ga0501082_1358039 3300060353 Bacteria 621
634 Ga0530510_0712691 3300061734 Bacteria 765

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10640271 Ga0075366_106402711 90
2 3300009092 Ga0105250_10076922 Ga0105250_100769224 90
3 3300005329 Ga0070683_100565925 Ga0070683_1005659252 98
4 3300025944 Ga0207661_11139378 Ga0207661_111393782 98
5 iso_pu_bacteria 8002285264 8002285926 100
6 3300039437 Ga0436365_0451316 Ga0436365_0451316_77_382 101
7 iso_pu_bacteria 2545555834 2545677362 101
8 iso_pu_bacteria 2842698319 2842701709 101
9 iso_pu_bacteria 2909042592 2909043607 101
10 iso_pu_bacteria 3003665799 3003667749 101
11 iso_pu_bacteria 641522639 641640670 101
12 iso_pu_bacteria 643348564 643599654 101
13 3300031548 Ga0307408_100769660 Ga0307408_1007696602 103
14 3300031731 Ga0307405_10324581 Ga0307405_103245812 103
15 3300031824 Ga0307413_10792958 Ga0307413_107929581 103
16 3300031995 Ga0307409_100224075 Ga0307409_1002240755 103
17 3300032005 Ga0307411_10390912 Ga0307411_103909121 103
18 3300032126 Ga0307415_100454199 Ga0307415_1004541991 103
19 3300041997 Ga0439431_0095110 Ga0439431_0095110_188_499 103
20 3300042014 Ga0439457_186150 Ga0439457_186150_123_434 103
21 3300049571 Ga0501034_0014685 Ga0501034_0014685_4228_4539 103
22 3300049571 Ga0501034_0172892 Ga0501034_0172892_1687_2001 103
23 3300049576 Ga0501040_0378075 Ga0501040_0378075_579_890 103
24 3300049823 Ga0501044_0106357 Ga0501044_0106357_2144_2455 103
25 3300005539 Ga0068853_100908836 Ga0068853_1009088362 104
26 3300005983 Ga0081540_1046399 Ga0081540_10463996 104
27 3300009101 Ga0105247_10965182 Ga0105247_109651822 104
28 3300009174 Ga0105241_11794485 Ga0105241_117944852 104
29 3300013104 Ga0157370_11293650 Ga0157370_112936502 104
30 3300013307 Ga0157372_12050085 Ga0157372_120500852 104
31 3300026041 Ga0207639_11436428 Ga0207639_114364281 104
32 3300031344 Ga0265316_11101272 Ga0265316_111012721 104
33 3300031712 Ga0265342_10180624 Ga0265342_101806242 104
34 3300035398 Ga0316574_0924778 Ga0316574_0924778_184_498 104
35 3300049568 Ga0501031_0142725 Ga0501031_0142725_977_1291 104
36 3300049569 Ga0501032_0106312 Ga0501032_0106312_1112_1426 104
37 3300049570 Ga0501033_0082000 Ga0501033_0082000_1782_2096 104
38 3300049572 Ga0501036_0916616 Ga0501036_0916616_180_494 104
39 3300049574 Ga0501038_0672149 Ga0501038_0672149_86_400 104
40 3300049575 Ga0501039_0600033 Ga0501039_0600033_451_765 104
41 3300049581 Ga0501047_0639715 Ga0501047_0639715_322_636 104
42 3300049584 Ga0501068_0377864 Ga0501068_0377864_526_846 104
43 3300049592 Ga0501076_1710880 Ga0501076_1710880_26_346 104
44 3300049822 Ga0501035_0907568 Ga0501035_0907568_109_423 104
45 3300049823 Ga0501044_0107329 Ga0501044_0107329_692_1006 104
46 3300053083 Ga0495655_0216010 Ga0495655_0216010_119_436 104
47 3300001979 JGI24740J21852_10158064 JGI24740J21852_101580641 105
48 3300001990 JGI24737J22298_10002957 JGI24737J22298_100029573 105
49 3300002067 JGI24735J21928_10114903 JGI24735J21928_101149032 105
50 3300002070 JGI24750J21931_1025865 JGI24750J21931_10258652 105
51 3300002074 JGI24748J21848_1061909 JGI24748J21848_10619091 105
52 3300002075 JGI24738J21930_10005208 JGI24738J21930_100052085 105
53 3300002077 JGI24744J21845_10030691 JGI24744J21845_100306913 105
54 3300002239 JGI24034J26672_10026547 JGI24034J26672_100265472 105
55 3300002244 JGI24742J22300_10034521 JGI24742J22300_100345212 105
56 3300002459 JGI24751J29686_10074257 JGI24751J29686_100742571 105
57 3300003911 JGI25405J52794_10135021 JGI25405J52794_101350212 105
58 3300005290 Ga0065712_10141376 Ga0065712_101413764 105
59 3300005295 Ga0065707_10838764 Ga0065707_108387642 105
60 3300005327 Ga0070658_10012301 Ga0070658_1001230111 105
61 3300005328 Ga0070676_10014395 Ga0070676_100143959 105
62 3300005328 Ga0070676_10357237 Ga0070676_103572372 105
63 3300005329 Ga0070683_100014681 Ga0070683_10001468111 105
64 3300005330 Ga0070690_100012397 Ga0070690_10001239710 105
65 3300005330 Ga0070690_100137081 Ga0070690_1001370814 105
66 3300005331 Ga0070670_100000376 Ga0070670_10000037633 105
67 3300005331 Ga0070670_101001242 Ga0070670_1010012422 105
68 3300005334 Ga0068869_100003825 Ga0068869_1000038255 105
69 3300005335 Ga0070666_10004644 Ga0070666_1000464412 105
70 3300005336 Ga0070680_100008294 Ga0070680_1000082949 105
71 3300005336 Ga0070680_100707378 Ga0070680_1007073782 105
72 3300005337 Ga0070682_100041295 Ga0070682_1000412955 105
73 3300005338 Ga0068868_100010801 Ga0068868_10001080110 105
74 3300005338 Ga0068868_100844818 Ga0068868_1008448181 105
75 3300005339 Ga0070660_100000686 Ga0070660_10000068618 105
76 3300005339 Ga0070660_101541607 Ga0070660_1015416071 105
77 3300005340 Ga0070689_100000122 Ga0070689_10000012225 105
78 3300005341 Ga0070691_10000273 Ga0070691_1000027321 105
79 3300005344 Ga0070661_100000385 Ga0070661_10000038510 105
80 3300005345 Ga0070692_10003072 Ga0070692_100030726 105
81 3300005345 Ga0070692_10701732 Ga0070692_107017322 105
82 3300005353 Ga0070669_100002082 Ga0070669_1000020829 105
83 3300005354 Ga0070675_100700921 Ga0070675_1007009212 105
84 3300005355 Ga0070671_100001283 Ga0070671_10000128317 105
