F471801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 641 | 395 | 634 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0451316|Ga0436365_0451316_77_382 |
| Length | 101 |
| Sequence | MAAKIRKGDKVIVLAGRDKGRTGEVIQIMPKENRALVRGVNIVKRHQRQTANQEAGIINKEASVHLSNVAIVDKDGKPTRVGFKVVDGKKVRVAKRSGEVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 2 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 3 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 4 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 146 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 147 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 219 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 233 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 234 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 241 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 272 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 275 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 276 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 286 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 287 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 386 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 393 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 394 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 395 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.88 |
| Metatranscriptomes | 2.03 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.5 |
| Nodule | 0.78 |
| Rhizoplane | 9.83 |
| Rhizosphere | 83.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10158064 | 3300001979 | Bacteria | 562 |
| 2 | JGI24737J22298_10002957 | 3300001990 | Bacteria | 6024 |
| 3 | JGI24735J21928_10114903 | 3300002067 | Bacteria | 775 |
| 4 | JGI24750J21931_1025865 | 3300002070 | Bacteria | 843 |
| 5 | JGI24748J21848_1061909 | 3300002074 | Bacteria | 501 |
| 6 | JGI24738J21930_10005208 | 3300002075 | Bacteria | 3137 |
| 7 | JGI24744J21845_10030691 | 3300002077 | Bacteria | 1030 |
| 8 | JGI24034J26672_10026547 | 3300002239 | Bacteria | 929 |
| 9 | JGI24742J22300_10034521 | 3300002244 | Bacteria | 891 |
| 10 | JGI24751J29686_10074257 | 3300002459 | Bacteria | 702 |
| 11 | JGI25405J52794_10135021 | 3300003911 | Bacteria | 560 |
| 12 | Ga0065712_10141376 | 3300005290 | Bacteria | 1447 |
| 13 | Ga0065707_10838764 | 3300005295 | Bacteria | 586 |
| 14 | Ga0070658_10012301 | 3300005327 | Bacteria | 6871 |
| 15 | Ga0070676_10014395 | 3300005328 | Bacteria | 4347 |
| 16 | Ga0070676_10357237 | 3300005328 | Bacteria | 1006 |
| 17 | Ga0070683_100014681 | 3300005329 | Bacteria | 6861 |
| 18 | Ga0070683_100565925 | 3300005329 | Bacteria | 1087 |
| 19 | Ga0070690_100012397 | 3300005330 | Bacteria | 5017 |
| 20 | Ga0070690_100137081 | 3300005330 | Bacteria | 1658 |
| 21 | Ga0070670_100000376 | 3300005331 | Bacteria | 37212 |
| 22 | Ga0070670_101001242 | 3300005331 | Bacteria | 760 |
| 23 | Ga0068869_100003825 | 3300005334 | Bacteria | 9286 |
| 24 | Ga0070666_10004644 | 3300005335 | Bacteria | 8386 |
| 25 | Ga0070680_100008294 | 3300005336 | Bacteria | 7948 |
| 26 | Ga0070680_100707378 | 3300005336 | Bacteria | 867 |
| 27 | Ga0070682_100041295 | 3300005337 | Bacteria | 2843 |
| 28 | Ga0068868_100010801 | 3300005338 | Bacteria | 6623 |
| 29 | Ga0068868_100844818 | 3300005338 | Bacteria | 829 |
| 30 | Ga0070660_100000686 | 3300005339 | Bacteria | 22383 |
| 31 | Ga0070660_101541607 | 3300005339 | Bacteria | 565 |
| 32 | Ga0070689_100000122 | 3300005340 | Bacteria | 44668 |
| 33 | Ga0070691_10000273 | 3300005341 | Bacteria | 18063 |
| 34 | Ga0070661_100000385 | 3300005344 | Bacteria | 34633 |
| 35 | Ga0070692_10003072 | 3300005345 | Bacteria | 6671 |
| 36 | Ga0070692_10701732 | 3300005345 | Bacteria | 681 |
| 37 | Ga0070669_100002082 | 3300005353 | Bacteria | 14453 |
| 38 | Ga0070675_100700921 | 3300005354 | Bacteria | 922 |
| 39 | Ga0070671_100001283 | 3300005355 | Bacteria | 18858 |
| 40 | Ga0070674_100000649 | 3300005356 | Bacteria | 17518 |
| 41 | Ga0070674_100005343 | 3300005356 | Bacteria | 7407 |
| 42 | Ga0070674_101674466 | 3300005356 | Bacteria | 575 |
| 43 | Ga0070673_100002163 | 3300005364 | Bacteria | 11899 |
| 44 | Ga0070688_100000217 | 3300005365 | Bacteria | 30556 |
| 45 | Ga0070659_100003485 | 3300005366 | Bacteria | 11201 |
| 46 | Ga0070667_100003614 | 3300005367 | Bacteria | 13156 |
| 47 | Ga0070703_10217434 | 3300005406 | Bacteria | 759 |
| 48 | Ga0070709_10001353 | 3300005434 | Bacteria | 13379 |
| 49 | Ga0070709_11337907 | 3300005434 | Bacteria | 578 |
| 50 | Ga0070714_100006925 | 3300005435 | Bacteria | 8788 |
| 51 | Ga0070714_100050142 | 3300005435 | Bacteria | 3555 |
| 52 | Ga0070714_101396830 | 3300005435 | Bacteria | 684 |
| 53 | Ga0070713_101269131 | 3300005436 | Bacteria | 713 |
| 54 | Ga0070710_10005298 | 3300005437 | Bacteria | 6115 |
| 55 | Ga0070710_10297179 | 3300005437 | Bacteria | 1053 |
| 56 | Ga0070701_10000897 | 3300005438 | Bacteria | 10740 |
| 57 | Ga0070711_100000834 | 3300005439 | Bacteria | 16154 |
| 58 | Ga0070711_100043033 | 3300005439 | Bacteria | 3056 |
| 59 | Ga0070711_101003908 | 3300005439 | Bacteria | 716 |
| 60 | Ga0070705_100001475 | 3300005440 | Bacteria | 12439 |
| 61 | Ga0070705_100054734 | 3300005440 | Bacteria | 2342 |
| 62 | Ga0070700_100001041 | 3300005441 | Bacteria | 13717 |
| 63 | Ga0070700_100133165 | 3300005441 | Bacteria | 1680 |
| 64 | Ga0070700_100271271 | 3300005441 | Bacteria | 1226 |
| 65 | Ga0070694_100000195 | 3300005444 | Bacteria | 32086 |
| 66 | Ga0070694_101306564 | 3300005444 | Bacteria | 610 |
| 67 | Ga0070663_100000352 | 3300005455 | Bacteria | 24139 |
| 68 | Ga0070663_100341785 | 3300005455 | Bacteria | 1209 |
| 69 | Ga0070678_100001146 | 3300005456 | Bacteria | 14002 |
| 70 | Ga0070678_100257457 | 3300005456 | Bacteria | 1466 |
| 71 | Ga0070662_100000412 | 3300005457 | Bacteria | 25384 |
| 72 | Ga0070662_100758779 | 3300005457 | Bacteria | 823 |
| 73 | Ga0070681_10423869 | 3300005458 | Bacteria | 1243 |
| 74 | Ga0068867_100042053 | 3300005459 | Bacteria | 3341 |
| 75 | Ga0068867_100292281 | 3300005459 | Bacteria | 1340 |
| 76 | Ga0070685_10155510 | 3300005466 | Bacteria | 1453 |
| 77 | Ga0070699_100101221 | 3300005518 | Bacteria | 2526 |
| 78 | Ga0070679_100103457 | 3300005530 | Bacteria | 2834 |
| 79 | Ga0070684_100149269 | 3300005535 | Bacteria | 2117 |
| 80 | Ga0070697_100000391 | 3300005536 | Bacteria | 34002 |
| 81 | Ga0068853_100001082 | 3300005539 | Bacteria | 19264 |
| 82 | Ga0068853_100908836 | 3300005539 | Bacteria | 846 |
| 83 | Ga0070672_100002807 | 3300005543 | Bacteria | 11158 |
| 84 | Ga0070672_100351224 | 3300005543 | Bacteria | 1257 |
| 85 | Ga0070686_100001391 | 3300005544 | Bacteria | 13661 |
| 86 | Ga0070686_101519100 | 3300005544 | Bacteria | 565 |
| 87 | Ga0070695_100000238 | 3300005545 | Bacteria | 27265 |
| 88 | Ga0070696_100000815 | 3300005546 | Bacteria | 20059 |
| 89 | Ga0070696_100311884 | 3300005546 | Bacteria | 1208 |
| 90 | Ga0070693_100000455 | 3300005547 | Bacteria | 18375 |
| 91 | Ga0070693_100290171 | 3300005547 | Bacteria | 1099 |
| 92 | Ga0070665_100008997 | 3300005548 | Bacteria | 10112 |
| 93 | Ga0070704_100000124 | 3300005549 | Bacteria | 27978 |
| 94 | Ga0070704_100675714 | 3300005549 | Bacteria | 914 |
| 95 | Ga0068855_100002691 | 3300005563 | Bacteria | 21916 |
| 96 | Ga0070664_100002450 | 3300005564 | Bacteria | 14942 |
| 97 | Ga0068857_100008457 | 3300005577 | Bacteria | 8896 |
| 98 | Ga0068857_100363422 | 3300005577 | Bacteria | 1342 |
| 99 | Ga0068857_101329909 | 3300005577 | Bacteria | 698 |
| 100 | Ga0068854_100004862 | 3300005578 | Bacteria | 8473 |
| 101 | Ga0068854_100207540 | 3300005578 | Bacteria | 1544 |
| 102 | Ga0068856_100005122 | 3300005614 | Bacteria | 12946 |
| 103 | Ga0068856_100194610 | 3300005614 | Bacteria | 2041 |
| 104 | Ga0068856_100937139 | 3300005614 | Bacteria | 885 |
| 105 | Ga0068856_101631752 | 3300005614 | Bacteria | 658 |
| 106 | Ga0070702_100000018 | 3300005615 | Bacteria | 47204 |
| 107 | Ga0070702_100289754 | 3300005615 | Bacteria | 1128 |
| 108 | Ga0070702_100451962 | 3300005615 | Bacteria | 932 |
| 109 | Ga0068852_100010938 | 3300005616 | Bacteria | 6801 |
| 110 | Ga0068852_101698313 | 3300005616 | Bacteria | 654 |
| 111 | Ga0068859_100030651 | 3300005617 | Bacteria | 5398 |
| 112 | Ga0068859_100076838 | 3300005617 | Bacteria | 3379 |
| 113 | Ga0068864_100002243 | 3300005618 | Bacteria | 15978 |
| 114 | Ga0068866_10001983 | 3300005718 | Bacteria | 8531 |
| 115 | Ga0068866_10629037 | 3300005718 | Bacteria | 728 |
| 116 | Ga0068861_100000942 | 3300005719 | Bacteria | 17675 |
| 117 | Ga0068861_100039077 | 3300005719 | Bacteria | 3540 |
| 118 | Ga0068861_101161056 | 3300005719 | Bacteria | 745 |
| 119 | Ga0068863_100007838 | 3300005841 | Bacteria | 10440 |
| 120 | Ga0068858_100016672 | 3300005842 | Bacteria | 6898 |
| 121 | Ga0068860_100000598 | 3300005843 | Bacteria | 43069 |
| 122 | Ga0068862_100002944 | 3300005844 | Bacteria | 14884 |
| 123 | Ga0068862_100988163 | 3300005844 | Bacteria | 832 |
| 124 | Ga0081455_10014358 | 3300005937 | Bacteria | 7770 |
| 125 | Ga0081455_10020755 | 3300005937 | Bacteria | 6176 |
| 126 | Ga0081540_1046399 | 3300005983 | Bacteria | 2194 |
| 127 | Ga0081540_1077636 | 3300005983 | Bacteria | 1509 |
| 128 | Ga0070717_10053359 | 3300006028 | Bacteria | 3332 |
| 129 | Ga0070717_10326478 | 3300006028 | Bacteria | 1368 |
| 130 | Ga0075365_10484677 | 3300006038 | Bacteria | 874 |
| 131 | Ga0075363_100265443 | 3300006048 | Bacteria | 991 |
| 132 | Ga0075432_10000910 | 3300006058 | Bacteria | 9311 |
| 133 | Ga0070715_10003461 | 3300006163 | Bacteria | 5024 |
| 134 | Ga0070715_10414604 | 3300006163 | Bacteria | 752 |
| 135 | Ga0070716_100001603 | 3300006173 | Bacteria | 10188 |
| 136 | Ga0070716_100170814 | 3300006173 | Bacteria | 1418 |
| 137 | Ga0070712_100006515 | 3300006175 | Bacteria | 7246 |
| 138 | Ga0070712_100130538 | 3300006175 | Bacteria | 1903 |
| 139 | Ga0070712_100175321 | 3300006175 | Bacteria | 1667 |
| 140 | Ga0075369_10023039 | 3300006186 | Bacteria | 2571 |
| 141 | Ga0075366_10640271 | 3300006195 | Bacteria | 659 |
| 142 | Ga0097621_100240950 | 3300006237 | Bacteria | 1581 |