85 3300005356 Ga0070674_100000649 Ga0070674_10000064918 105
86 3300005356 Ga0070674_100005343 Ga0070674_10000534312 105
87 3300005356 Ga0070674_101674466 Ga0070674_1016744661 105
88 3300005364 Ga0070673_100002163 Ga0070673_10000216311 105
89 3300005365 Ga0070688_100000217 Ga0070688_10000021730 105
90 3300005366 Ga0070659_100003485 Ga0070659_10000348515 105
91 3300005367 Ga0070667_100003614 Ga0070667_10000361413 105
92 3300005406 Ga0070703_10217434 Ga0070703_102174342 105
93 3300005434 Ga0070709_10001353 Ga0070709_100013539 105
94 3300005434 Ga0070709_11337907 Ga0070709_113379072 105
95 3300005435 Ga0070714_100006925 Ga0070714_1000069259 105
96 3300005435 Ga0070714_100050142 Ga0070714_1000501427 105
97 3300005435 Ga0070714_101396830 Ga0070714_1013968302 105
98 3300005436 Ga0070713_101269131 Ga0070713_1012691312 105
99 3300005437 Ga0070710_10005298 Ga0070710_100052989 105
100 3300005437 Ga0070710_10297179 Ga0070710_102971792 105
101 3300005438 Ga0070701_10000897 Ga0070701_1000089712 105
102 3300005439 Ga0070711_100000834 Ga0070711_10000083418 105
103 3300005439 Ga0070711_100043033 Ga0070711_1000430332 105
104 3300005439 Ga0070711_101003908 Ga0070711_1010039081 105
105 3300005440 Ga0070705_100001475 Ga0070705_1000014758 105
106 3300005440 Ga0070705_100054734 Ga0070705_1000547341 105
107 3300005441 Ga0070700_100001041 Ga0070700_10000104118 105
108 3300005441 Ga0070700_100133165 Ga0070700_1001331652 105
109 3300005441 Ga0070700_100271271 Ga0070700_1002712713 105
110 3300005444 Ga0070694_100000195 Ga0070694_10000019513 105
111 3300005444 Ga0070694_101306564 Ga0070694_1013065642 105
112 3300005455 Ga0070663_100000352 Ga0070663_10000035216 105
113 3300005455 Ga0070663_100341785 Ga0070663_1003417852 105
114 3300005456 Ga0070678_100001146 Ga0070678_10000114612 105
115 3300005456 Ga0070678_100257457 Ga0070678_1002574574 105
116 3300005457 Ga0070662_100000412 Ga0070662_10000041230 105
117 3300005457 Ga0070662_100758779 Ga0070662_1007587791 105
118 3300005458 Ga0070681_10423869 Ga0070681_104238691 105
119 3300005459 Ga0068867_100042053 Ga0068867_1000420536 105
120 3300005459 Ga0068867_100292281 Ga0068867_1002922813 105
121 3300005466 Ga0070685_10155510 Ga0070685_101555104 105
122 3300005518 Ga0070699_100101221 Ga0070699_1001012215 105
123 3300005530 Ga0070679_100103457 Ga0070679_1001034575 105
124 3300005535 Ga0070684_100149269 Ga0070684_1001492693 105
125 3300005536 Ga0070697_100000391 Ga0070697_10000039133 105
126 3300005539 Ga0068853_100001082 Ga0068853_10000108215 105
127 3300005543 Ga0070672_100002807 Ga0070672_10000280716 105
128 3300005543 Ga0070672_100351224 Ga0070672_1003512242 105
129 3300005544 Ga0070686_100001391 Ga0070686_10000139112 105
130 3300005544 Ga0070686_101519100 Ga0070686_1015191002 105
131 3300005545 Ga0070695_100000238 Ga0070695_10000023820 105
132 3300005546 Ga0070696_100000815 Ga0070696_1000008159 105
133 3300005546 Ga0070696_100311884 Ga0070696_1003118842 105
134 3300005547 Ga0070693_100000455 Ga0070693_10000045515 105
135 3300005547 Ga0070693_100290171 Ga0070693_1002901712 105
136 3300005548 Ga0070665_100008997 Ga0070665_1000089974 105
137 3300005549 Ga0070704_100000124 Ga0070704_10000012415 105
138 3300005549 Ga0070704_100675714 Ga0070704_1006757142 105
139 3300005563 Ga0068855_100002691 Ga0068855_10000269118 105
140 3300005564 Ga0070664_100002450 Ga0070664_10000245011 105
141 3300005577 Ga0068857_100008457 Ga0068857_1000084572 105
142 3300005577 Ga0068857_100363422 Ga0068857_1003634222 105
143 3300005577 Ga0068857_101329909 Ga0068857_1013299092 105
144 3300005578 Ga0068854_100004862 Ga0068854_10000486214 105
145 3300005578 Ga0068854_100207540 Ga0068854_1002075402 105
146 3300005614 Ga0068856_100005122 Ga0068856_10000512211 105
147 3300005614 Ga0068856_100194610 Ga0068856_1001946105 105
148 3300005614 Ga0068856_100937139 Ga0068856_1009371392 105
149 3300005614 Ga0068856_101631752 Ga0068856_1016317522 105
150 3300005615 Ga0070702_100000018 Ga0070702_10000001821 105
151 3300005615 Ga0070702_100289754 Ga0070702_1002897543 105
152 3300005615 Ga0070702_100451962 Ga0070702_1004519622 105
153 3300005616 Ga0068852_100010938 Ga0068852_10001093814 105
154 3300005616 Ga0068852_101698313 Ga0068852_1016983131 105
155 3300005617 Ga0068859_100030651 Ga0068859_10003065112 105
156 3300005617 Ga0068859_100076838 Ga0068859_1000768382 105
157 3300005618 Ga0068864_100002243 Ga0068864_1000022439 105
158 3300005718 Ga0068866_10001983 Ga0068866_1000198315 105
159 3300005718 Ga0068866_10629037 Ga0068866_106290372 105
160 3300005719 Ga0068861_100000942 Ga0068861_10000094216 105
161 3300005719 Ga0068861_100039077 Ga0068861_1000390779 105
162 3300005719 Ga0068861_101161056 Ga0068861_1011610562 105
163 3300005841 Ga0068863_100007838 Ga0068863_1000078384 105
164 3300005842 Ga0068858_100016672 Ga0068858_1000166725 105
165 3300005843 Ga0068860_100000598 Ga0068860_10000059822 105
166 3300005844 Ga0068862_100002944 Ga0068862_1000029446 105
167 3300005844 Ga0068862_100988163 Ga0068862_1009881632 105
168 3300005937 Ga0081455_10014358 Ga0081455_100143589 105
169 3300005937 Ga0081455_10020755 Ga0081455_100207558 105
170 3300005983 Ga0081540_1077636 Ga0081540_10776363 105
171 3300006028 Ga0070717_10053359 Ga0070717_100533596 105
172 3300006028 Ga0070717_10326478 Ga0070717_103264782 105
173 3300006038 Ga0075365_10484677 Ga0075365_104846772 105
174 3300006048 Ga0075363_100265443 Ga0075363_1002654432 105
175 3300006058 Ga0075432_10000910 Ga0075432_1000091012 105
176 3300006163 Ga0070715_10003461 Ga0070715_100034616 105
177 3300006163 Ga0070715_10414604 Ga0070715_104146042 105
178 3300006173 Ga0070716_100001603 Ga0070716_10000160314 105
179 3300006173 Ga0070716_100170814 Ga0070716_1001708143 105
180 3300006175 Ga0070712_100006515 Ga0070712_10000651511 105
181 3300006175 Ga0070712_100130538 Ga0070712_1001305383 105
182 3300006175 Ga0070712_100175321 Ga0070712_1001753215 105
183 3300006186 Ga0075369_10023039 Ga0075369_100230394 105
184 3300006237 Ga0097621_100240950 Ga0097621_1002409501 105
185 3300006237 Ga0097621_102315546 Ga0097621_1023155462 105
186 3300006844 Ga0075428_100133606 Ga0075428_1001336066 105
187 3300006847 Ga0075431_100003503 Ga0075431_10000350313 105
188 3300006852 Ga0075433_10023032 Ga0075433_1002303211 105
189 3300006871 Ga0075434_100069351 Ga0075434_1000693517 105
190 3300006880 Ga0075429_100041550 Ga0075429_1000415509 105
191 3300006881 Ga0068865_100005623 Ga0068865_10000562311 105
192 3300006881 Ga0068865_100110847 Ga0068865_1001108472 105
193 3300006881 Ga0068865_100592701 Ga0068865_1005927012 105
194 3300006914 Ga0075436_100002180 Ga0075436_10000218019 105
195 3300006914 Ga0075436_100027159 Ga0075436_1000271593 105
196 3300006931 Ga0097620_100030651 Ga0097620_1000306512 105
197 3300006931 Ga0097620_100076839 Ga0097620_1000768392 105
198 3300007076 Ga0075435_100065482 Ga0075435_1000654826 105
199 3300007076 Ga0075435_100087765 Ga0075435_1000877652 105
200 3300007788 Ga0099795_10001948 Ga0099795_100019487 105
201 3300009011 Ga0105251_10071832 Ga0105251_100718322 105
202 3300009011 Ga0105251_10121149 Ga0105251_101211492 105
203 3300009036 Ga0105244_10048677 Ga0105244_100486773 105
204 3300009093 Ga0105240_10039464 Ga0105240_1003946411 105
205 3300009094 Ga0111539_10341243 Ga0111539_103412432 105
206 3300009094 Ga0111539_11038987 Ga0111539_110389871 105
207 3300009098 Ga0105245_10000718 Ga0105245_100007188 105
208 3300009098 Ga0105245_10796709 Ga0105245_107967092 105
209 3300009098 Ga0105245_13295271 Ga0105245_132952712 105
210 3300009101 Ga0105247_10001104 Ga0105247_1000110420 105
211 3300009101 Ga0105247_10418328 Ga0105247_104183282 105
212 3300009147 Ga0114129_10051465 Ga0114129_100514658 105
213 3300009148 Ga0105243_10001752 Ga0105243_1000175212 105
214 3300009148 Ga0105243_10183090 Ga0105243_101830904 105
215 3300009148 Ga0105243_10593114 Ga0105243_105931141 105
216 3300009148 Ga0105243_11128866 Ga0105243_111288662 105
217 3300009148 Ga0105243_11638009 Ga0105243_116380091 105
218 3300009174 Ga0105241_10003357 Ga0105241_100033577 105
219 3300009176 Ga0105242_10757195 Ga0105242_107571952 105
220 3300009177 Ga0105248_10002832 Ga0105248_1000283213 105
221 3300009177 Ga0105248_10049856 Ga0105248_100498562 105
222 3300009545 Ga0105237_10001618 Ga0105237_1000161810 105
223 3300009551 Ga0105238_10007984 Ga0105238_1000798416 105
224 3300009551 Ga0105238_12781241 Ga0105238_127812412 105
225 3300009553 Ga0105249_10002122 Ga0105249_1000212218 105
226 3300009553 Ga0105249_10019915 Ga0105249_1001991510 105
227 3300009553 Ga0105249_10513588 Ga0105249_105135883 105
228 3300009553 Ga0105249_12662686 Ga0105249_126626862 105
229 3300009553 Ga0105249_12989881 Ga0105249_129898812 105
230 3300010159 Ga0099796_10051000 Ga0099796_100510002 105
231 3300010375 Ga0105239_10002536 Ga0105239_100025365 105
232 3300010375 Ga0105239_10067735 Ga0105239_100677355 105
233 3300011119 Ga0105246_10002439 Ga0105246_100024397 105
234 3300011119 Ga0105246_10291090 Ga0105246_102910902 105
235 3300013100 Ga0157373_10048800 Ga0157373_100488006 105
236 3300013102 Ga0157371_10018898 Ga0157371_100188989 105
237 3300013105 Ga0157369_10001227 Ga0157369_100012279 105
238 3300013296 Ga0157374_10028235 Ga0157374_100282358 105
239 3300013297 Ga0157378_10000470 Ga0157378_1000047015 105
240 3300013297 Ga0157378_10813982 Ga0157378_108139822 105
241 3300013297 Ga0157378_11215857 Ga0157378_112158572 105
242 3300013306 Ga0163162_10136124 Ga0163162_101361245 105
243 3300013306 Ga0163162_10765479 Ga0163162_107654792 105
244 3300013306 Ga0163162_11247194 Ga0163162_112471942 105
245 3300013307 Ga0157372_10001215 Ga0157372_1000121514 105
246 3300013308 Ga0157375_10001640 Ga0157375_100016406 105
247 3300013308 Ga0157375_10007439 Ga0157375_1000743911 105
248 3300013308 Ga0157375_13130304 Ga0157375_131303042 105
249 3300014325 Ga0163163_10002310 Ga0163163_100023109 105
250 3300014325 Ga0163163_10005311 Ga0163163_1000531113 105
251 3300014326 Ga0157380_10076160 Ga0157380_100761605 105
252 3300014326 Ga0157380_10143061 Ga0157380_101430613 105
253 3300014497 Ga0182008_10107640 Ga0182008_101076402 105
254 3300014745 Ga0157377_10006965 Ga0157377_1000696511 105
255 3300014968 Ga0157379_10001927 Ga0157379_1000192715 105
256 3300014969 Ga0157376_10000606 Ga0157376_1000060624 105