| 143 | Ga0097621_102315546 | 3300006237 | Bacteria | 514 |
| 144 | Ga0075428_100133606 | 3300006844 | Bacteria | 2698 |
| 145 | Ga0075431_100003503 | 3300006847 | Bacteria | 15211 |
| 146 | Ga0075433_10023032 | 3300006852 | Bacteria | 5237 |
| 147 | Ga0075434_100069351 | 3300006871 | Bacteria | 3515 |
| 148 | Ga0075429_100041550 | 3300006880 | Bacteria | 4005 |
| 149 | Ga0068865_100005623 | 3300006881 | Bacteria | 7609 |
| 150 | Ga0068865_100110847 | 3300006881 | Bacteria | 2024 |
| 151 | Ga0068865_100592701 | 3300006881 | Bacteria | 936 |
| 152 | Ga0075436_100002180 | 3300006914 | Bacteria | 13503 |
| 153 | Ga0075436_100027159 | 3300006914 | Bacteria | 3940 |
| 154 | Ga0097620_100030651 | 3300006931 | Bacteria | 5398 |
| 155 | Ga0097620_100076839 | 3300006931 | Bacteria | 3379 |
| 156 | Ga0075435_100065482 | 3300007076 | Bacteria | 2954 |
| 157 | Ga0075435_100087765 | 3300007076 | Bacteria | 2563 |
| 158 | Ga0099795_10001948 | 3300007788 | Bacteria | 4692 |
| 159 | Ga0105251_10071832 | 3300009011 | Bacteria | 1610 |
| 160 | Ga0105251_10121149 | 3300009011 | Bacteria | 1188 |
| 161 | Ga0105244_10048677 | 3300009036 | Bacteria | 2169 |
| 162 | Ga0105250_10076922 | 3300009092 | Bacteria | 1351 |
| 163 | Ga0105240_10039464 | 3300009093 | Bacteria | 6047 |
| 164 | Ga0111539_10341243 | 3300009094 | Bacteria | 1744 |
| 165 | Ga0111539_11038987 | 3300009094 | Bacteria | 952 |
| 166 | Ga0105245_10000718 | 3300009098 | Bacteria | 29853 |
| 167 | Ga0105245_10796709 | 3300009098 | Bacteria | 983 |
| 168 | Ga0105245_13295271 | 3300009098 | Bacteria | 500 |
| 169 | Ga0105247_10001104 | 3300009101 | Bacteria | 20096 |
| 170 | Ga0105247_10418328 | 3300009101 | Bacteria | 959 |
| 171 | Ga0105247_10965182 | 3300009101 | Bacteria | 663 |
| 172 | Ga0114129_10051465 | 3300009147 | Bacteria | 5782 |
| 173 | Ga0105243_10001752 | 3300009148 | Bacteria | 18680 |
| 174 | Ga0105243_10183090 | 3300009148 | Bacteria | 1823 |
| 175 | Ga0105243_10593114 | 3300009148 | Bacteria | 1065 |
| 176 | Ga0105243_11128866 | 3300009148 | Bacteria | 794 |
| 177 | Ga0105243_11638009 | 3300009148 | Bacteria | 671 |
| 178 | Ga0105241_10003357 | 3300009174 | Bacteria | 11919 |
| 179 | Ga0105241_11794485 | 3300009174 | Bacteria | 598 |
| 180 | Ga0105242_10757195 | 3300009176 | Bacteria | 957 |
| 181 | Ga0105248_10002832 | 3300009177 | Bacteria | 19248 |
| 182 | Ga0105248_10049856 | 3300009177 | Bacteria | 4694 |
| 183 | Ga0105237_10001618 | 3300009545 | Bacteria | 29243 |
| 184 | Ga0105238_10007984 | 3300009551 | Bacteria | 10588 |
| 185 | Ga0105238_12781241 | 3300009551 | Bacteria | 526 |
| 186 | Ga0105249_10002122 | 3300009553 | Bacteria | 17209 |
| 187 | Ga0105249_10019915 | 3300009553 | Bacteria | 5991 |
| 188 | Ga0105249_10513588 | 3300009553 | Bacteria | 1245 |
| 189 | Ga0105249_12662686 | 3300009553 | Bacteria | 572 |
| 190 | Ga0105249_12989881 | 3300009553 | Bacteria | 543 |
| 191 | Ga0099796_10051000 | 3300010159 | Bacteria | 1436 |
| 192 | Ga0105239_10002536 | 3300010375 | Bacteria | 23214 |
| 193 | Ga0105239_10067735 | 3300010375 | Bacteria | 3922 |
| 194 | Ga0105246_10002439 | 3300011119 | Bacteria | 11222 |
| 195 | Ga0105246_10291090 | 3300011119 | Bacteria | 1314 |
| 196 | Ga0157373_10048800 | 3300013100 | Bacteria | 3018 |
| 197 | Ga0157371_10018898 | 3300013102 | Bacteria | 5090 |
| 198 | Ga0157370_11293650 | 3300013104 | Bacteria | 657 |
| 199 | Ga0157369_10001227 | 3300013105 | Bacteria | 31941 |
| 200 | Ga0157374_10028235 | 3300013296 | Bacteria | 5068 |
| 201 | Ga0157378_10000470 | 3300013297 | Bacteria | 38483 |
| 202 | Ga0157378_10813982 | 3300013297 | Bacteria | 960 |
| 203 | Ga0157378_11215857 | 3300013297 | Bacteria | 793 |
| 204 | Ga0163162_10136124 | 3300013306 | Bacteria | 2567 |
| 205 | Ga0163162_10765479 | 3300013306 | Bacteria | 1084 |
| 206 | Ga0163162_11247194 | 3300013306 | Bacteria | 844 |
| 207 | Ga0157372_10001215 | 3300013307 | Bacteria | 27865 |
| 208 | Ga0157372_12050085 | 3300013307 | Bacteria | 657 |
| 209 | Ga0157375_10001640 | 3300013308 | Bacteria | 19249 |
| 210 | Ga0157375_10007439 | 3300013308 | Bacteria | 9585 |
| 211 | Ga0157375_13130304 | 3300013308 | Bacteria | 552 |
| 212 | Ga0163163_10002310 | 3300014325 | Bacteria | 16099 |
| 213 | Ga0163163_10005311 | 3300014325 | Bacteria | 11124 |
| 214 | Ga0157380_10076160 | 3300014326 | Bacteria | 2729 |
| 215 | Ga0157380_10143061 | 3300014326 | Bacteria | 2057 |
| 216 | Ga0182008_10107640 | 3300014497 | Bacteria | 1380 |
| 217 | Ga0157377_10006965 | 3300014745 | Bacteria | 5428 |
| 218 | Ga0157379_10001927 | 3300014968 | Bacteria | 17169 |
| 219 | Ga0157376_10000606 | 3300014969 | Bacteria | 23175 |
| 220 | Ga0157376_10197722 | 3300014969 | Bacteria | 1848 |
| 221 | Ga0163161_10005439 | 3300017792 | Bacteria | 8844 |
| 222 | Ga0163161_10008942 | 3300017792 | Bacteria | 6925 |
| 223 | Ga0163161_11899609 | 3300017792 | Bacteria | 530 |
| 224 | Ga0206356_11650643 | 3300020070 | Bacteria | 1133 |
| 225 | Ga0213873_10035050 | 3300021358 | Bacteria | 1268 |
| 226 | Ga0213875_10123121 | 3300021388 | Bacteria | 1212 |
| 227 | Ga0213875_10173164 | 3300021388 | Bacteria | 1014 |
| 228 | Ga0213875_10258435 | 3300021388 | Bacteria | 822 |
| 229 | Ga0213871_10124014 | 3300021441 | Bacteria | 772 |
| 230 | Ga0224712_10068907 | 3300022467 | Bacteria | 1431 |
| 231 | Ga0224570_109993 | 3300022730 | Bacteria | 596 |
| 232 | Ga0224572_1054657 | 3300024225 | Bacteria | 742 |
| 233 | Ga0228598_1020778 | 3300024227 | Bacteria | 1293 |
| 234 | Ga0207656_10287146 | 3300025321 | Bacteria | 812 |
| 235 | Ga0207713_1196988 | 3300025735 | Bacteria | 620 |
| 236 | Ga0207653_10051268 | 3300025885 | Bacteria | 1374 |
| 237 | Ga0207692_10024037 | 3300025898 | Bacteria | 2827 |
| 238 | Ga0207692_10249418 | 3300025898 | Bacteria | 1063 |
| 239 | Ga0207692_10391785 | 3300025898 | Bacteria | 864 |
| 240 | Ga0207642_10002270 | 3300025899 | Bacteria | 5983 |
| 241 | Ga0207642_10122545 | 3300025899 | Bacteria | 1344 |
| 242 | Ga0207710_10003497 | 3300025900 | Bacteria | 6990 |
| 243 | Ga0207688_10002614 | 3300025901 | Bacteria | 9749 |
| 244 | Ga0207688_10654957 | 3300025901 | Bacteria | 663 |
| 245 | Ga0207688_11077438 | 3300025901 | Bacteria | 507 |
| 246 | Ga0207680_10114735 | 3300025903 | Bacteria | 1753 |
| 247 | Ga0207647_10001458 | 3300025904 | Bacteria | 18183 |
| 248 | Ga0207685_10000290 | 3300025905 | Bacteria | 7986 |
| 249 | Ga0207685_10034041 | 3300025905 | Bacteria | 1847 |
| 250 | Ga0207699_10002558 | 3300025906 | Bacteria | 8581 |
| 251 | Ga0207645_10043754 | 3300025907 | Bacteria | 2866 |
| 252 | Ga0207705_10154032 | 3300025909 | Bacteria | 1723 |
| 253 | Ga0207654_10003285 | 3300025911 | Bacteria | 8172 |
| 254 | Ga0207695_10425048 | 3300025913 | Bacteria | 1213 |
| 255 | Ga0207671_10077044 | 3300025914 | Bacteria | 2496 |
| 256 | Ga0207693_10000493 | 3300025915 | Bacteria | 35669 |
| 257 | Ga0207693_10113345 | 3300025915 | Bacteria | 2127 |
| 258 | Ga0207693_10125438 | 3300025915 | Bacteria | 2018 |
| 259 | Ga0207663_10001067 | 3300025916 | Bacteria | 12565 |
| 260 | Ga0207663_10804423 | 3300025916 | Bacteria | 749 |
| 261 | Ga0207660_10034333 | 3300025917 | Bacteria | 3515 |
| 262 | Ga0207660_10365717 | 3300025917 | Bacteria | 1158 |
| 263 | Ga0207662_10045568 | 3300025918 | Bacteria | 2592 |
| 264 | Ga0207657_10000282 | 3300025919 | Bacteria | 54101 |
| 265 | Ga0207657_10738995 | 3300025919 | Bacteria | 763 |
| 266 | Ga0207649_10001010 | 3300025920 | Bacteria | 17375 |
| 267 | Ga0207649_10907252 | 3300025920 | Bacteria | 691 |
| 268 | Ga0207652_10141055 | 3300025921 | Bacteria | 2155 |
| 269 | Ga0207681_10033396 | 3300025923 | Bacteria | 3373 |
| 270 | Ga0207694_10019951 | 3300025924 | Bacteria | 5071 |
| 271 | Ga0207659_10005250 | 3300025926 | Bacteria | 7843 |
| 272 | Ga0207659_10162871 | 3300025926 | Bacteria | 1753 |
| 273 | Ga0207700_10712302 | 3300025928 | Bacteria | 896 |
| 274 | Ga0207700_11099447 | 3300025928 | Bacteria | 711 |
| 275 | Ga0207664_10012756 | 3300025929 | Bacteria | 6015 |
| 276 | Ga0207664_10133566 | 3300025929 | Bacteria | 2092 |
| 277 | Ga0207664_10354751 | 3300025929 | Bacteria | 1298 |
| 278 | Ga0207664_11294975 | 3300025929 | Bacteria | 648 |
| 279 | Ga0207644_10017754 | 3300025931 | Bacteria | 4810 |
| 280 | Ga0207706_10000270 | 3300025933 | Bacteria | 56584 |
| 281 | Ga0207706_10732870 | 3300025933 | Bacteria | 843 |
| 282 | Ga0207686_10075628 | 3300025934 | Bacteria | 2181 |
| 283 | Ga0207709_10032580 | 3300025935 | Bacteria | 3053 |
| 284 | Ga0207709_10133493 | 3300025935 | Bacteria | 1695 |
| 285 | Ga0207709_10588937 | 3300025935 | Bacteria | 879 |
| 286 | Ga0207670_10025739 | 3300025936 | Bacteria | 3698 |
| 287 | Ga0207669_10075263 | 3300025937 | Bacteria | 2138 |
| 288 | Ga0207669_10811320 | 3300025937 | Bacteria | 777 |
| 289 | Ga0207704_10018065 | 3300025938 | Bacteria | 3672 |
| 290 | Ga0207704_10680210 | 3300025938 | Bacteria | 850 |
| 291 | Ga0207665_10001538 | 3300025939 | Bacteria | 15513 |
| 292 | Ga0207665_10007579 | 3300025939 | Bacteria | 7172 |
| 293 | Ga0207691_10010501 | 3300025940 | Bacteria | 8885 |
| 294 | Ga0207691_10497050 | 3300025940 | Bacteria | 1036 |
| 295 | Ga0207711_10013882 | 3300025941 | Bacteria | 6690 |
| 296 | Ga0207711_10747109 | 3300025941 | Bacteria | 912 |
| 297 | Ga0207689_10006518 | 3300025942 | Bacteria | 10303 |
| 298 | Ga0207661_10022097 | 3300025944 | Bacteria | 4783 |
| 299 | Ga0207661_11139378 | 3300025944 | Bacteria | 718 |
| 300 | Ga0207667_10011595 | 3300025949 | Bacteria | 10234 |
| 301 | Ga0207651_10006413 | 3300025960 | Bacteria | 6156 |
| 302 | Ga0207712_10042972 | 3300025961 | Bacteria | 3115 |
| 303 | Ga0207712_11861607 | 3300025961 | Bacteria | 539 |
| 304 | Ga0207668_10001057 | 3300025972 | Bacteria | 16415 |
| 305 | Ga0207668_10114869 | 3300025972 | Bacteria | 2027 |
| 306 | Ga0207640_10507893 | 3300025981 | Bacteria | 1005 |
| 307 | Ga0207658_10007478 | 3300025986 | Bacteria | 7442 |
| 308 | Ga0207677_10046226 | 3300026023 | Bacteria | 2913 |
| 309 | Ga0207677_11450404 | 3300026023 | Bacteria | 633 |
| 310 | Ga0207703_10010584 | 3300026035 | Bacteria | 7208 |
| 311 | Ga0207639_11436428 | 3300026041 | Bacteria | 647 |
| 312 | Ga0207678_10000477 | 3300026067 | Bacteria | 36336 |
| 313 | Ga0207708_10000337 | 3300026075 | Bacteria | 36962 |
| 314 | Ga0207708_10016146 | 3300026075 | Bacteria | 5609 |
| 315 | Ga0207708_10081269 | 3300026075 | Bacteria | 2491 |
| 316 | Ga0207702_10102306 | 3300026078 | Bacteria | 2531 |
| 317 | Ga0207702_10196753 | 3300026078 | Bacteria | 1866 |
| 318 | Ga0207702_10630702 | 3300026078 | Bacteria | 1053 |
| 319 | Ga0207702_12429892 | 3300026078 | Bacteria | 511 |
| 320 | Ga0207641_10017486 | 3300026088 | Bacteria | 5870 |
| 321 | Ga0207648_10055524 | 3300026089 | Bacteria | 3457 |
| 322 | Ga0207648_11188403 | 3300026089 | Bacteria | 716 |
| 323 | Ga0207676_10028077 | 3300026095 | Bacteria | 4199 |
| 324 | Ga0207676_10059434 | 3300026095 | Bacteria | 3019 |
| 325 | Ga0207674_10002865 | 3300026116 | Bacteria | 21427 |
| 326 | Ga0207674_10644903 | 3300026116 | Bacteria | 1023 |
| 327 | Ga0207675_100002251 | 3300026118 | Bacteria | 19192 |
| 328 | Ga0207675_100022526 | 3300026118 | Bacteria | 5865 |
| 329 | Ga0207675_101300612 | 3300026118 | Bacteria | 747 |
| 330 | Ga0207675_101718610 | 3300026118 | Bacteria | 647 |
| 331 | Ga0207683_10000681 | 3300026121 | Bacteria | 31192 |
| 332 | Ga0207683_11828352 | 3300026121 | Bacteria | 556 |
| 333 | Ga0207698_11464924 | 3300026142 | Bacteria | 698 |
| 334 | Ga0207428_10008303 | 3300027907 | Bacteria | 9386 |
| 335 | Ga0207428_10860386 | 3300027907 | Bacteria | 642 |
| 336 | Ga0265357_1001191 | 3300028023 | Bacteria | 1834 |
| 337 | Ga0268266_10746671 | 3300028379 | Bacteria | 944 |
| 338 | Ga0268265_10182679 | 3300028380 | Bacteria | 1803 |
| 339 | Ga0268265_10820856 | 3300028380 | Bacteria | 908 |
| 340 | Ga0268264_10020640 | 3300028381 | Bacteria | 5382 |
| 341 | Ga0268264_10638707 | 3300028381 | Bacteria | 1052 |
| 342 | Ga0265338_10660267 | 3300028800 | Bacteria | 724 |
| 343 | Ga0265762_1017824 | 3300030760 | Bacteria | 1294 |
| 344 | Ga0265760_10028793 | 3300031090 | Bacteria | 1631 |
| 345 | Ga0265760_10091826 | 3300031090 | Bacteria | 951 |
| 346 | Ga0265331_10041152 | 3300031250 | Bacteria | 2246 |
| 347 | Ga0265316_10132279 | 3300031344 | Bacteria | 1878 |
| 348 | Ga0265316_11101272 | 3300031344 | Bacteria | 551 |
| 349 | Ga0307408_100430244 | 3300031548 | Bacteria | 1140 |
| 350 | Ga0307408_100769660 | 3300031548 | Bacteria | 871 |
| 351 | Ga0316575_10000986 | 3300031665 | Bacteria | 8786 |
| 352 | Ga0316579_10016915 | 3300031691 | Bacteria | 3193 |
| 353 | Ga0265342_10180624 | 3300031712 | Bacteria | 1156 |
| 354 | Ga0316576_10005834 | 3300031727 | Bacteria | 7592 |
| 355 | Ga0307405_10252139 | 3300031731 | Bacteria | 1314 |
| 356 | Ga0307405_10324581 | 3300031731 | Bacteria | 1177 |
| 357 | Ga0316577_10009939 | 3300031733 | Bacteria | 5131 |
| 358 | Ga0307413_10068491 | 3300031824 | Bacteria | 2223 |
| 359 | Ga0307413_10779066 | 3300031824 | Bacteria | 802 |
| 360 | Ga0307413_10792958 | 3300031824 | Bacteria | 795 |
| 361 | Ga0307406_10395799 | 3300031901 | Bacteria | 1093 |
| 362 | Ga0307406_10845824 | 3300031901 | Bacteria | 775 |
| 363 | Ga0307412_10030283 | 3300031911 | Bacteria | 3406 |
| 364 | Ga0307409_100224075 | 3300031995 | Bacteria | 1700 |
| 365 | Ga0307416_100111845 | 3300032002 | Bacteria | 2409 |
| 366 | Ga0307416_101274431 | 3300032002 | Bacteria | 841 |
| 367 | Ga0307411_10316917 | 3300032005 | Bacteria | 1258 |
| 368 | Ga0307411_10390912 | 3300032005 | Bacteria | 1147 |
| 369 | Ga0307411_10430887 | 3300032005 | Bacteria | 1098 |
| 370 | Ga0307415_100454199 | 3300032126 | Bacteria | 1108 |
| 371 | Ga0307415_100796194 | 3300032126 | Bacteria | 862 |
| 372 | Ga0316583_10054181 | 3300032133 | Bacteria | 1410 |
| 373 | Ga0316585_10002061 | 3300032137 | Bacteria | 5391 |
| 374 | Ga0316580_10015499 | 3300032139 | Bacteria | 2332 |
| 375 | Ga0316593_10000349 | 3300032168 | Bacteria | 8071 |
| 376 | Ga0316592_1003508 | 3300033524 | Bacteria | 2833 |
| 377 | Ga0316586_1009630 | 3300033527 | Bacteria | 1450 |
| 378 | Ga0316588_1003356 | 3300033528 | Bacteria | 2911 |
| 379 | Ga0316596_1000615 | 3300033541 | Bacteria | 6324 |
| 380 | Ga0316596_1093529 | 3300033541 | Bacteria | 811 |
| 381 | Ga0373930_0121500 | 3300034816 | Bacteria | 636 |
| 382 | Ga0373926_0013170 | 3300035083 | Bacteria | 2802 |
| 383 | Ga0373928_0167210 | 3300035084 | Bacteria | 618 |
| 384 | Ga0373929_0030267 | 3300035085 | Bacteria | 1153 |
| 385 | Ga0373929_0048974 | 3300035085 | Bacteria | 961 |
| 386 | Ga0373940_0062626 | 3300035088 | Bacteria | 1067 |
| 387 | Ga0373944_0199632 | 3300035089 | Bacteria | 724 |
| 388 | Ga0373951_0008546 | 3300035091 | Bacteria | 2309 |
| 389 | Ga0373923_0125153 | 3300035111 | Bacteria | 1151 |
| 390 | Ga0373936_0315257 | 3300035113 | Bacteria | 708 |
| 391 | Ga0373939_0011947 | 3300035114 | Bacteria | 2204 |
| 392 | Ga0373941_0330837 | 3300035115 | Bacteria | 615 |
| 393 | Ga0373945_0084273 | 3300035116 | Bacteria | 1222 |
| 394 | Ga0373953_0468572 | 3300035117 | Bacteria | 557 |
| 395 | Ga0373957_0202794 | 3300035120 | Bacteria | 827 |
| 396 | Ga0373943_0006870 | 3300035170 | Bacteria | 5105 |
| 397 | Ga0373943_0538662 | 3300035170 | Bacteria | 684 |
| 398 | Ga0373946_0474182 | 3300035171 | Bacteria | 639 |
| 399 | Ga0373942_0038211 | 3300035207 | Bacteria | 1301 |
| 400 | Ga0373961_0157303 | 3300035241 | Bacteria | 778 |
| 401 | Ga0316574_0001643 | 3300035398 | Bacteria | 10749 |
| 402 | Ga0316574_0217715 | 3300035398 | Bacteria | 1224 |
| 403 | Ga0316574_0924778 | 3300035398 | Bacteria | 527 |
| 404 | Ga0373924_0006164 | 3300035410 | Bacteria | 4285 |
| 405 | Ga0373924_0237454 | 3300035410 | Bacteria | 806 |
| 406 | Ga0373931_0004918 | 3300035691 | Bacteria | 6144 |
| 407 | Ga0373931_0049119 | 3300035691 | Bacteria | 2239 |
| 408 | Ga0373935_0057637 | 3300035692 | Bacteria | 2478 |
| 409 | Ga0373927_0050141 | 3300035695 | Bacteria | 2698 |
| 410 | Ga0373927_0384791 | 3300035695 | Bacteria | 925 |
| 411 | Ga0373933_0183660 | 3300035724 | Bacteria | 1334 |
| 412 | Ga0373933_0194007 | 3300035724 | Bacteria | 1298 |
| 413 | Ga0373947_0006238 | 3300035725 | Bacteria | 6931 |
| 414 | Ga0373947_0177399 | 3300035725 | Bacteria | 1385 |
| 415 | Ga0373947_0960300 | 3300035725 | Bacteria | 583 |
| 416 | Ga0373937_0311322 | 3300036401 | Bacteria | 1489 |
| 417 | Ga0373937_2139227 | 3300036401 | Bacteria | 505 |
| 418 | Ga0316582_0009543 | 3300036647 | Bacteria | 5271 |
| 419 | Ga0316584_0001849 | 3300036712 | Bacteria | 13108 |
| 420 | Ga0373925_0167807 | 3300037068 | Bacteria | 1732 |
| 421 | Ga0373925_1292678 | 3300037068 | Bacteria | 599 |
| 422 | Ga0395900_0032155 | 3300037418 | Bacteria | 5394 |
| 423 | Ga0395898_0639728 | 3300037466 | Bacteria | 1006 |
| 424 | Ga0395905_0002506 | 3300037471 | Bacteria | 20297 |
| 425 | Ga0395905_0319671 | 3300037471 | Bacteria | 1442 |
| 426 | Ga0316581_0000487 | 3300037588 | Bacteria | 7649 |
| 427 | Ga0436364_0565626 | 3300037853 | Bacteria | 555 |
| 428 | Ga0436364_0927931 | 3300037853 | Bacteria | 1329 |
| 429 | Ga0436364_0997073 | 3300037853 | Bacteria | 2123 |
| 430 | Ga0395901_0151090 | 3300038443 | Bacteria | 2440 |
| 431 | Ga0400490_42780 | 3300038726 | Bacteria | 1517 |
| 432 | Ga0400486_04379 | 3300038742 | Bacteria | 2620 |
| 433 | Ga0400486_08264 | 3300038742 | Bacteria | 1833 |
| 434 | Ga0400487_10011 | 3300039110 | Bacteria | 1112 |
| 435 | Ga0436365_0451316 | 3300039437 | Bacteria | 564 |
| 436 | Ga0436365_1570347 | 3300039437 | Bacteria | 1106 |
| 437 | Ga0436365_1727234 | 3300039437 | Bacteria | 663 |
| 438 | Ga0436360_0846530 | 3300039438 | Bacteria | 557 |
| 439 | Ga0436361_0930690 | 3300039447 | Bacteria | 2179 |
| 440 | Ga0436363_0889443 | 3300039450 | Bacteria | 1025 |
| 441 | Ga0436363_1571548 | 3300039450 | Bacteria | 7951 |
| 442 | Ga0436362_0675540 | 3300039453 | Bacteria | 2436 |
| 443 | Ga0439465_0013112 | 3300041413 | Bacteria | 2588 |
| 444 | Ga0451794_27367 | 3300041446 | Bacteria | 547 |
| 445 | Ga0451839_0361652 | 3300041496 | Bacteria | 628 |
| 446 | Ga0439431_0095110 | 3300041997 | Bacteria | 815 |
| 447 | Ga0439431_0250195 | 3300041997 | Bacteria | 526 |
| 448 | Ga0439454_048333 | 3300042011 | Bacteria | 713 |
| 449 | Ga0439457_186150 | 3300042014 | Bacteria | 508 |
| 450 | Ga0495617_052691 | 3300046452 | Bacteria | 1352 |
| 451 | Ga0495603_0000280 | 3300046455 | Bacteria | 27139 |
| 452 | Ga0495629_0000177 | 3300046459 | Bacteria | 56906 |
| 453 | Ga0495638_0279683 | 3300046460 | Bacteria | 907 |
| 454 | Ga0495641_0029673 | 3300046461 | Bacteria | 2633 |
| 455 | Ga0495580_0000498 | 3300046472 | Bacteria | 32908 |
| 456 | Ga0495582_0000185 | 3300046473 | Bacteria | 34065 |
| 457 | Ga0495639_0001788 | 3300046475 | Bacteria | 9521 |
| 458 | Ga0495664_0072642 | 3300046477 | Bacteria | 2056 |
| 459 | Ga0495594_0000224 | 3300046499 | Bacteria | 27588 |
| 460 | Ga0495608_0626772 | 3300046511 | Bacteria | 644 |
| 461 | Ga0495608_0884773 | 3300046511 | Bacteria | 523 |
| 462 | Ga0495618_0239954 | 3300046514 | Bacteria | 1140 |
| 463 | Ga0495666_0020979 | 3300046526 | Bacteria | 3235 |
| 464 | Ga0495652_0198733 | 3300046529 | Bacteria | 1523 |
| 465 | Ga0495665_0048045 | 3300046531 | Bacteria | 2263 |
| 466 | Ga0495622_0000916 | 3300046557 | Bacteria | 15986 |
| 467 | Ga0495667_0391434 | 3300046559 | Bacteria | 876 |
| 468 | Ga0495668_0167441 | 3300046616 | Bacteria | 1204 |
| 469 | Ga0495634_0003557 | 3300046642 | Bacteria | 12469 |
| 470 | Ga0495588_0000617 | 3300046674 | Bacteria | 16755 |
| 471 | Ga0495588_0238940 | 3300046674 | Bacteria | 958 |
| 472 | Ga0495657_0165545 | 3300046675 | Bacteria | 1365 |
| 473 | Ga0495647_0001129 | 3300046681 | Bacteria | 8180 |
| 474 | Ga0495658_0399130 | 3300046683 | Bacteria | 876 |
| 475 | Ga0495613_0037438 | 3300046689 | Bacteria | 3596 |
| 476 | Ga0495624_0330223 | 3300046690 | Bacteria | 918 |
| 477 | Ga0495649_0119724 | 3300046694 | Bacteria | 1393 |
| 478 | Ga0495581_0001367 | 3300047315 | Bacteria | 13506 |
| 479 | Ga0495604_0815245 | 3300047317 | Bacteria | 587 |
| 480 | Ga0495674_0240554 | 3300047319 | Bacteria | 1492 |
| 481 | Ga0495676_0437059 | 3300047321 | Bacteria | 864 |