257 3300014969 Ga0157376_10197722 Ga0157376_101977224 105
258 3300017792 Ga0163161_10005439 Ga0163161_100054396 105
259 3300017792 Ga0163161_10008942 Ga0163161_1000894213 105
260 3300017792 Ga0163161_11899609 Ga0163161_118996091 105
261 3300020070 Ga0206356_11650643 Ga0206356_116506432 105
262 3300021358 Ga0213873_10035050 Ga0213873_100350502 105
263 3300021388 Ga0213875_10123121 Ga0213875_101231212 105
264 3300021388 Ga0213875_10173164 Ga0213875_101731641 105
265 3300021388 Ga0213875_10258435 Ga0213875_102584351 105
266 3300021441 Ga0213871_10124014 Ga0213871_101240142 105
267 3300022467 Ga0224712_10068907 Ga0224712_100689072 105
268 3300022730 Ga0224570_109993 Ga0224570_1099931 105
269 3300024225 Ga0224572_1054657 Ga0224572_10546572 105
270 3300024227 Ga0228598_1020778 Ga0228598_10207782 105
271 3300025321 Ga0207656_10287146 Ga0207656_102871462 105
272 3300025735 Ga0207713_1196988 Ga0207713_11969882 105
273 3300025885 Ga0207653_10051268 Ga0207653_100512684 105
274 3300025898 Ga0207692_10024037 Ga0207692_100240372 105
275 3300025898 Ga0207692_10249418 Ga0207692_102494182 105
276 3300025898 Ga0207692_10391785 Ga0207692_103917852 105
277 3300025899 Ga0207642_10002270 Ga0207642_100022706 105
278 3300025899 Ga0207642_10122545 Ga0207642_101225452 105
279 3300025900 Ga0207710_10003497 Ga0207710_1000349712 105
280 3300025901 Ga0207688_10002614 Ga0207688_1000261410 105
281 3300025901 Ga0207688_10654957 Ga0207688_106549571 105
282 3300025901 Ga0207688_11077438 Ga0207688_110774381 105
283 3300025903 Ga0207680_10114735 Ga0207680_101147352 105
284 3300025904 Ga0207647_10001458 Ga0207647_100014589 105
285 3300025905 Ga0207685_10000290 Ga0207685_1000029010 105
286 3300025905 Ga0207685_10034041 Ga0207685_100340414 105
287 3300025906 Ga0207699_10002558 Ga0207699_1000255813 105
288 3300025907 Ga0207645_10043754 Ga0207645_100437544 105
289 3300025909 Ga0207705_10154032 Ga0207705_101540322 105
290 3300025911 Ga0207654_10003285 Ga0207654_1000328515 105
291 3300025913 Ga0207695_10425048 Ga0207695_104250482 105
292 3300025914 Ga0207671_10077044 Ga0207671_100770443 105
293 3300025915 Ga0207693_10000493 Ga0207693_1000049332 105
294 3300025915 Ga0207693_10113345 Ga0207693_101133452 105
295 3300025915 Ga0207693_10125438 Ga0207693_101254386 105
296 3300025916 Ga0207663_10001067 Ga0207663_100010675 105
297 3300025916 Ga0207663_10804423 Ga0207663_108044232 105
298 3300025917 Ga0207660_10034333 Ga0207660_100343334 105
299 3300025917 Ga0207660_10365717 Ga0207660_103657172 105
300 3300025918 Ga0207662_10045568 Ga0207662_100455681 105
301 3300025919 Ga0207657_10000282 Ga0207657_1000028234 105
302 3300025919 Ga0207657_10738995 Ga0207657_107389952 105
303 3300025920 Ga0207649_10001010 Ga0207649_1000101024 105
304 3300025920 Ga0207649_10907252 Ga0207649_109072522 105
305 3300025921 Ga0207652_10141055 Ga0207652_101410555 105
306 3300025923 Ga0207681_10033396 Ga0207681_100333966 105
307 3300025924 Ga0207694_10019951 Ga0207694_100199514 105
308 3300025926 Ga0207659_10005250 Ga0207659_100052502 105
309 3300025926 Ga0207659_10162871 Ga0207659_101628714 105
310 3300025928 Ga0207700_10712302 Ga0207700_107123022 105
311 3300025928 Ga0207700_11099447 Ga0207700_110994472 105
312 3300025929 Ga0207664_10012756 Ga0207664_100127562 105
313 3300025929 Ga0207664_10133566 Ga0207664_101335664 105
314 3300025929 Ga0207664_10354751 Ga0207664_103547513 105
315 3300025929 Ga0207664_11294975 Ga0207664_112949752 105
316 3300025931 Ga0207644_10017754 Ga0207644_100177546 105
317 3300025933 Ga0207706_10000270 Ga0207706_1000027035 105
318 3300025933 Ga0207706_10732870 Ga0207706_107328701 105
319 3300025934 Ga0207686_10075628 Ga0207686_100756282 105
320 3300025935 Ga0207709_10032580 Ga0207709_100325807 105
321 3300025935 Ga0207709_10133493 Ga0207709_101334932 105
322 3300025935 Ga0207709_10588937 Ga0207709_105889372 105
323 3300025936 Ga0207670_10025739 Ga0207670_100257399 105
324 3300025937 Ga0207669_10075263 Ga0207669_100752632 105
325 3300025937 Ga0207669_10811320 Ga0207669_108113201 105
326 3300025938 Ga0207704_10018065 Ga0207704_100180655 105
327 3300025938 Ga0207704_10680210 Ga0207704_106802102 105
328 3300025939 Ga0207665_10001538 Ga0207665_1000153813 105
329 3300025939 Ga0207665_10007579 Ga0207665_1000757911 105
330 3300025940 Ga0207691_10010501 Ga0207691_1001050113 105
331 3300025940 Ga0207691_10497050 Ga0207691_104970502 105
332 3300025941 Ga0207711_10013882 Ga0207711_1001388210 105
333 3300025941 Ga0207711_10747109 Ga0207711_107471091 105
334 3300025942 Ga0207689_10006518 Ga0207689_1000651814 105
335 3300025944 Ga0207661_10022097 Ga0207661_100220976 105
336 3300025949 Ga0207667_10011595 Ga0207667_1001159515 105
337 3300025960 Ga0207651_10006413 Ga0207651_1000641310 105
338 3300025961 Ga0207712_10042972 Ga0207712_100429727 105
339 3300025961 Ga0207712_11861607 Ga0207712_118616072 105
340 3300025972 Ga0207668_10001057 Ga0207668_1000105719 105
341 3300025972 Ga0207668_10114869 Ga0207668_101148695 105
342 3300025981 Ga0207640_10507893 Ga0207640_105078932 105
343 3300025986 Ga0207658_10007478 Ga0207658_1000747810 105
344 3300026023 Ga0207677_10046226 Ga0207677_100462262 105