| 482 | Ga0495680_0079783 | 3300047322 | Bacteria | 2474 |
| 483 | Ga0495673_0087438 | 3300047469 | Bacteria | 1279 |
| 484 | Ga0495684_0351441 | 3300047471 | Bacteria | 1046 |
| 485 | Ga0495593_0001943 | 3300047673 | Bacteria | 12328 |
| 486 | Ga0495602_0354855 | 3300048088 | Bacteria | 1057 |
| 487 | Ga0495614_0000618 | 3300048089 | Bacteria | 14895 |
| 488 | Ga0495626_0174901 | 3300048091 | Bacteria | 893 |
| 489 | Ga0496101_0077258 | 3300048904 | Bacteria | 2454 |
| 490 | Ga0496101_0117548 | 3300048904 | Bacteria | 2007 |
| 491 | Ga0496101_0234802 | 3300048904 | Bacteria | 1426 |
| 492 | Ga0496101_0397399 | 3300048904 | Bacteria | 1085 |
| 493 | Ga0496101_1531599 | 3300048904 | Bacteria | 519 |
| 494 | Ga0496102_0024862 | 3300048905 | Bacteria | 5327 |
| 495 | Ga0496102_0033525 | 3300048905 | Bacteria | 4616 |
| 496 | Ga0496102_0223736 | 3300048905 | Bacteria | 1774 |
| 497 | Ga0496102_0519856 | 3300048905 | Bacteria | 1113 |
| 498 | Ga0496103_0136822 | 3300048906 | Bacteria | 1565 |
| 499 | Ga0496104_0017958 | 3300048907 | Bacteria | 6448 |
| 500 | Ga0496104_0045259 | 3300048907 | Bacteria | 4138 |
| 501 | Ga0496104_0052296 | 3300048907 | Bacteria | 3857 |
| 502 | Ga0496104_0131885 | 3300048907 | Bacteria | 2400 |
| 503 | Ga0496104_0142115 | 3300048907 | Bacteria | 2306 |
| 504 | Ga0496104_0416930 | 3300048907 | Bacteria | 1255 |
| 505 | Ga0496104_0499920 | 3300048907 | Bacteria | 1127 |
| 506 | Ga0496104_0945468 | 3300048907 | Bacteria | 766 |
| 507 | Ga0496105_0006441 | 3300048908 | Bacteria | 9025 |
| 508 | Ga0496105_0151616 | 3300048908 | Bacteria | 1905 |
| 509 | Ga0496105_0499518 | 3300048908 | Bacteria | 955 |
| 510 | Ga0496106_0091723 | 3300048909 | Bacteria | 2346 |
| 511 | Ga0496106_0094349 | 3300048909 | Bacteria | 2313 |
| 512 | Ga0496106_0498618 | 3300048909 | Bacteria | 978 |
| 513 | Ga0496107_0003748 | 3300048910 | Bacteria | 10211 |
| 514 | Ga0496107_0024386 | 3300048910 | Bacteria | 4278 |
| 515 | Ga0496107_0055486 | 3300048910 | Bacteria | 2862 |
| 516 | Ga0496107_0075028 | 3300048910 | Bacteria | 2461 |
| 517 | Ga0496107_0378806 | 3300048910 | Bacteria | 1052 |
| 518 | Ga0496108_0001133 | 3300048911 | Bacteria | 20819 |
| 519 | Ga0496108_0021902 | 3300048911 | Bacteria | 5253 |
| 520 | Ga0496108_0180575 | 3300048911 | Bacteria | 1827 |
| 521 | Ga0496108_0449363 | 3300048911 | Bacteria | 1126 |
| 522 | Ga0496108_0844396 | 3300048911 | Bacteria | 788 |
| 523 | Ga0496108_0976407 | 3300048911 | Bacteria | 724 |
| 524 | Ga0496109_0000583 | 3300048912 | Bacteria | 30510 |
| 525 | Ga0496109_0078261 | 3300048912 | Bacteria | 3044 |
| 526 | Ga0496109_0148378 | 3300048912 | Bacteria | 2195 |
| 527 | Ga0496109_0162674 | 3300048912 | Bacteria | 2091 |
| 528 | Ga0496109_0186745 | 3300048912 | Bacteria | 1947 |
| 529 | Ga0496109_0283421 | 3300048912 | Bacteria | 1562 |
| 530 | Ga0496109_1059183 | 3300048912 | Bacteria | 748 |
| 531 | Ga0496110_0014672 | 3300048913 | Bacteria | 6512 |
| 532 | Ga0496110_0062981 | 3300048913 | Bacteria | 3277 |
| 533 | Ga0496110_0162976 | 3300048913 | Bacteria | 2021 |
| 534 | Ga0496111_0002980 | 3300048914 | Bacteria | 10376 |
| 535 | Ga0496111_0010039 | 3300048914 | Bacteria | 6336 |
| 536 | Ga0496112_0000884 | 3300048915 | Bacteria | 21517 |
| 537 | Ga0496112_0005326 | 3300048915 | Bacteria | 11105 |
| 538 | Ga0496112_0040118 | 3300048915 | Bacteria | 4577 |
| 539 | Ga0496112_0105310 | 3300048915 | Bacteria | 2790 |
| 540 | Ga0496112_0119156 | 3300048915 | Bacteria | 2609 |
| 541 | Ga0496113_0000351 | 3300048916 | Bacteria | 22021 |
| 542 | Ga0496113_0016963 | 3300048916 | Bacteria | 5042 |
| 543 | Ga0496113_0066735 | 3300048916 | Bacteria | 2726 |
| 544 | Ga0496113_0116789 | 3300048916 | Bacteria | 2082 |
| 545 | Ga0496114_0003614 | 3300048917 | Bacteria | 11884 |
| 546 | Ga0496114_0033385 | 3300048917 | Bacteria | 4240 |
| 547 | Ga0496114_0114919 | 3300048917 | Bacteria | 2309 |
| 548 | Ga0496115_0004536 | 3300048918 | Bacteria | 10046 |
| 549 | Ga0496115_0107641 | 3300048918 | Bacteria | 2289 |
| 550 | Ga0496115_0112724 | 3300048918 | Bacteria | 2234 |
| 551 | Ga0496124_0095308 | 3300048927 | Bacteria | 2419 |
| 552 | Ga0501307_017947 | 3300049162 | Bacteria | 895 |
| 553 | Ga0501031_0142725 | 3300049568 | Bacteria | 1565 |
| 554 | Ga0501032_0106312 | 3300049569 | Bacteria | 1859 |
| 555 | Ga0501032_0262477 | 3300049569 | Bacteria | 1120 |
| 556 | Ga0501033_0082000 | 3300049570 | Bacteria | 2365 |
| 557 | Ga0501034_0014685 | 3300049571 | Bacteria | 8064 |
| 558 | Ga0501034_0014987 | 3300049571 | Bacteria | 7973 |
| 559 | Ga0501034_0172892 | 3300049571 | Bacteria | 2126 |
| 560 | Ga0501034_0584983 | 3300049571 | Bacteria | 1023 |
| 561 | Ga0501034_0799191 | 3300049571 | Bacteria | 836 |
| 562 | Ga0501036_0916616 | 3300049572 | Bacteria | 719 |
| 563 | Ga0501036_1539035 | 3300049572 | Bacteria | 538 |
| 564 | Ga0501038_0672149 | 3300049574 | Bacteria | 778 |
| 565 | Ga0501039_0600033 | 3300049575 | Bacteria | 863 |
| 566 | Ga0501039_0770615 | 3300049575 | Bacteria | 751 |
| 567 | Ga0501040_0378075 | 3300049576 | Bacteria | 1016 |
| 568 | Ga0501040_0550422 | 3300049576 | Bacteria | 833 |
| 569 | Ga0501043_0979874 | 3300049579 | Bacteria | 603 |
| 570 | Ga0501046_0139696 | 3300049580 | Bacteria | 1834 |
| 571 | Ga0501046_0506808 | 3300049580 | Bacteria | 864 |
| 572 | Ga0501047_0023054 | 3300049581 | Bacteria | 5976 |
| 573 | Ga0501047_0557336 | 3300049581 | Bacteria | 970 |
| 574 | Ga0501047_0639715 | 3300049581 | Bacteria | 883 |
| 575 | Ga0501048_0058389 | 3300049582 | Bacteria | 2735 |
| 576 | Ga0501048_0401596 | 3300049582 | Bacteria | 980 |
| 577 | Ga0501067_0260490 | 3300049583 | Bacteria | 965 |
| 578 | Ga0501068_0012735 | 3300049584 | Bacteria | 4774 |
| 579 | Ga0501068_0377864 | 3300049584 | Bacteria | 912 |
| 580 | Ga0501069_0004928 | 3300049585 | Bacteria | 6923 |
| 581 | Ga0501070_0017027 | 3300049586 | Bacteria | 6099 |
| 582 | Ga0501071_0368191 | 3300049587 | Bacteria | 1095 |
| 583 | Ga0501071_1047662 | 3300049587 | Bacteria | 630 |
| 584 | Ga0501073_0043526 | 3300049589 | Bacteria | 3166 |
| 585 | Ga0501074_0110773 | 3300049590 | Bacteria | 1964 |
| 586 | Ga0501076_1710880 | 3300049592 | Bacteria | 516 |
| 587 | Ga0501079_0080947 | 3300049741 | Bacteria | 2511 |
| 588 | Ga0501080_0009625 | 3300049742 | Bacteria | 8822 |
| 589 | Ga0501080_0379929 | 3300049742 | Bacteria | 1273 |
| 590 | Ga0501081_0786268 | 3300049743 | Bacteria | 716 |
| 591 | Ga0501081_1100213 | 3300049743 | Bacteria | 601 |
| 592 | Ga0501081_1509009 | 3300049743 | Bacteria | 510 |
| 593 | Ga0501083_0086253 | 3300049744 | Bacteria | 2076 |
| 594 | Ga0501035_0091548 | 3300049822 | Bacteria | 2676 |
| 595 | Ga0501035_0760537 | 3300049822 | Bacteria | 777 |
| 596 | Ga0501035_0907568 | 3300049822 | Bacteria | 697 |
| 597 | Ga0501044_0106357 | 3300049823 | Bacteria | 2818 |
| 598 | Ga0501044_0107329 | 3300049823 | Bacteria | 2803 |
| 599 | Ga0501044_0888318 | 3300049823 | Bacteria | 766 |
| 600 | nmdc:mga03n38_300102_c1 | 3300050490 | Bacteria | 862 |
| 601 | nmdc:mga0yw44_1045237_c1 | 3300050492 | Bacteria | 552 |
| 602 | nmdc:mga0yw44_1239015_c1 | 3300050492 | Bacteria | 503 |
| 603 | nmdc:mga0yw44_698944_c1 | 3300050492 | Bacteria | 689 |
| 604 | nmdc:mga0yw44_798739_c1 | 3300050492 | Bacteria | 641 |
| 605 | nmdc:mga05p37_543913_c1 | 3300050507 | Bacteria | 1323 |
| 606 | nmdc:mga05p37_815531_c1 | 3300050507 | Bacteria | 1019 |
| 607 | nmdc:mga09592_38412_c1 | 3300050508 | Bacteria | 4019 |
| 608 | nmdc:mga0qj67_119451_c1 | 3300050509 | Bacteria | 1516 |
| 609 | nmdc:mga06r32_82733_c1 | 3300050510 | Bacteria | 3128 |
| 610 | nmdc:mga08y16_1396023_c1 | 3300050511 | Bacteria | 664 |
| 611 | nmdc:mga08y16_270689_c1 | 3300050511 | Bacteria | 1754 |
| 612 | nmdc:mga0n895_189011_c1 | 3300050512 | Bacteria | 2091 |
| 613 | nmdc:mga0rr50_40885_c1 | 3300050513 | Bacteria | 3374 |
| 614 | nmdc:mga0rr50_88314_c1 | 3300050513 | Bacteria | 2408 |
| 615 | nmdc:mga08x19_187071_c1 | 3300050514 | Bacteria | 1416 |
| 616 | nmdc:mga08x19_41905_c1 | 3300050514 | Bacteria | 2917 |
| 617 | nmdc:mga0a205_179499_c1 | 3300050515 | Bacteria | 2012 |
| 618 | nmdc:mga0sz30_15776_c1 | 3300050516 | Bacteria | 2990 |
| 619 | Ga0495601_0030907 | 3300053077 | Bacteria | 3327 |
| 620 | Ga0495612_0058802 | 3300053078 | Bacteria | 1589 |
| 621 | Ga0495655_0216010 | 3300053083 | Bacteria | 633 |
| 622 | Ga0495595_0063731 | 3300053084 | Bacteria | 1731 |
| 623 | Ga0495595_0686740 | 3300053084 | Bacteria | 524 |
| 624 | Ga0495619_0001164 | 3300053085 | Bacteria | 17272 |
| 625 | Ga0495619_0296822 | 3300053085 | Bacteria | 1119 |
| 626 | Ga0500651_0630558 | 3300053093 | Bacteria | 579 |
| 627 | Ga0500556_0000636 | 3300053104 | Bacteria | 22036 |
| 628 | Ga0500562_036758 | 3300053108 | Bacteria | 1299 |
| 629 | Ga0500616_0003259 | 3300053153 | Bacteria | 12557 |
| 630 | Ga0500616_0065923 | 3300053153 | Bacteria | 1861 |
| 631 | Ga0500645_115075 | 3300053730 | Bacteria | 753 |
| 632 | Ga0501084_0039158 | 3300054114 | Bacteria | 3965 |
| 633 | Ga0501082_1358039 | 3300060353 | Bacteria | 621 |
| 634 | Ga0530510_0712691 | 3300061734 | Bacteria | 765 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10640271 | Ga0075366_106402711 | 90 |
| 2 | 3300009092 | Ga0105250_10076922 | Ga0105250_100769224 | 90 |
| 3 | 3300005329 | Ga0070683_100565925 | Ga0070683_1005659252 | 98 |
| 4 | 3300025944 | Ga0207661_11139378 | Ga0207661_111393782 | 98 |
| 5 | iso_pu_bacteria | 8002285264 | 8002285926 | 100 |
| 6 | 3300039437 | Ga0436365_0451316 | Ga0436365_0451316_77_382 | 101 |
| 7 | iso_pu_bacteria | 2545555834 | 2545677362 | 101 |
| 8 | iso_pu_bacteria | 2842698319 | 2842701709 | 101 |
| 9 | iso_pu_bacteria | 2909042592 | 2909043607 | 101 |
| 10 | iso_pu_bacteria | 3003665799 | 3003667749 | 101 |
| 11 | iso_pu_bacteria | 641522639 | 641640670 | 101 |
| 12 | iso_pu_bacteria | 643348564 | 643599654 | 101 |
| 13 | 3300031548 | Ga0307408_100769660 | Ga0307408_1007696602 | 103 |
| 14 | 3300031731 | Ga0307405_10324581 | Ga0307405_103245812 | 103 |
| 15 | 3300031824 | Ga0307413_10792958 | Ga0307413_107929581 | 103 |
| 16 | 3300031995 | Ga0307409_100224075 | Ga0307409_1002240755 | 103 |
| 17 | 3300032005 | Ga0307411_10390912 | Ga0307411_103909121 | 103 |
| 18 | 3300032126 | Ga0307415_100454199 | Ga0307415_1004541991 | 103 |
| 19 | 3300041997 | Ga0439431_0095110 | Ga0439431_0095110_188_499 | 103 |
| 20 | 3300042014 | Ga0439457_186150 | Ga0439457_186150_123_434 | 103 |
| 21 | 3300049571 | Ga0501034_0014685 | Ga0501034_0014685_4228_4539 | 103 |
| 22 | 3300049571 | Ga0501034_0172892 | Ga0501034_0172892_1687_2001 | 103 |
| 23 | 3300049576 | Ga0501040_0378075 | Ga0501040_0378075_579_890 | 103 |
| 24 | 3300049823 | Ga0501044_0106357 | Ga0501044_0106357_2144_2455 | 103 |
| 25 | 3300005539 | Ga0068853_100908836 | Ga0068853_1009088362 | 104 |
| 26 | 3300005983 | Ga0081540_1046399 | Ga0081540_10463996 | 104 |
| 27 | 3300009101 | Ga0105247_10965182 | Ga0105247_109651822 | 104 |
| 28 | 3300009174 | Ga0105241_11794485 | Ga0105241_117944852 | 104 |
| 29 | 3300013104 | Ga0157370_11293650 | Ga0157370_112936502 | 104 |
| 30 | 3300013307 | Ga0157372_12050085 | Ga0157372_120500852 | 104 |
| 31 | 3300026041 | Ga0207639_11436428 | Ga0207639_114364281 | 104 |
| 32 | 3300031344 | Ga0265316_11101272 | Ga0265316_111012721 | 104 |
| 33 | 3300031712 | Ga0265342_10180624 | Ga0265342_101806242 | 104 |
| 34 | 3300035398 | Ga0316574_0924778 | Ga0316574_0924778_184_498 | 104 |
| 35 | 3300049568 | Ga0501031_0142725 | Ga0501031_0142725_977_1291 | 104 |
| 36 | 3300049569 | Ga0501032_0106312 | Ga0501032_0106312_1112_1426 | 104 |
| 37 | 3300049570 | Ga0501033_0082000 | Ga0501033_0082000_1782_2096 | 104 |
| 38 | 3300049572 | Ga0501036_0916616 | Ga0501036_0916616_180_494 | 104 |
| 39 | 3300049574 | Ga0501038_0672149 | Ga0501038_0672149_86_400 | 104 |
| 40 | 3300049575 | Ga0501039_0600033 | Ga0501039_0600033_451_765 | 104 |
| 41 | 3300049581 | Ga0501047_0639715 | Ga0501047_0639715_322_636 | 104 |
| 42 | 3300049584 | Ga0501068_0377864 | Ga0501068_0377864_526_846 | 104 |
| 43 | 3300049592 | Ga0501076_1710880 | Ga0501076_1710880_26_346 | 104 |
| 44 | 3300049822 | Ga0501035_0907568 | Ga0501035_0907568_109_423 | 104 |
| 45 | 3300049823 | Ga0501044_0107329 | Ga0501044_0107329_692_1006 | 104 |
| 46 | 3300053083 | Ga0495655_0216010 | Ga0495655_0216010_119_436 | 104 |
| 47 | 3300001979 | JGI24740J21852_10158064 | JGI24740J21852_101580641 | 105 |
| 48 | 3300001990 | JGI24737J22298_10002957 | JGI24737J22298_100029573 | 105 |
| 49 | 3300002067 | JGI24735J21928_10114903 | JGI24735J21928_101149032 | 105 |
| 50 | 3300002070 | JGI24750J21931_1025865 | JGI24750J21931_10258652 | 105 |
| 51 | 3300002074 | JGI24748J21848_1061909 | JGI24748J21848_10619091 | 105 |
| 52 | 3300002075 | JGI24738J21930_10005208 | JGI24738J21930_100052085 | 105 |
| 53 | 3300002077 | JGI24744J21845_10030691 | JGI24744J21845_100306913 | 105 |
| 54 | 3300002239 | JGI24034J26672_10026547 | JGI24034J26672_100265472 | 105 |
| 55 | 3300002244 | JGI24742J22300_10034521 | JGI24742J22300_100345212 | 105 |
| 56 | 3300002459 | JGI24751J29686_10074257 | JGI24751J29686_100742571 | 105 |
| 57 | 3300003911 | JGI25405J52794_10135021 | JGI25405J52794_101350212 | 105 |
| 58 | 3300005290 | Ga0065712_10141376 | Ga0065712_101413764 | 105 |
| 59 | 3300005295 | Ga0065707_10838764 | Ga0065707_108387642 | 105 |
| 60 | 3300005327 | Ga0070658_10012301 | Ga0070658_1001230111 | 105 |
| 61 | 3300005328 | Ga0070676_10014395 | Ga0070676_100143959 | 105 |
| 62 | 3300005328 | Ga0070676_10357237 | Ga0070676_103572372 | 105 |
| 63 | 3300005329 | Ga0070683_100014681 | Ga0070683_10001468111 | 105 |
| 64 | 3300005330 | Ga0070690_100012397 | Ga0070690_10001239710 | 105 |
| 65 | 3300005330 | Ga0070690_100137081 | Ga0070690_1001370814 | 105 |
| 66 | 3300005331 | Ga0070670_100000376 | Ga0070670_10000037633 | 105 |
| 67 | 3300005331 | Ga0070670_101001242 | Ga0070670_1010012422 | 105 |
| 68 | 3300005334 | Ga0068869_100003825 | Ga0068869_1000038255 | 105 |
| 69 | 3300005335 | Ga0070666_10004644 | Ga0070666_1000464412 | 105 |
| 70 | 3300005336 | Ga0070680_100008294 | Ga0070680_1000082949 | 105 |
| 71 | 3300005336 | Ga0070680_100707378 | Ga0070680_1007073782 | 105 |
| 72 | 3300005337 | Ga0070682_100041295 | Ga0070682_1000412955 | 105 |
| 73 | 3300005338 | Ga0068868_100010801 | Ga0068868_10001080110 | 105 |
| 74 | 3300005338 | Ga0068868_100844818 | Ga0068868_1008448181 | 105 |
| 75 | 3300005339 | Ga0070660_100000686 | Ga0070660_10000068618 | 105 |
| 76 | 3300005339 | Ga0070660_101541607 | Ga0070660_1015416071 | 105 |
| 77 | 3300005340 | Ga0070689_100000122 | Ga0070689_10000012225 | 105 |
| 78 | 3300005341 | Ga0070691_10000273 | Ga0070691_1000027321 | 105 |
| 79 | 3300005344 | Ga0070661_100000385 | Ga0070661_10000038510 | 105 |
| 80 | 3300005345 | Ga0070692_10003072 | Ga0070692_100030726 | 105 |
| 81 | 3300005345 | Ga0070692_10701732 | Ga0070692_107017322 | 105 |
| 82 | 3300005353 | Ga0070669_100002082 | Ga0070669_1000020829 | 105 |
| 83 | 3300005354 | Ga0070675_100700921 | Ga0070675_1007009212 | 105 |
| 84 | 3300005355 | Ga0070671_100001283 | Ga0070671_10000128317 | 105 |
| 85 | 3300005356 | Ga0070674_100000649 | Ga0070674_10000064918 | 105 |
| 86 | 3300005356 | Ga0070674_100005343 | Ga0070674_10000534312 | 105 |
| 87 | 3300005356 | Ga0070674_101674466 | Ga0070674_1016744661 | 105 |
| 88 | 3300005364 | Ga0070673_100002163 | Ga0070673_10000216311 | 105 |
| 89 | 3300005365 | Ga0070688_100000217 | Ga0070688_10000021730 | 105 |
| 90 | 3300005366 | Ga0070659_100003485 | Ga0070659_10000348515 | 105 |
| 91 | 3300005367 | Ga0070667_100003614 | Ga0070667_10000361413 | 105 |
| 92 | 3300005406 | Ga0070703_10217434 | Ga0070703_102174342 | 105 |
| 93 | 3300005434 | Ga0070709_10001353 | Ga0070709_100013539 | 105 |
| 94 | 3300005434 | Ga0070709_11337907 | Ga0070709_113379072 | 105 |
| 95 | 3300005435 | Ga0070714_100006925 | Ga0070714_1000069259 | 105 |
| 96 | 3300005435 | Ga0070714_100050142 | Ga0070714_1000501427 | 105 |
| 97 | 3300005435 | Ga0070714_101396830 | Ga0070714_1013968302 | 105 |
| 98 | 3300005436 | Ga0070713_101269131 | Ga0070713_1012691312 | 105 |
| 99 | 3300005437 | Ga0070710_10005298 | Ga0070710_100052989 | 105 |
| 100 | 3300005437 | Ga0070710_10297179 | Ga0070710_102971792 | 105 |
| 101 | 3300005438 | Ga0070701_10000897 | Ga0070701_1000089712 | 105 |
| 102 | 3300005439 | Ga0070711_100000834 | Ga0070711_10000083418 | 105 |
| 103 | 3300005439 | Ga0070711_100043033 | Ga0070711_1000430332 | 105 |
| 104 | 3300005439 | Ga0070711_101003908 | Ga0070711_1010039081 | 105 |
| 105 | 3300005440 | Ga0070705_100001475 | Ga0070705_1000014758 | 105 |
| 106 | 3300005440 | Ga0070705_100054734 | Ga0070705_1000547341 | 105 |
| 107 | 3300005441 | Ga0070700_100001041 | Ga0070700_10000104118 | 105 |
| 108 | 3300005441 | Ga0070700_100133165 | Ga0070700_1001331652 | 105 |
| 109 | 3300005441 | Ga0070700_100271271 | Ga0070700_1002712713 | 105 |
| 110 | 3300005444 | Ga0070694_100000195 | Ga0070694_10000019513 | 105 |
| 111 | 3300005444 | Ga0070694_101306564 | Ga0070694_1013065642 | 105 |
| 112 | 3300005455 | Ga0070663_100000352 | Ga0070663_10000035216 | 105 |
| 113 | 3300005455 | Ga0070663_100341785 | Ga0070663_1003417852 | 105 |
| 114 | 3300005456 | Ga0070678_100001146 | Ga0070678_10000114612 | 105 |
| 115 | 3300005456 | Ga0070678_100257457 | Ga0070678_1002574574 | 105 |
| 116 | 3300005457 | Ga0070662_100000412 | Ga0070662_10000041230 | 105 |
| 117 | 3300005457 | Ga0070662_100758779 | Ga0070662_1007587791 | 105 |
| 118 | 3300005458 | Ga0070681_10423869 | Ga0070681_104238691 | 105 |
| 119 | 3300005459 | Ga0068867_100042053 | Ga0068867_1000420536 | 105 |
| 120 | 3300005459 | Ga0068867_100292281 | Ga0068867_1002922813 | 105 |
| 121 | 3300005466 | Ga0070685_10155510 | Ga0070685_101555104 | 105 |
| 122 | 3300005518 | Ga0070699_100101221 | Ga0070699_1001012215 | 105 |
| 123 | 3300005530 | Ga0070679_100103457 | Ga0070679_1001034575 | 105 |
| 124 | 3300005535 | Ga0070684_100149269 | Ga0070684_1001492693 | 105 |
| 125 | 3300005536 | Ga0070697_100000391 | Ga0070697_10000039133 | 105 |
| 126 | 3300005539 | Ga0068853_100001082 | Ga0068853_10000108215 | 105 |
| 127 | 3300005543 | Ga0070672_100002807 | Ga0070672_10000280716 | 105 |
| 128 | 3300005543 | Ga0070672_100351224 | Ga0070672_1003512242 | 105 |
| 129 | 3300005544 | Ga0070686_100001391 | Ga0070686_10000139112 | 105 |
| 130 | 3300005544 | Ga0070686_101519100 | Ga0070686_1015191002 | 105 |
| 131 | 3300005545 | Ga0070695_100000238 | Ga0070695_10000023820 | 105 |
| 132 | 3300005546 | Ga0070696_100000815 | Ga0070696_1000008159 | 105 |
| 133 | 3300005546 | Ga0070696_100311884 | Ga0070696_1003118842 | 105 |
| 134 | 3300005547 | Ga0070693_100000455 | Ga0070693_10000045515 | 105 |
| 135 | 3300005547 | Ga0070693_100290171 | Ga0070693_1002901712 | 105 |
| 136 | 3300005548 | Ga0070665_100008997 | Ga0070665_1000089974 | 105 |
| 137 | 3300005549 | Ga0070704_100000124 | Ga0070704_10000012415 | 105 |
| 138 | 3300005549 | Ga0070704_100675714 | Ga0070704_1006757142 | 105 |
| 139 | 3300005563 | Ga0068855_100002691 | Ga0068855_10000269118 | 105 |
| 140 | 3300005564 | Ga0070664_100002450 | Ga0070664_10000245011 | 105 |
| 141 | 3300005577 | Ga0068857_100008457 | Ga0068857_1000084572 | 105 |
| 142 | 3300005577 | Ga0068857_100363422 | Ga0068857_1003634222 | 105 |
| 143 | 3300005577 | Ga0068857_101329909 | Ga0068857_1013299092 | 105 |
| 144 | 3300005578 | Ga0068854_100004862 | Ga0068854_10000486214 | 105 |
| 145 | 3300005578 | Ga0068854_100207540 | Ga0068854_1002075402 | 105 |
| 146 | 3300005614 | Ga0068856_100005122 | Ga0068856_10000512211 | 105 |
| 147 | 3300005614 | Ga0068856_100194610 | Ga0068856_1001946105 | 105 |
| 148 | 3300005614 | Ga0068856_100937139 | Ga0068856_1009371392 | 105 |
| 149 | 3300005614 | Ga0068856_101631752 | Ga0068856_1016317522 | 105 |
| 150 | 3300005615 | Ga0070702_100000018 | Ga0070702_10000001821 | 105 |
| 151 | 3300005615 | Ga0070702_100289754 | Ga0070702_1002897543 | 105 |
| 152 | 3300005615 | Ga0070702_100451962 | Ga0070702_1004519622 | 105 |
| 153 | 3300005616 | Ga0068852_100010938 | Ga0068852_10001093814 | 105 |
| 154 | 3300005616 | Ga0068852_101698313 | Ga0068852_1016983131 | 105 |
| 155 | 3300005617 | Ga0068859_100030651 | Ga0068859_10003065112 | 105 |
| 156 | 3300005617 | Ga0068859_100076838 | Ga0068859_1000768382 | 105 |