345 3300026023 Ga0207677_11450404 Ga0207677_114504042 105
346 3300026035 Ga0207703_10010584 Ga0207703_1001058410 105
347 3300026067 Ga0207678_10000477 Ga0207678_1000047735 105
348 3300026075 Ga0207708_10000337 Ga0207708_1000033715 105
349 3300026075 Ga0207708_10016146 Ga0207708_100161465 105
350 3300026075 Ga0207708_10081269 Ga0207708_100812694 105
351 3300026078 Ga0207702_10102306 Ga0207702_101023062 105
352 3300026078 Ga0207702_10196753 Ga0207702_101967532 105
353 3300026078 Ga0207702_10630702 Ga0207702_106307022 105
354 3300026078 Ga0207702_12429892 Ga0207702_124298922 105
355 3300026088 Ga0207641_10017486 Ga0207641_1001748612 105
356 3300026089 Ga0207648_10055524 Ga0207648_100555246 105
357 3300026089 Ga0207648_11188403 Ga0207648_111884032 105
358 3300026095 Ga0207676_10028077 Ga0207676_100280779 105
359 3300026095 Ga0207676_10059434 Ga0207676_100594342 105
360 3300026116 Ga0207674_10002865 Ga0207674_100028656 105
361 3300026116 Ga0207674_10644903 Ga0207674_106449032 105
362 3300026118 Ga0207675_100002251 Ga0207675_10000225125 105
363 3300026118 Ga0207675_100022526 Ga0207675_1000225265 105
364 3300026118 Ga0207675_101300612 Ga0207675_1013006122 105
365 3300026118 Ga0207675_101718610 Ga0207675_1017186101 105
366 3300026121 Ga0207683_10000681 Ga0207683_100006819 105
367 3300026121 Ga0207683_11828352 Ga0207683_118283521 105
368 3300026142 Ga0207698_11464924 Ga0207698_114649241 105
369 3300027907 Ga0207428_10008303 Ga0207428_1000830315 105
370 3300027907 Ga0207428_10860386 Ga0207428_108603862 105
371 3300028023 Ga0265357_1001191 Ga0265357_10011914 105
372 3300028379 Ga0268266_10746671 Ga0268266_107466712 105
373 3300028380 Ga0268265_10182679 Ga0268265_101826792 105
374 3300028380 Ga0268265_10820856 Ga0268265_108208561 105
375 3300028381 Ga0268264_10020640 Ga0268264_100206405 105
376 3300028381 Ga0268264_10638707 Ga0268264_106387071 105
377 3300028800 Ga0265338_10660267 Ga0265338_106602672 105
378 3300030760 Ga0265762_1017824 Ga0265762_10178242 105
379 3300031090 Ga0265760_10028793 Ga0265760_100287932 105
380 3300031090 Ga0265760_10091826 Ga0265760_100918263 105
381 3300031250 Ga0265331_10041152 Ga0265331_100411524 105
382 3300031344 Ga0265316_10132279 Ga0265316_101322796 105
383 3300031548 Ga0307408_100430244 Ga0307408_1004302441 105
384 3300031665 Ga0316575_10000986 Ga0316575_1000098610 105
385 3300031691 Ga0316579_10016915 Ga0316579_100169156 105
386 3300031727 Ga0316576_10005834 Ga0316576_100058349 105
387 3300031731 Ga0307405_10252139 Ga0307405_102521392 105
388 3300031733 Ga0316577_10009939 Ga0316577_1000993910 105
389 3300031824 Ga0307413_10068491 Ga0307413_100684914 105
390 3300031824 Ga0307413_10779066 Ga0307413_107790662 105
391 3300031901 Ga0307406_10395799 Ga0307406_103957992 105
392 3300031901 Ga0307406_10845824 Ga0307406_108458242 105
393 3300031911 Ga0307412_10030283 Ga0307412_100302837 105
394 3300032002 Ga0307416_100111845 Ga0307416_1001118455 105
395 3300032002 Ga0307416_101274431 Ga0307416_1012744312 105
396 3300032005 Ga0307411_10316917 Ga0307411_103169173 105
397 3300032005 Ga0307411_10430887 Ga0307411_104308872 105
398 3300032126 Ga0307415_100796194 Ga0307415_1007961942 105
399 3300032133 Ga0316583_10054181 Ga0316583_100541814 105
400 3300032137 Ga0316585_10002061 Ga0316585_1000206110 105
401 3300032139 Ga0316580_10015499 Ga0316580_100154992 105
402 3300032168 Ga0316593_10000349 Ga0316593_100003497 105
403 3300033524 Ga0316592_1003508 Ga0316592_10035084 105
404 3300033527 Ga0316586_1009630 Ga0316586_10096302 105
405 3300033528 Ga0316588_1003356 Ga0316588_10033565 105
406 3300033541 Ga0316596_1000615 Ga0316596_10006158 105
407 3300033541 Ga0316596_1093529 Ga0316596_10935292 105
408 3300034816 Ga0373930_0121500 Ga0373930_0121500_194_514 105
409 3300035083 Ga0373926_0013170 Ga0373926_0013170_1823_2143 105
410 3300035084 Ga0373928_0167210 Ga0373928_0167210_193_513 105
411 3300035085 Ga0373929_0030267 Ga0373929_0030267_134_454 105
412 3300035085 Ga0373929_0048974 Ga0373929_0048974_127_447 105
413 3300035088 Ga0373940_0062626 Ga0373940_0062626_665_985 105
414 3300035089 Ga0373944_0199632 Ga0373944_0199632_230_550 105
415 3300035091 Ga0373951_0008546 Ga0373951_0008546_1252_1572 105
416 3300035111 Ga0373923_0125153 Ga0373923_0125153_129_455 105
417 3300035113 Ga0373936_0315257 Ga0373936_0315257_79_399 105
418 3300035114 Ga0373939_0011947 Ga0373939_0011947_1714_2034 105
419 3300035115 Ga0373941_0330837 Ga0373941_0330837_97_417 105
420 3300035116 Ga0373945_0084273 Ga0373945_0084273_724_1044 105
421 3300035117 Ga0373953_0468572 Ga0373953_0468572_52_378 105
422 3300035120 Ga0373957_0202794 Ga0373957_0202794_428_754 105
423 3300035170 Ga0373943_0006870 Ga0373943_0006870_112_432 105
424 3300035170 Ga0373943_0538662 Ga0373943_0538662_100_417 105
425 3300035171 Ga0373946_0474182 Ga0373946_0474182_291_611 105
426 3300035207 Ga0373942_0038211 Ga0373942_0038211_138_458 105
427 3300035241 Ga0373961_0157303 Ga0373961_0157303_40_360 105
428 3300035398 Ga0316574_0001643 Ga0316574_0001643_3947_4267 105
429 3300035398 Ga0316574_0217715 Ga0316574_0217715_567_893 105