| 157 | 3300005618 | Ga0068864_100002243 | Ga0068864_1000022439 | 105 |
| 158 | 3300005718 | Ga0068866_10001983 | Ga0068866_1000198315 | 105 |
| 159 | 3300005718 | Ga0068866_10629037 | Ga0068866_106290372 | 105 |
| 160 | 3300005719 | Ga0068861_100000942 | Ga0068861_10000094216 | 105 |
| 161 | 3300005719 | Ga0068861_100039077 | Ga0068861_1000390779 | 105 |
| 162 | 3300005719 | Ga0068861_101161056 | Ga0068861_1011610562 | 105 |
| 163 | 3300005841 | Ga0068863_100007838 | Ga0068863_1000078384 | 105 |
| 164 | 3300005842 | Ga0068858_100016672 | Ga0068858_1000166725 | 105 |
| 165 | 3300005843 | Ga0068860_100000598 | Ga0068860_10000059822 | 105 |
| 166 | 3300005844 | Ga0068862_100002944 | Ga0068862_1000029446 | 105 |
| 167 | 3300005844 | Ga0068862_100988163 | Ga0068862_1009881632 | 105 |
| 168 | 3300005937 | Ga0081455_10014358 | Ga0081455_100143589 | 105 |
| 169 | 3300005937 | Ga0081455_10020755 | Ga0081455_100207558 | 105 |
| 170 | 3300005983 | Ga0081540_1077636 | Ga0081540_10776363 | 105 |
| 171 | 3300006028 | Ga0070717_10053359 | Ga0070717_100533596 | 105 |
| 172 | 3300006028 | Ga0070717_10326478 | Ga0070717_103264782 | 105 |
| 173 | 3300006038 | Ga0075365_10484677 | Ga0075365_104846772 | 105 |
| 174 | 3300006048 | Ga0075363_100265443 | Ga0075363_1002654432 | 105 |
| 175 | 3300006058 | Ga0075432_10000910 | Ga0075432_1000091012 | 105 |
| 176 | 3300006163 | Ga0070715_10003461 | Ga0070715_100034616 | 105 |
| 177 | 3300006163 | Ga0070715_10414604 | Ga0070715_104146042 | 105 |
| 178 | 3300006173 | Ga0070716_100001603 | Ga0070716_10000160314 | 105 |
| 179 | 3300006173 | Ga0070716_100170814 | Ga0070716_1001708143 | 105 |
| 180 | 3300006175 | Ga0070712_100006515 | Ga0070712_10000651511 | 105 |
| 181 | 3300006175 | Ga0070712_100130538 | Ga0070712_1001305383 | 105 |
| 182 | 3300006175 | Ga0070712_100175321 | Ga0070712_1001753215 | 105 |
| 183 | 3300006186 | Ga0075369_10023039 | Ga0075369_100230394 | 105 |
| 184 | 3300006237 | Ga0097621_100240950 | Ga0097621_1002409501 | 105 |
| 185 | 3300006237 | Ga0097621_102315546 | Ga0097621_1023155462 | 105 |
| 186 | 3300006844 | Ga0075428_100133606 | Ga0075428_1001336066 | 105 |
| 187 | 3300006847 | Ga0075431_100003503 | Ga0075431_10000350313 | 105 |
| 188 | 3300006852 | Ga0075433_10023032 | Ga0075433_1002303211 | 105 |
| 189 | 3300006871 | Ga0075434_100069351 | Ga0075434_1000693517 | 105 |
| 190 | 3300006880 | Ga0075429_100041550 | Ga0075429_1000415509 | 105 |
| 191 | 3300006881 | Ga0068865_100005623 | Ga0068865_10000562311 | 105 |
| 192 | 3300006881 | Ga0068865_100110847 | Ga0068865_1001108472 | 105 |
| 193 | 3300006881 | Ga0068865_100592701 | Ga0068865_1005927012 | 105 |
| 194 | 3300006914 | Ga0075436_100002180 | Ga0075436_10000218019 | 105 |
| 195 | 3300006914 | Ga0075436_100027159 | Ga0075436_1000271593 | 105 |
| 196 | 3300006931 | Ga0097620_100030651 | Ga0097620_1000306512 | 105 |
| 197 | 3300006931 | Ga0097620_100076839 | Ga0097620_1000768392 | 105 |
| 198 | 3300007076 | Ga0075435_100065482 | Ga0075435_1000654826 | 105 |
| 199 | 3300007076 | Ga0075435_100087765 | Ga0075435_1000877652 | 105 |
| 200 | 3300007788 | Ga0099795_10001948 | Ga0099795_100019487 | 105 |
| 201 | 3300009011 | Ga0105251_10071832 | Ga0105251_100718322 | 105 |
| 202 | 3300009011 | Ga0105251_10121149 | Ga0105251_101211492 | 105 |
| 203 | 3300009036 | Ga0105244_10048677 | Ga0105244_100486773 | 105 |
| 204 | 3300009093 | Ga0105240_10039464 | Ga0105240_1003946411 | 105 |
| 205 | 3300009094 | Ga0111539_10341243 | Ga0111539_103412432 | 105 |
| 206 | 3300009094 | Ga0111539_11038987 | Ga0111539_110389871 | 105 |
| 207 | 3300009098 | Ga0105245_10000718 | Ga0105245_100007188 | 105 |
| 208 | 3300009098 | Ga0105245_10796709 | Ga0105245_107967092 | 105 |
| 209 | 3300009098 | Ga0105245_13295271 | Ga0105245_132952712 | 105 |
| 210 | 3300009101 | Ga0105247_10001104 | Ga0105247_1000110420 | 105 |
| 211 | 3300009101 | Ga0105247_10418328 | Ga0105247_104183282 | 105 |
| 212 | 3300009147 | Ga0114129_10051465 | Ga0114129_100514658 | 105 |
| 213 | 3300009148 | Ga0105243_10001752 | Ga0105243_1000175212 | 105 |
| 214 | 3300009148 | Ga0105243_10183090 | Ga0105243_101830904 | 105 |
| 215 | 3300009148 | Ga0105243_10593114 | Ga0105243_105931141 | 105 |
| 216 | 3300009148 | Ga0105243_11128866 | Ga0105243_111288662 | 105 |
| 217 | 3300009148 | Ga0105243_11638009 | Ga0105243_116380091 | 105 |
| 218 | 3300009174 | Ga0105241_10003357 | Ga0105241_100033577 | 105 |
| 219 | 3300009176 | Ga0105242_10757195 | Ga0105242_107571952 | 105 |
| 220 | 3300009177 | Ga0105248_10002832 | Ga0105248_1000283213 | 105 |
| 221 | 3300009177 | Ga0105248_10049856 | Ga0105248_100498562 | 105 |
| 222 | 3300009545 | Ga0105237_10001618 | Ga0105237_1000161810 | 105 |
| 223 | 3300009551 | Ga0105238_10007984 | Ga0105238_1000798416 | 105 |
| 224 | 3300009551 | Ga0105238_12781241 | Ga0105238_127812412 | 105 |
| 225 | 3300009553 | Ga0105249_10002122 | Ga0105249_1000212218 | 105 |
| 226 | 3300009553 | Ga0105249_10019915 | Ga0105249_1001991510 | 105 |
| 227 | 3300009553 | Ga0105249_10513588 | Ga0105249_105135883 | 105 |
| 228 | 3300009553 | Ga0105249_12662686 | Ga0105249_126626862 | 105 |
| 229 | 3300009553 | Ga0105249_12989881 | Ga0105249_129898812 | 105 |
| 230 | 3300010159 | Ga0099796_10051000 | Ga0099796_100510002 | 105 |
| 231 | 3300010375 | Ga0105239_10002536 | Ga0105239_100025365 | 105 |
| 232 | 3300010375 | Ga0105239_10067735 | Ga0105239_100677355 | 105 |
| 233 | 3300011119 | Ga0105246_10002439 | Ga0105246_100024397 | 105 |
| 234 | 3300011119 | Ga0105246_10291090 | Ga0105246_102910902 | 105 |
| 235 | 3300013100 | Ga0157373_10048800 | Ga0157373_100488006 | 105 |
| 236 | 3300013102 | Ga0157371_10018898 | Ga0157371_100188989 | 105 |
| 237 | 3300013105 | Ga0157369_10001227 | Ga0157369_100012279 | 105 |
| 238 | 3300013296 | Ga0157374_10028235 | Ga0157374_100282358 | 105 |
| 239 | 3300013297 | Ga0157378_10000470 | Ga0157378_1000047015 | 105 |
| 240 | 3300013297 | Ga0157378_10813982 | Ga0157378_108139822 | 105 |
| 241 | 3300013297 | Ga0157378_11215857 | Ga0157378_112158572 | 105 |
| 242 | 3300013306 | Ga0163162_10136124 | Ga0163162_101361245 | 105 |
| 243 | 3300013306 | Ga0163162_10765479 | Ga0163162_107654792 | 105 |
| 244 | 3300013306 | Ga0163162_11247194 | Ga0163162_112471942 | 105 |
| 245 | 3300013307 | Ga0157372_10001215 | Ga0157372_1000121514 | 105 |
| 246 | 3300013308 | Ga0157375_10001640 | Ga0157375_100016406 | 105 |
| 247 | 3300013308 | Ga0157375_10007439 | Ga0157375_1000743911 | 105 |
| 248 | 3300013308 | Ga0157375_13130304 | Ga0157375_131303042 | 105 |
| 249 | 3300014325 | Ga0163163_10002310 | Ga0163163_100023109 | 105 |
| 250 | 3300014325 | Ga0163163_10005311 | Ga0163163_1000531113 | 105 |
| 251 | 3300014326 | Ga0157380_10076160 | Ga0157380_100761605 | 105 |
| 252 | 3300014326 | Ga0157380_10143061 | Ga0157380_101430613 | 105 |
| 253 | 3300014497 | Ga0182008_10107640 | Ga0182008_101076402 | 105 |
| 254 | 3300014745 | Ga0157377_10006965 | Ga0157377_1000696511 | 105 |
| 255 | 3300014968 | Ga0157379_10001927 | Ga0157379_1000192715 | 105 |
| 256 | 3300014969 | Ga0157376_10000606 | Ga0157376_1000060624 | 105 |
| 257 | 3300014969 | Ga0157376_10197722 | Ga0157376_101977224 | 105 |
| 258 | 3300017792 | Ga0163161_10005439 | Ga0163161_100054396 | 105 |
| 259 | 3300017792 | Ga0163161_10008942 | Ga0163161_1000894213 | 105 |
| 260 | 3300017792 | Ga0163161_11899609 | Ga0163161_118996091 | 105 |
| 261 | 3300020070 | Ga0206356_11650643 | Ga0206356_116506432 | 105 |
| 262 | 3300021358 | Ga0213873_10035050 | Ga0213873_100350502 | 105 |
| 263 | 3300021388 | Ga0213875_10123121 | Ga0213875_101231212 | 105 |
| 264 | 3300021388 | Ga0213875_10173164 | Ga0213875_101731641 | 105 |
| 265 | 3300021388 | Ga0213875_10258435 | Ga0213875_102584351 | 105 |
| 266 | 3300021441 | Ga0213871_10124014 | Ga0213871_101240142 | 105 |
| 267 | 3300022467 | Ga0224712_10068907 | Ga0224712_100689072 | 105 |
| 268 | 3300022730 | Ga0224570_109993 | Ga0224570_1099931 | 105 |
| 269 | 3300024225 | Ga0224572_1054657 | Ga0224572_10546572 | 105 |
| 270 | 3300024227 | Ga0228598_1020778 | Ga0228598_10207782 | 105 |
| 271 | 3300025321 | Ga0207656_10287146 | Ga0207656_102871462 | 105 |
| 272 | 3300025735 | Ga0207713_1196988 | Ga0207713_11969882 | 105 |
| 273 | 3300025885 | Ga0207653_10051268 | Ga0207653_100512684 | 105 |
| 274 | 3300025898 | Ga0207692_10024037 | Ga0207692_100240372 | 105 |
| 275 | 3300025898 | Ga0207692_10249418 | Ga0207692_102494182 | 105 |
| 276 | 3300025898 | Ga0207692_10391785 | Ga0207692_103917852 | 105 |
| 277 | 3300025899 | Ga0207642_10002270 | Ga0207642_100022706 | 105 |
| 278 | 3300025899 | Ga0207642_10122545 | Ga0207642_101225452 | 105 |
| 279 | 3300025900 | Ga0207710_10003497 | Ga0207710_1000349712 | 105 |
| 280 | 3300025901 | Ga0207688_10002614 | Ga0207688_1000261410 | 105 |
| 281 | 3300025901 | Ga0207688_10654957 | Ga0207688_106549571 | 105 |
| 282 | 3300025901 | Ga0207688_11077438 | Ga0207688_110774381 | 105 |
| 283 | 3300025903 | Ga0207680_10114735 | Ga0207680_101147352 | 105 |
| 284 | 3300025904 | Ga0207647_10001458 | Ga0207647_100014589 | 105 |
| 285 | 3300025905 | Ga0207685_10000290 | Ga0207685_1000029010 | 105 |
| 286 | 3300025905 | Ga0207685_10034041 | Ga0207685_100340414 | 105 |
| 287 | 3300025906 | Ga0207699_10002558 | Ga0207699_1000255813 | 105 |
| 288 | 3300025907 | Ga0207645_10043754 | Ga0207645_100437544 | 105 |
| 289 | 3300025909 | Ga0207705_10154032 | Ga0207705_101540322 | 105 |
| 290 | 3300025911 | Ga0207654_10003285 | Ga0207654_1000328515 | 105 |
| 291 | 3300025913 | Ga0207695_10425048 | Ga0207695_104250482 | 105 |
| 292 | 3300025914 | Ga0207671_10077044 | Ga0207671_100770443 | 105 |
| 293 | 3300025915 | Ga0207693_10000493 | Ga0207693_1000049332 | 105 |
| 294 | 3300025915 | Ga0207693_10113345 | Ga0207693_101133452 | 105 |
| 295 | 3300025915 | Ga0207693_10125438 | Ga0207693_101254386 | 105 |
| 296 | 3300025916 | Ga0207663_10001067 | Ga0207663_100010675 | 105 |
| 297 | 3300025916 | Ga0207663_10804423 | Ga0207663_108044232 | 105 |
| 298 | 3300025917 | Ga0207660_10034333 | Ga0207660_100343334 | 105 |
| 299 | 3300025917 | Ga0207660_10365717 | Ga0207660_103657172 | 105 |