430 3300035410 Ga0373924_0006164 Ga0373924_0006164_3524_3850 105
431 3300035410 Ga0373924_0237454 Ga0373924_0237454_108_428 105
432 3300035691 Ga0373931_0004918 Ga0373931_0004918_3522_3842 105
433 3300035691 Ga0373931_0049119 Ga0373931_0049119_1718_2038 105
434 3300035692 Ga0373935_0057637 Ga0373935_0057637_1551_1871 105
435 3300035695 Ga0373927_0050141 Ga0373927_0050141_574_894 105
436 3300035695 Ga0373927_0384791 Ga0373927_0384791_320_640 105
437 3300035724 Ga0373933_0183660 Ga0373933_0183660_957_1283 105
438 3300035724 Ga0373933_0194007 Ga0373933_0194007_415_735 105
439 3300035725 Ga0373947_0006238 Ga0373947_0006238_1274_1594 105
440 3300035725 Ga0373947_0177399 Ga0373947_0177399_657_977 105
441 3300035725 Ga0373947_0960300 Ga0373947_0960300_73_399 105
442 3300036401 Ga0373937_0311322 Ga0373937_0311322_906_1226 105
443 3300036401 Ga0373937_2139227 Ga0373937_2139227_85_411 105
444 3300036647 Ga0316582_0009543 Ga0316582_0009543_3963_4283 105
445 3300036712 Ga0316584_0001849 Ga0316584_0001849_8031_8351 105
446 3300037068 Ga0373925_0167807 Ga0373925_0167807_1305_1622 105
447 3300037068 Ga0373925_1292678 Ga0373925_1292678_153_479 105
448 3300037418 Ga0395900_0032155 Ga0395900_0032155_2053_2373 105
449 3300037466 Ga0395898_0639728 Ga0395898_0639728_122_442 105
450 3300037471 Ga0395905_0002506 Ga0395905_0002506_14711_15031 105
451 3300037471 Ga0395905_0319671 Ga0395905_0319671_685_1002 105
452 3300037588 Ga0316581_0000487 Ga0316581_0000487_10_330 105
453 3300037853 Ga0436364_0565626 Ga0436364_0565626_137_454 105
454 3300037853 Ga0436364_0927931 Ga0436364_0927931_613_930 105
455 3300037853 Ga0436364_0997073 Ga0436364_0997073_1140_1457 105
456 3300038443 Ga0395901_0151090 Ga0395901_0151090_412_732 105
457 3300038726 Ga0400490_42780 Ga0400490_42780_898_1218 105
458 3300038742 Ga0400486_04379 Ga0400486_04379_43_363 105
459 3300038742 Ga0400486_08264 Ga0400486_08264_1479_1799 105
460 3300039110 Ga0400487_10011 Ga0400487_10011_625_945 105
461 3300039437 Ga0436365_1570347 Ga0436365_1570347_143_460 105
462 3300039437 Ga0436365_1727234 Ga0436365_1727234_324_641 105
463 3300039438 Ga0436360_0846530 Ga0436360_0846530_213_533 105
464 3300039447 Ga0436361_0930690 Ga0436361_0930690_338_658 105
465 3300039450 Ga0436363_0889443 Ga0436363_0889443_449_766 105
466 3300039450 Ga0436363_1571548 Ga0436363_1571548_4541_4858 105
467 3300039453 Ga0436362_0675540 Ga0436362_0675540_580_900 105
468 3300041413 Ga0439465_0013112 Ga0439465_0013112_2208_2534 105
469 3300041446 Ga0451794_27367 Ga0451794_27367_59_376 105
470 3300041496 Ga0451839_0361652 Ga0451839_0361652_33_350 105
471 3300041997 Ga0439431_0250195 Ga0439431_0250195_154_480 105
472 3300042011 Ga0439454_048333 Ga0439454_048333_214_540 105
473 3300046452 Ga0495617_052691 Ga0495617_052691_331_657 105
474 3300046455 Ga0495603_0000280 Ga0495603_0000280_22411_22731 105
475 3300046459 Ga0495629_0000177 Ga0495629_0000177_31558_31878 105
476 3300046460 Ga0495638_0279683 Ga0495638_0279683_358_684 105
477 3300046461 Ga0495641_0029673 Ga0495641_0029673_2155_2475 105
478 3300046472 Ga0495580_0000498 Ga0495580_0000498_370_690 105
479 3300046473 Ga0495582_0000185 Ga0495582_0000185_14992_15312 105
480 3300046475 Ga0495639_0001788 Ga0495639_0001788_2389_2709 105
481 3300046477 Ga0495664_0072642 Ga0495664_0072642_1551_1877 105
482 3300046499 Ga0495594_0000224 Ga0495594_0000224_3462_3782 105
483 3300046511 Ga0495608_0626772 Ga0495608_0626772_244_570 105
484 3300046511 Ga0495608_0884773 Ga0495608_0884773_169_489 105
485 3300046514 Ga0495618_0239954 Ga0495618_0239954_238_564 105
486 3300046526 Ga0495666_0020979 Ga0495666_0020979_411_731 105
487 3300046529 Ga0495652_0198733 Ga0495652_0198733_1178_1504 105
488 3300046531 Ga0495665_0048045 Ga0495665_0048045_1450_1770 105
489 3300046557 Ga0495622_0000916 Ga0495622_0000916_5729_6049 105
490 3300046559 Ga0495667_0391434 Ga0495667_0391434_52_378 105
491 3300046616 Ga0495668_0167441 Ga0495668_0167441_827_1150 105
492 3300046642 Ga0495634_0003557 Ga0495634_0003557_9245_9565 105
493 3300046674 Ga0495588_0000617 Ga0495588_0000617_3484_3804 105
494 3300046674 Ga0495588_0238940 Ga0495588_0238940_587_904 105
495 3300046675 Ga0495657_0165545 Ga0495657_0165545_256_582 105
496 3300046681 Ga0495647_0001129 Ga0495647_0001129_7394_7714 105
497 3300046683 Ga0495658_0399130 Ga0495658_0399130_125_445 105
498 3300046689 Ga0495613_0037438 Ga0495613_0037438_449_769 105
499 3300046690 Ga0495624_0330223 Ga0495624_0330223_326_646 105
500 3300046694 Ga0495649_0119724 Ga0495649_0119724_442_768 105
501 3300047315 Ga0495581_0001367 Ga0495581_0001367_9252_9572 105
502 3300047317 Ga0495604_0815245 Ga0495604_0815245_148_474 105
503 3300047319 Ga0495674_0240554 Ga0495674_0240554_515_841 105
504 3300047321 Ga0495676_0437059 Ga0495676_0437059_98_418 105
505 3300047322 Ga0495680_0079783 Ga0495680_0079783_1609_1929 105
506 3300047469 Ga0495673_0087438 Ga0495673_0087438_578_904 105
507 3300047471 Ga0495684_0351441 Ga0495684_0351441_138_458 105
508 3300047673 Ga0495593_0001943 Ga0495593_0001943_6184_6504 105
509 3300048088 Ga0495602_0354855 Ga0495602_0354855_693_1019 105
510 3300048089 Ga0495614_0000618 Ga0495614_0000618_10130_10450 105
511 3300048091 Ga0495626_0174901 Ga0495626_0174901_213_539 105
512 3300048904 Ga0496101_0077258 Ga0496101_0077258_1896_2222 105
513 3300048904 Ga0496101_0117548 Ga0496101_0117548_1360_1680 105
514 3300048904 Ga0496101_0234802 Ga0496101_0234802_1006_1323 105
515 3300048904 Ga0496101_0397399 Ga0496101_0397399_697_1017 105
516 3300048904 Ga0496101_1531599 Ga0496101_1531599_130_450 105
517 3300048905 Ga0496102_0024862 Ga0496102_0024862_3898_4218 105
518 3300048905 Ga0496102_0033525 Ga0496102_0033525_2283_2600 105
519 3300048905 Ga0496102_0223736 Ga0496102_0223736_1191_1517 105
520 3300048905 Ga0496102_0519856 Ga0496102_0519856_386_712 105
521 3300048906 Ga0496103_0136822 Ga0496103_0136822_98_418 105
522 3300048907 Ga0496104_0017958 Ga0496104_0017958_5036_5353 105
523 3300048907 Ga0496104_0045259 Ga0496104_0045259_660_980 105
524 3300048907 Ga0496104_0052296 Ga0496104_0052296_1715_2035 105
525 3300048907 Ga0496104_0131885 Ga0496104_0131885_649_969 105
526 3300048907 Ga0496104_0142115 Ga0496104_0142115_1698_2018 105
527 3300048907 Ga0496104_0416930 Ga0496104_0416930_58_384 105
528 3300048907 Ga0496104_0499920 Ga0496104_0499920_42_368 105
529 3300048907 Ga0496104_0945468 Ga0496104_0945468_199_519 105
530 3300048908 Ga0496105_0006441 Ga0496105_0006441_2739_3056 105
531 3300048908 Ga0496105_0151616 Ga0496105_0151616_310_630 105
532 3300048908 Ga0496105_0499518 Ga0496105_0499518_215_535 105
533 3300048909 Ga0496106_0091723 Ga0496106_0091723_367_687 105
534 3300048909 Ga0496106_0094349 Ga0496106_0094349_1496_1822 105
535 3300048909 Ga0496106_0498618 Ga0496106_0498618_595_915 105
536 3300048910 Ga0496107_0003748 Ga0496107_0003748_857_1177 105
537 3300048910 Ga0496107_0024386 Ga0496107_0024386_1823_2143 105
538 3300048910 Ga0496107_0055486 Ga0496107_0055486_293_619 105
539 3300048910 Ga0496107_0075028 Ga0496107_0075028_337_657 105
540 3300048910 Ga0496107_0378806 Ga0496107_0378806_244_564 105
541 3300048911 Ga0496108_0001133 Ga0496108_0001133_5141_5458 105
542 3300048911 Ga0496108_0021902 Ga0496108_0021902_1148_1468 105
543 3300048911 Ga0496108_0180575 Ga0496108_0180575_1383_1703 105
544 3300048911 Ga0496108_0449363 Ga0496108_0449363_608_934 105
545 3300048911 Ga0496108_0844396 Ga0496108_0844396_211_531 105
546 3300048911 Ga0496108_0976407 Ga0496108_0976407_371_691 105
547 3300048912 Ga0496109_0000583 Ga0496109_0000583_7404_7721 105
548 3300048912 Ga0496109_0078261 Ga0496109_0078261_881_1201 105
549 3300048912 Ga0496109_0148378 Ga0496109_0148378_1506_1826 105
550 3300048912 Ga0496109_0162674 Ga0496109_0162674_1692_2012 105
551 3300048912 Ga0496109_0186745 Ga0496109_0186745_1587_1907 105
552 3300048912 Ga0496109_0283421 Ga0496109_0283421_1190_1510 105
553 3300048912 Ga0496109_1059183 Ga0496109_1059183_119_445 105
554 3300048913 Ga0496110_0014672 Ga0496110_0014672_4057_4377 105
555 3300048913 Ga0496110_0062981 Ga0496110_0062981_289_609 105
556 3300048913 Ga0496110_0162976 Ga0496110_0162976_650_967 105
557 3300048914 Ga0496111_0002980 Ga0496111_0002980_9270_9587 105
558 3300048914 Ga0496111_0010039 Ga0496111_0010039_4332_4652 105
559 3300048915 Ga0496112_0000884 Ga0496112_0000884_18778_19095 105
560 3300048915 Ga0496112_0005326 Ga0496112_0005326_2136_2456 105
561 3300048915 Ga0496112_0040118 Ga0496112_0040118_2309_2629 105
562 3300048915 Ga0496112_0105310 Ga0496112_0105310_977_1297 105
563 3300048915 Ga0496112_0119156 Ga0496112_0119156_1962_2282 105
564 3300048916 Ga0496113_0000351 Ga0496113_0000351_2333_2650 105
565 3300048916 Ga0496113_0016963 Ga0496113_0016963_2511_2831 105
566 3300048916 Ga0496113_0066735 Ga0496113_0066735_594_914 105
567 3300048916 Ga0496113_0116789 Ga0496113_0116789_1692_2012 105
568 3300048917 Ga0496114_0003614 Ga0496114_0003614_2136_2456 105
569 3300048917 Ga0496114_0033385 Ga0496114_0033385_163_480 105
570 3300048917 Ga0496114_0114919 Ga0496114_0114919_1733_2059 105
571 3300048918 Ga0496115_0004536 Ga0496115_0004536_2042_2359 105
572 3300048918 Ga0496115_0107641 Ga0496115_0107641_728_1048 105
573 3300048918 Ga0496115_0112724 Ga0496115_0112724_328_648 105
574 3300048927 Ga0496124_0095308 Ga0496124_0095308_183_509 105
575 3300049162 Ga0501307_017947 Ga0501307_017947_404_721 105
576 3300049569 Ga0501032_0262477 Ga0501032_0262477_370_687 105
577 3300049571 Ga0501034_0014987 Ga0501034_0014987_5028_5345 105
578 3300049571 Ga0501034_0584983 Ga0501034_0584983_73_390 105
579 3300049571 Ga0501034_0799191 Ga0501034_0799191_74_400 105
580 3300049572 Ga0501036_1539035 Ga0501036_1539035_137_463 105
581 3300049575 Ga0501039_0770615 Ga0501039_0770615_235_561 105
582 3300049576 Ga0501040_0550422 Ga0501040_0550422_21_347 105
583 3300049579 Ga0501043_0979874 Ga0501043_0979874_74_400 105
584 3300049580 Ga0501046_0139696 Ga0501046_0139696_409_726 105
585 3300049580 Ga0501046_0506808 Ga0501046_0506808_97_417 105
586 3300049581 Ga0501047_0023054 Ga0501047_0023054_1756_2073 105
587 3300049581 Ga0501047_0557336 Ga0501047_0557336_347_664 105
588 3300049582 Ga0501048_0058389 Ga0501048_0058389_939_1256 105
589 3300049582 Ga0501048_0401596 Ga0501048_0401596_189_515 105