| 300 | 3300025918 | Ga0207662_10045568 | Ga0207662_100455681 | 105 |
| 301 | 3300025919 | Ga0207657_10000282 | Ga0207657_1000028234 | 105 |
| 302 | 3300025919 | Ga0207657_10738995 | Ga0207657_107389952 | 105 |
| 303 | 3300025920 | Ga0207649_10001010 | Ga0207649_1000101024 | 105 |
| 304 | 3300025920 | Ga0207649_10907252 | Ga0207649_109072522 | 105 |
| 305 | 3300025921 | Ga0207652_10141055 | Ga0207652_101410555 | 105 |
| 306 | 3300025923 | Ga0207681_10033396 | Ga0207681_100333966 | 105 |
| 307 | 3300025924 | Ga0207694_10019951 | Ga0207694_100199514 | 105 |
| 308 | 3300025926 | Ga0207659_10005250 | Ga0207659_100052502 | 105 |
| 309 | 3300025926 | Ga0207659_10162871 | Ga0207659_101628714 | 105 |
| 310 | 3300025928 | Ga0207700_10712302 | Ga0207700_107123022 | 105 |
| 311 | 3300025928 | Ga0207700_11099447 | Ga0207700_110994472 | 105 |
| 312 | 3300025929 | Ga0207664_10012756 | Ga0207664_100127562 | 105 |
| 313 | 3300025929 | Ga0207664_10133566 | Ga0207664_101335664 | 105 |
| 314 | 3300025929 | Ga0207664_10354751 | Ga0207664_103547513 | 105 |
| 315 | 3300025929 | Ga0207664_11294975 | Ga0207664_112949752 | 105 |
| 316 | 3300025931 | Ga0207644_10017754 | Ga0207644_100177546 | 105 |
| 317 | 3300025933 | Ga0207706_10000270 | Ga0207706_1000027035 | 105 |
| 318 | 3300025933 | Ga0207706_10732870 | Ga0207706_107328701 | 105 |
| 319 | 3300025934 | Ga0207686_10075628 | Ga0207686_100756282 | 105 |
| 320 | 3300025935 | Ga0207709_10032580 | Ga0207709_100325807 | 105 |
| 321 | 3300025935 | Ga0207709_10133493 | Ga0207709_101334932 | 105 |
| 322 | 3300025935 | Ga0207709_10588937 | Ga0207709_105889372 | 105 |
| 323 | 3300025936 | Ga0207670_10025739 | Ga0207670_100257399 | 105 |
| 324 | 3300025937 | Ga0207669_10075263 | Ga0207669_100752632 | 105 |
| 325 | 3300025937 | Ga0207669_10811320 | Ga0207669_108113201 | 105 |
| 326 | 3300025938 | Ga0207704_10018065 | Ga0207704_100180655 | 105 |
| 327 | 3300025938 | Ga0207704_10680210 | Ga0207704_106802102 | 105 |
| 328 | 3300025939 | Ga0207665_10001538 | Ga0207665_1000153813 | 105 |
| 329 | 3300025939 | Ga0207665_10007579 | Ga0207665_1000757911 | 105 |
| 330 | 3300025940 | Ga0207691_10010501 | Ga0207691_1001050113 | 105 |
| 331 | 3300025940 | Ga0207691_10497050 | Ga0207691_104970502 | 105 |
| 332 | 3300025941 | Ga0207711_10013882 | Ga0207711_1001388210 | 105 |
| 333 | 3300025941 | Ga0207711_10747109 | Ga0207711_107471091 | 105 |
| 334 | 3300025942 | Ga0207689_10006518 | Ga0207689_1000651814 | 105 |
| 335 | 3300025944 | Ga0207661_10022097 | Ga0207661_100220976 | 105 |
| 336 | 3300025949 | Ga0207667_10011595 | Ga0207667_1001159515 | 105 |
| 337 | 3300025960 | Ga0207651_10006413 | Ga0207651_1000641310 | 105 |
| 338 | 3300025961 | Ga0207712_10042972 | Ga0207712_100429727 | 105 |
| 339 | 3300025961 | Ga0207712_11861607 | Ga0207712_118616072 | 105 |
| 340 | 3300025972 | Ga0207668_10001057 | Ga0207668_1000105719 | 105 |
| 341 | 3300025972 | Ga0207668_10114869 | Ga0207668_101148695 | 105 |
| 342 | 3300025981 | Ga0207640_10507893 | Ga0207640_105078932 | 105 |
| 343 | 3300025986 | Ga0207658_10007478 | Ga0207658_1000747810 | 105 |
| 344 | 3300026023 | Ga0207677_10046226 | Ga0207677_100462262 | 105 |
| 345 | 3300026023 | Ga0207677_11450404 | Ga0207677_114504042 | 105 |
| 346 | 3300026035 | Ga0207703_10010584 | Ga0207703_1001058410 | 105 |
| 347 | 3300026067 | Ga0207678_10000477 | Ga0207678_1000047735 | 105 |
| 348 | 3300026075 | Ga0207708_10000337 | Ga0207708_1000033715 | 105 |
| 349 | 3300026075 | Ga0207708_10016146 | Ga0207708_100161465 | 105 |
| 350 | 3300026075 | Ga0207708_10081269 | Ga0207708_100812694 | 105 |
| 351 | 3300026078 | Ga0207702_10102306 | Ga0207702_101023062 | 105 |
| 352 | 3300026078 | Ga0207702_10196753 | Ga0207702_101967532 | 105 |
| 353 | 3300026078 | Ga0207702_10630702 | Ga0207702_106307022 | 105 |
| 354 | 3300026078 | Ga0207702_12429892 | Ga0207702_124298922 | 105 |
| 355 | 3300026088 | Ga0207641_10017486 | Ga0207641_1001748612 | 105 |
| 356 | 3300026089 | Ga0207648_10055524 | Ga0207648_100555246 | 105 |
| 357 | 3300026089 | Ga0207648_11188403 | Ga0207648_111884032 | 105 |
| 358 | 3300026095 | Ga0207676_10028077 | Ga0207676_100280779 | 105 |
| 359 | 3300026095 | Ga0207676_10059434 | Ga0207676_100594342 | 105 |
| 360 | 3300026116 | Ga0207674_10002865 | Ga0207674_100028656 | 105 |
| 361 | 3300026116 | Ga0207674_10644903 | Ga0207674_106449032 | 105 |
| 362 | 3300026118 | Ga0207675_100002251 | Ga0207675_10000225125 | 105 |
| 363 | 3300026118 | Ga0207675_100022526 | Ga0207675_1000225265 | 105 |
| 364 | 3300026118 | Ga0207675_101300612 | Ga0207675_1013006122 | 105 |
| 365 | 3300026118 | Ga0207675_101718610 | Ga0207675_1017186101 | 105 |
| 366 | 3300026121 | Ga0207683_10000681 | Ga0207683_100006819 | 105 |
| 367 | 3300026121 | Ga0207683_11828352 | Ga0207683_118283521 | 105 |
| 368 | 3300026142 | Ga0207698_11464924 | Ga0207698_114649241 | 105 |
| 369 | 3300027907 | Ga0207428_10008303 | Ga0207428_1000830315 | 105 |
| 370 | 3300027907 | Ga0207428_10860386 | Ga0207428_108603862 | 105 |
| 371 | 3300028023 | Ga0265357_1001191 | Ga0265357_10011914 | 105 |
| 372 | 3300028379 | Ga0268266_10746671 | Ga0268266_107466712 | 105 |
| 373 | 3300028380 | Ga0268265_10182679 | Ga0268265_101826792 | 105 |
| 374 | 3300028380 | Ga0268265_10820856 | Ga0268265_108208561 | 105 |
| 375 | 3300028381 | Ga0268264_10020640 | Ga0268264_100206405 | 105 |
| 376 | 3300028381 | Ga0268264_10638707 | Ga0268264_106387071 | 105 |
| 377 | 3300028800 | Ga0265338_10660267 | Ga0265338_106602672 | 105 |
| 378 | 3300030760 | Ga0265762_1017824 | Ga0265762_10178242 | 105 |
| 379 | 3300031090 | Ga0265760_10028793 | Ga0265760_100287932 | 105 |
| 380 | 3300031090 | Ga0265760_10091826 | Ga0265760_100918263 | 105 |
| 381 | 3300031250 | Ga0265331_10041152 | Ga0265331_100411524 | 105 |
| 382 | 3300031344 | Ga0265316_10132279 | Ga0265316_101322796 | 105 |
| 383 | 3300031548 | Ga0307408_100430244 | Ga0307408_1004302441 | 105 |
| 384 | 3300031665 | Ga0316575_10000986 | Ga0316575_1000098610 | 105 |
| 385 | 3300031691 | Ga0316579_10016915 | Ga0316579_100169156 | 105 |
| 386 | 3300031727 | Ga0316576_10005834 | Ga0316576_100058349 | 105 |
| 387 | 3300031731 | Ga0307405_10252139 | Ga0307405_102521392 | 105 |
| 388 | 3300031733 | Ga0316577_10009939 | Ga0316577_1000993910 | 105 |
| 389 | 3300031824 | Ga0307413_10068491 | Ga0307413_100684914 | 105 |
| 390 | 3300031824 | Ga0307413_10779066 | Ga0307413_107790662 | 105 |
| 391 | 3300031901 | Ga0307406_10395799 | Ga0307406_103957992 | 105 |
| 392 | 3300031901 | Ga0307406_10845824 | Ga0307406_108458242 | 105 |
| 393 | 3300031911 | Ga0307412_10030283 | Ga0307412_100302837 | 105 |
| 394 | 3300032002 | Ga0307416_100111845 | Ga0307416_1001118455 | 105 |
| 395 | 3300032002 | Ga0307416_101274431 | Ga0307416_1012744312 | 105 |
| 396 | 3300032005 | Ga0307411_10316917 | Ga0307411_103169173 | 105 |
| 397 | 3300032005 | Ga0307411_10430887 | Ga0307411_104308872 | 105 |
| 398 | 3300032126 | Ga0307415_100796194 | Ga0307415_1007961942 | 105 |
| 399 | 3300032133 | Ga0316583_10054181 | Ga0316583_100541814 | 105 |
| 400 | 3300032137 | Ga0316585_10002061 | Ga0316585_1000206110 | 105 |
| 401 | 3300032139 | Ga0316580_10015499 | Ga0316580_100154992 | 105 |
| 402 | 3300032168 | Ga0316593_10000349 | Ga0316593_100003497 | 105 |
| 403 | 3300033524 | Ga0316592_1003508 | Ga0316592_10035084 | 105 |
| 404 | 3300033527 | Ga0316586_1009630 | Ga0316586_10096302 | 105 |
| 405 | 3300033528 | Ga0316588_1003356 | Ga0316588_10033565 | 105 |
| 406 | 3300033541 | Ga0316596_1000615 | Ga0316596_10006158 | 105 |
| 407 | 3300033541 | Ga0316596_1093529 | Ga0316596_10935292 | 105 |
| 408 | 3300034816 | Ga0373930_0121500 | Ga0373930_0121500_194_514 | 105 |
| 409 | 3300035083 | Ga0373926_0013170 | Ga0373926_0013170_1823_2143 | 105 |
| 410 | 3300035084 | Ga0373928_0167210 | Ga0373928_0167210_193_513 | 105 |
| 411 | 3300035085 | Ga0373929_0030267 | Ga0373929_0030267_134_454 | 105 |
| 412 | 3300035085 | Ga0373929_0048974 | Ga0373929_0048974_127_447 | 105 |
| 413 | 3300035088 | Ga0373940_0062626 | Ga0373940_0062626_665_985 | 105 |
| 414 | 3300035089 | Ga0373944_0199632 | Ga0373944_0199632_230_550 | 105 |
| 415 | 3300035091 | Ga0373951_0008546 | Ga0373951_0008546_1252_1572 | 105 |
| 416 | 3300035111 | Ga0373923_0125153 | Ga0373923_0125153_129_455 | 105 |
| 417 | 3300035113 | Ga0373936_0315257 | Ga0373936_0315257_79_399 | 105 |
| 418 | 3300035114 | Ga0373939_0011947 | Ga0373939_0011947_1714_2034 | 105 |
| 419 | 3300035115 | Ga0373941_0330837 | Ga0373941_0330837_97_417 | 105 |
| 420 | 3300035116 | Ga0373945_0084273 | Ga0373945_0084273_724_1044 | 105 |
| 421 | 3300035117 | Ga0373953_0468572 | Ga0373953_0468572_52_378 | 105 |
| 422 | 3300035120 | Ga0373957_0202794 | Ga0373957_0202794_428_754 | 105 |
| 423 | 3300035170 | Ga0373943_0006870 | Ga0373943_0006870_112_432 | 105 |
| 424 | 3300035170 | Ga0373943_0538662 | Ga0373943_0538662_100_417 | 105 |
| 425 | 3300035171 | Ga0373946_0474182 | Ga0373946_0474182_291_611 | 105 |
| 426 | 3300035207 | Ga0373942_0038211 | Ga0373942_0038211_138_458 | 105 |
| 427 | 3300035241 | Ga0373961_0157303 | Ga0373961_0157303_40_360 | 105 |
| 428 | 3300035398 | Ga0316574_0001643 | Ga0316574_0001643_3947_4267 | 105 |
| 429 | 3300035398 | Ga0316574_0217715 | Ga0316574_0217715_567_893 | 105 |
| 430 | 3300035410 | Ga0373924_0006164 | Ga0373924_0006164_3524_3850 | 105 |
| 431 | 3300035410 | Ga0373924_0237454 | Ga0373924_0237454_108_428 | 105 |
| 432 | 3300035691 | Ga0373931_0004918 | Ga0373931_0004918_3522_3842 | 105 |
| 433 | 3300035691 | Ga0373931_0049119 | Ga0373931_0049119_1718_2038 | 105 |
| 434 | 3300035692 | Ga0373935_0057637 | Ga0373935_0057637_1551_1871 | 105 |
| 435 | 3300035695 | Ga0373927_0050141 | Ga0373927_0050141_574_894 | 105 |
| 436 | 3300035695 | Ga0373927_0384791 | Ga0373927_0384791_320_640 | 105 |
| 437 | 3300035724 | Ga0373933_0183660 | Ga0373933_0183660_957_1283 | 105 |
| 438 | 3300035724 | Ga0373933_0194007 | Ga0373933_0194007_415_735 | 105 |
| 439 | 3300035725 | Ga0373947_0006238 | Ga0373947_0006238_1274_1594 | 105 |
| 440 | 3300035725 | Ga0373947_0177399 | Ga0373947_0177399_657_977 | 105 |
| 441 | 3300035725 | Ga0373947_0960300 | Ga0373947_0960300_73_399 | 105 |