590 3300049583 Ga0501067_0260490 Ga0501067_0260490_133_450 105
591 3300049584 Ga0501068_0012735 Ga0501068_0012735_534_851 105
592 3300049585 Ga0501069_0004928 Ga0501069_0004928_1516_1833 105
593 3300049586 Ga0501070_0017027 Ga0501070_0017027_5269_5586 105
594 3300049587 Ga0501071_0368191 Ga0501071_0368191_668_994 105
595 3300049587 Ga0501071_1047662 Ga0501071_1047662_165_482 105
596 3300049589 Ga0501073_0043526 Ga0501073_0043526_2713_3030 105
597 3300049590 Ga0501074_0110773 Ga0501074_0110773_1147_1464 105
598 3300049741 Ga0501079_0080947 Ga0501079_0080947_1252_1578 105
599 3300049742 Ga0501080_0009625 Ga0501080_0009625_6292_6609 105
600 3300049742 Ga0501080_0379929 Ga0501080_0379929_366_692 105
601 3300049743 Ga0501081_0786268 Ga0501081_0786268_133_459 105
602 3300049743 Ga0501081_1100213 Ga0501081_1100213_262_579 105
603 3300049743 Ga0501081_1509009 Ga0501081_1509009_101_427 105
604 3300049744 Ga0501083_0086253 Ga0501083_0086253_1518_1835 105
605 3300049822 Ga0501035_0091548 Ga0501035_0091548_71_388 105
606 3300049822 Ga0501035_0760537 Ga0501035_0760537_163_489 105
607 3300049823 Ga0501044_0888318 Ga0501044_0888318_428_745 105
608 3300050490 nmdc:mga03n38_300102_c1 nmdc:mga03n38_300102_c1_245_571 105
609 3300050492 nmdc:mga0yw44_1045237_c1 nmdc:mga0yw44_1045237_c1_17_340 105
610 3300050492 nmdc:mga0yw44_1239015_c1 nmdc:mga0yw44_1239015_c1_111_437 105
611 3300050492 nmdc:mga0yw44_698944_c1 nmdc:mga0yw44_698944_c1_31_357 105
612 3300050492 nmdc:mga0yw44_798739_c1 nmdc:mga0yw44_798739_c1_55_381 105
613 3300050507 nmdc:mga05p37_543913_c1 nmdc:mga05p37_543913_c1_715_1041 105
614 3300050507 nmdc:mga05p37_815531_c1 nmdc:mga05p37_815531_c1_319_639 105
615 3300050508 nmdc:mga09592_38412_c1 nmdc:mga09592_38412_c1_2739_3059 105
616 3300050509 nmdc:mga0qj67_119451_c1 nmdc:mga0qj67_119451_c1_856_1176 105
617 3300050510 nmdc:mga06r32_82733_c1 nmdc:mga06r32_82733_c1_226_546 105
618 3300050511 nmdc:mga08y16_1396023_c1 nmdc:mga08y16_1396023_c1_233_559 105
619 3300050511 nmdc:mga08y16_270689_c1 nmdc:mga08y16_270689_c1_695_1015 105
620 3300050512 nmdc:mga0n895_189011_c1 nmdc:mga0n895_189011_c1_190_510 105
621 3300050513 nmdc:mga0rr50_40885_c1 nmdc:mga0rr50_40885_c1_317_637 105
622 3300050513 nmdc:mga0rr50_88314_c1 nmdc:mga0rr50_88314_c1_1559_1879 105
623 3300050514 nmdc:mga08x19_187071_c1 nmdc:mga08x19_187071_c1_558_878 105
624 3300050514 nmdc:mga08x19_41905_c1 nmdc:mga08x19_41905_c1_2583_2903 105
625 3300050515 nmdc:mga0a205_179499_c1 nmdc:mga0a205_179499_c1_755_1075 105
626 3300050516 nmdc:mga0sz30_15776_c1 nmdc:mga0sz30_15776_c1_1849_2166 105
627 3300053077 Ga0495601_0030907 Ga0495601_0030907_969_1295 105
628 3300053078 Ga0495612_0058802 Ga0495612_0058802_606_932 105
629 3300053084 Ga0495595_0063731 Ga0495595_0063731_1123_1443 105
630 3300053084 Ga0495595_0686740 Ga0495595_0686740_166_492 105
631 3300053085 Ga0495619_0001164 Ga0495619_0001164_6847_7167 105
632 3300053085 Ga0495619_0296822 Ga0495619_0296822_636_962 105
633 3300053093 Ga0500651_0630558 Ga0500651_0630558_151_477 105
634 3300053104 Ga0500556_0000636 Ga0500556_0000636_21574_21897 105
635 3300053108 Ga0500562_036758 Ga0500562_036758_131_454 105
636 3300053153 Ga0500616_0003259 Ga0500616_0003259_8941_9264 105
637 3300053153 Ga0500616_0065923 Ga0500616_0065923_565_891 105
638 3300053730 Ga0500645_115075 Ga0500645_115075_188_511 105
639 3300054114 Ga0501084_0039158 Ga0501084_0039158_3576_3893 105
640 3300060353 Ga0501082_1358039 Ga0501082_1358039_187_513 105
641 3300061734 Ga0530510_0712691 Ga0530510_0712691_313_639 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

7

38

0.97

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

101

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9344 5 71
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.8955 5 103
5mmm-assembly1.cif.gz_V structure of the 70s chloroplast ribosome 0.883 5 105
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.8805 2 103
6eri-assembly1.cif.gz_AU structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.8796 5 105
ID Description Score Start End Superfamily
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9053 5 101 2.30.30.30
1nppD03 Mainly Beta;Roll;SH3 type barrels.; 0.9005 6 37 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.896 5 101 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8929 5 100 2.30.30.30
3kbgA03 Mainly Beta;Roll;SH3 type barrels.; 0.8752 6 38 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3D1TDX0-F1-model_v4 Large ribosomal subunit protein uL24 0.944 5 72 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7X3XRY9-F1-model_v4 Large ribosomal subunit protein uL24 0.9394 1 73 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0L0LNB9-F1-model_v4 Large ribosomal subunit protein uL24 0.9362 5 71 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F6G6P1-F1-model_v4 Large ribosomal subunit protein uL24 0.9356 4 76 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0L0LAE1-F1-model_v4 Large ribosomal subunit protein uL24 0.9345 4 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
89.96 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map