| 442 | 3300036401 | Ga0373937_0311322 | Ga0373937_0311322_906_1226 | 105 |
| 443 | 3300036401 | Ga0373937_2139227 | Ga0373937_2139227_85_411 | 105 |
| 444 | 3300036647 | Ga0316582_0009543 | Ga0316582_0009543_3963_4283 | 105 |
| 445 | 3300036712 | Ga0316584_0001849 | Ga0316584_0001849_8031_8351 | 105 |
| 446 | 3300037068 | Ga0373925_0167807 | Ga0373925_0167807_1305_1622 | 105 |
| 447 | 3300037068 | Ga0373925_1292678 | Ga0373925_1292678_153_479 | 105 |
| 448 | 3300037418 | Ga0395900_0032155 | Ga0395900_0032155_2053_2373 | 105 |
| 449 | 3300037466 | Ga0395898_0639728 | Ga0395898_0639728_122_442 | 105 |
| 450 | 3300037471 | Ga0395905_0002506 | Ga0395905_0002506_14711_15031 | 105 |
| 451 | 3300037471 | Ga0395905_0319671 | Ga0395905_0319671_685_1002 | 105 |
| 452 | 3300037588 | Ga0316581_0000487 | Ga0316581_0000487_10_330 | 105 |
| 453 | 3300037853 | Ga0436364_0565626 | Ga0436364_0565626_137_454 | 105 |
| 454 | 3300037853 | Ga0436364_0927931 | Ga0436364_0927931_613_930 | 105 |
| 455 | 3300037853 | Ga0436364_0997073 | Ga0436364_0997073_1140_1457 | 105 |
| 456 | 3300038443 | Ga0395901_0151090 | Ga0395901_0151090_412_732 | 105 |
| 457 | 3300038726 | Ga0400490_42780 | Ga0400490_42780_898_1218 | 105 |
| 458 | 3300038742 | Ga0400486_04379 | Ga0400486_04379_43_363 | 105 |
| 459 | 3300038742 | Ga0400486_08264 | Ga0400486_08264_1479_1799 | 105 |
| 460 | 3300039110 | Ga0400487_10011 | Ga0400487_10011_625_945 | 105 |
| 461 | 3300039437 | Ga0436365_1570347 | Ga0436365_1570347_143_460 | 105 |
| 462 | 3300039437 | Ga0436365_1727234 | Ga0436365_1727234_324_641 | 105 |
| 463 | 3300039438 | Ga0436360_0846530 | Ga0436360_0846530_213_533 | 105 |
| 464 | 3300039447 | Ga0436361_0930690 | Ga0436361_0930690_338_658 | 105 |
| 465 | 3300039450 | Ga0436363_0889443 | Ga0436363_0889443_449_766 | 105 |
| 466 | 3300039450 | Ga0436363_1571548 | Ga0436363_1571548_4541_4858 | 105 |
| 467 | 3300039453 | Ga0436362_0675540 | Ga0436362_0675540_580_900 | 105 |
| 468 | 3300041413 | Ga0439465_0013112 | Ga0439465_0013112_2208_2534 | 105 |
| 469 | 3300041446 | Ga0451794_27367 | Ga0451794_27367_59_376 | 105 |
| 470 | 3300041496 | Ga0451839_0361652 | Ga0451839_0361652_33_350 | 105 |
| 471 | 3300041997 | Ga0439431_0250195 | Ga0439431_0250195_154_480 | 105 |
| 472 | 3300042011 | Ga0439454_048333 | Ga0439454_048333_214_540 | 105 |
| 473 | 3300046452 | Ga0495617_052691 | Ga0495617_052691_331_657 | 105 |
| 474 | 3300046455 | Ga0495603_0000280 | Ga0495603_0000280_22411_22731 | 105 |
| 475 | 3300046459 | Ga0495629_0000177 | Ga0495629_0000177_31558_31878 | 105 |
| 476 | 3300046460 | Ga0495638_0279683 | Ga0495638_0279683_358_684 | 105 |
| 477 | 3300046461 | Ga0495641_0029673 | Ga0495641_0029673_2155_2475 | 105 |
| 478 | 3300046472 | Ga0495580_0000498 | Ga0495580_0000498_370_690 | 105 |
| 479 | 3300046473 | Ga0495582_0000185 | Ga0495582_0000185_14992_15312 | 105 |
| 480 | 3300046475 | Ga0495639_0001788 | Ga0495639_0001788_2389_2709 | 105 |
| 481 | 3300046477 | Ga0495664_0072642 | Ga0495664_0072642_1551_1877 | 105 |
| 482 | 3300046499 | Ga0495594_0000224 | Ga0495594_0000224_3462_3782 | 105 |
| 483 | 3300046511 | Ga0495608_0626772 | Ga0495608_0626772_244_570 | 105 |
| 484 | 3300046511 | Ga0495608_0884773 | Ga0495608_0884773_169_489 | 105 |
| 485 | 3300046514 | Ga0495618_0239954 | Ga0495618_0239954_238_564 | 105 |
| 486 | 3300046526 | Ga0495666_0020979 | Ga0495666_0020979_411_731 | 105 |
| 487 | 3300046529 | Ga0495652_0198733 | Ga0495652_0198733_1178_1504 | 105 |
| 488 | 3300046531 | Ga0495665_0048045 | Ga0495665_0048045_1450_1770 | 105 |
| 489 | 3300046557 | Ga0495622_0000916 | Ga0495622_0000916_5729_6049 | 105 |
| 490 | 3300046559 | Ga0495667_0391434 | Ga0495667_0391434_52_378 | 105 |
| 491 | 3300046616 | Ga0495668_0167441 | Ga0495668_0167441_827_1150 | 105 |
| 492 | 3300046642 | Ga0495634_0003557 | Ga0495634_0003557_9245_9565 | 105 |
| 493 | 3300046674 | Ga0495588_0000617 | Ga0495588_0000617_3484_3804 | 105 |
| 494 | 3300046674 | Ga0495588_0238940 | Ga0495588_0238940_587_904 | 105 |
| 495 | 3300046675 | Ga0495657_0165545 | Ga0495657_0165545_256_582 | 105 |
| 496 | 3300046681 | Ga0495647_0001129 | Ga0495647_0001129_7394_7714 | 105 |
| 497 | 3300046683 | Ga0495658_0399130 | Ga0495658_0399130_125_445 | 105 |
| 498 | 3300046689 | Ga0495613_0037438 | Ga0495613_0037438_449_769 | 105 |
| 499 | 3300046690 | Ga0495624_0330223 | Ga0495624_0330223_326_646 | 105 |
| 500 | 3300046694 | Ga0495649_0119724 | Ga0495649_0119724_442_768 | 105 |
| 501 | 3300047315 | Ga0495581_0001367 | Ga0495581_0001367_9252_9572 | 105 |
| 502 | 3300047317 | Ga0495604_0815245 | Ga0495604_0815245_148_474 | 105 |
| 503 | 3300047319 | Ga0495674_0240554 | Ga0495674_0240554_515_841 | 105 |
| 504 | 3300047321 | Ga0495676_0437059 | Ga0495676_0437059_98_418 | 105 |
| 505 | 3300047322 | Ga0495680_0079783 | Ga0495680_0079783_1609_1929 | 105 |
| 506 | 3300047469 | Ga0495673_0087438 | Ga0495673_0087438_578_904 | 105 |
| 507 | 3300047471 | Ga0495684_0351441 | Ga0495684_0351441_138_458 | 105 |
| 508 | 3300047673 | Ga0495593_0001943 | Ga0495593_0001943_6184_6504 | 105 |
| 509 | 3300048088 | Ga0495602_0354855 | Ga0495602_0354855_693_1019 | 105 |
| 510 | 3300048089 | Ga0495614_0000618 | Ga0495614_0000618_10130_10450 | 105 |
| 511 | 3300048091 | Ga0495626_0174901 | Ga0495626_0174901_213_539 | 105 |
| 512 | 3300048904 | Ga0496101_0077258 | Ga0496101_0077258_1896_2222 | 105 |
| 513 | 3300048904 | Ga0496101_0117548 | Ga0496101_0117548_1360_1680 | 105 |
| 514 | 3300048904 | Ga0496101_0234802 | Ga0496101_0234802_1006_1323 | 105 |
| 515 | 3300048904 | Ga0496101_0397399 | Ga0496101_0397399_697_1017 | 105 |
| 516 | 3300048904 | Ga0496101_1531599 | Ga0496101_1531599_130_450 | 105 |
| 517 | 3300048905 | Ga0496102_0024862 | Ga0496102_0024862_3898_4218 | 105 |
| 518 | 3300048905 | Ga0496102_0033525 | Ga0496102_0033525_2283_2600 | 105 |
| 519 | 3300048905 | Ga0496102_0223736 | Ga0496102_0223736_1191_1517 | 105 |
| 520 | 3300048905 | Ga0496102_0519856 | Ga0496102_0519856_386_712 | 105 |
| 521 | 3300048906 | Ga0496103_0136822 | Ga0496103_0136822_98_418 | 105 |
| 522 | 3300048907 | Ga0496104_0017958 | Ga0496104_0017958_5036_5353 | 105 |
| 523 | 3300048907 | Ga0496104_0045259 | Ga0496104_0045259_660_980 | 105 |
| 524 | 3300048907 | Ga0496104_0052296 | Ga0496104_0052296_1715_2035 | 105 |
| 525 | 3300048907 | Ga0496104_0131885 | Ga0496104_0131885_649_969 | 105 |
| 526 | 3300048907 | Ga0496104_0142115 | Ga0496104_0142115_1698_2018 | 105 |
| 527 | 3300048907 | Ga0496104_0416930 | Ga0496104_0416930_58_384 | 105 |
| 528 | 3300048907 | Ga0496104_0499920 | Ga0496104_0499920_42_368 | 105 |
| 529 | 3300048907 | Ga0496104_0945468 | Ga0496104_0945468_199_519 | 105 |
| 530 | 3300048908 | Ga0496105_0006441 | Ga0496105_0006441_2739_3056 | 105 |
| 531 | 3300048908 | Ga0496105_0151616 | Ga0496105_0151616_310_630 | 105 |
| 532 | 3300048908 | Ga0496105_0499518 | Ga0496105_0499518_215_535 | 105 |
| 533 | 3300048909 | Ga0496106_0091723 | Ga0496106_0091723_367_687 | 105 |
| 534 | 3300048909 | Ga0496106_0094349 | Ga0496106_0094349_1496_1822 | 105 |
| 535 | 3300048909 | Ga0496106_0498618 | Ga0496106_0498618_595_915 | 105 |
| 536 | 3300048910 | Ga0496107_0003748 | Ga0496107_0003748_857_1177 | 105 |
| 537 | 3300048910 | Ga0496107_0024386 | Ga0496107_0024386_1823_2143 | 105 |
| 538 | 3300048910 | Ga0496107_0055486 | Ga0496107_0055486_293_619 | 105 |
| 539 | 3300048910 | Ga0496107_0075028 | Ga0496107_0075028_337_657 | 105 |
| 540 | 3300048910 | Ga0496107_0378806 | Ga0496107_0378806_244_564 | 105 |
| 541 | 3300048911 | Ga0496108_0001133 | Ga0496108_0001133_5141_5458 | 105 |
| 542 | 3300048911 | Ga0496108_0021902 | Ga0496108_0021902_1148_1468 | 105 |
| 543 | 3300048911 | Ga0496108_0180575 | Ga0496108_0180575_1383_1703 | 105 |
| 544 | 3300048911 | Ga0496108_0449363 | Ga0496108_0449363_608_934 | 105 |
| 545 | 3300048911 | Ga0496108_0844396 | Ga0496108_0844396_211_531 | 105 |
| 546 | 3300048911 | Ga0496108_0976407 | Ga0496108_0976407_371_691 | 105 |
| 547 | 3300048912 | Ga0496109_0000583 | Ga0496109_0000583_7404_7721 | 105 |
| 548 | 3300048912 | Ga0496109_0078261 | Ga0496109_0078261_881_1201 | 105 |
| 549 | 3300048912 | Ga0496109_0148378 | Ga0496109_0148378_1506_1826 | 105 |
| 550 | 3300048912 | Ga0496109_0162674 | Ga0496109_0162674_1692_2012 | 105 |
| 551 | 3300048912 | Ga0496109_0186745 | Ga0496109_0186745_1587_1907 | 105 |
| 552 | 3300048912 | Ga0496109_0283421 | Ga0496109_0283421_1190_1510 | 105 |
| 553 | 3300048912 | Ga0496109_1059183 | Ga0496109_1059183_119_445 | 105 |
| 554 | 3300048913 | Ga0496110_0014672 | Ga0496110_0014672_4057_4377 | 105 |
| 555 | 3300048913 | Ga0496110_0062981 | Ga0496110_0062981_289_609 | 105 |
| 556 | 3300048913 | Ga0496110_0162976 | Ga0496110_0162976_650_967 | 105 |
| 557 | 3300048914 | Ga0496111_0002980 | Ga0496111_0002980_9270_9587 | 105 |
| 558 | 3300048914 | Ga0496111_0010039 | Ga0496111_0010039_4332_4652 | 105 |
| 559 | 3300048915 | Ga0496112_0000884 | Ga0496112_0000884_18778_19095 | 105 |
| 560 | 3300048915 | Ga0496112_0005326 | Ga0496112_0005326_2136_2456 | 105 |
| 561 | 3300048915 | Ga0496112_0040118 | Ga0496112_0040118_2309_2629 | 105 |
| 562 | 3300048915 | Ga0496112_0105310 | Ga0496112_0105310_977_1297 | 105 |
| 563 | 3300048915 | Ga0496112_0119156 | Ga0496112_0119156_1962_2282 | 105 |
| 564 | 3300048916 | Ga0496113_0000351 | Ga0496113_0000351_2333_2650 | 105 |
| 565 | 3300048916 | Ga0496113_0016963 | Ga0496113_0016963_2511_2831 | 105 |
| 566 | 3300048916 | Ga0496113_0066735 | Ga0496113_0066735_594_914 | 105 |
| 567 | 3300048916 | Ga0496113_0116789 | Ga0496113_0116789_1692_2012 | 105 |
| 568 | 3300048917 | Ga0496114_0003614 | Ga0496114_0003614_2136_2456 | 105 |
| 569 | 3300048917 | Ga0496114_0033385 | Ga0496114_0033385_163_480 | 105 |
| 570 | 3300048917 | Ga0496114_0114919 | Ga0496114_0114919_1733_2059 | 105 |
| 571 | 3300048918 | Ga0496115_0004536 | Ga0496115_0004536_2042_2359 | 105 |
| 572 | 3300048918 | Ga0496115_0107641 | Ga0496115_0107641_728_1048 | 105 |
| 573 | 3300048918 | Ga0496115_0112724 | Ga0496115_0112724_328_648 | 105 |
| 574 | 3300048927 | Ga0496124_0095308 | Ga0496124_0095308_183_509 | 105 |
| 575 | 3300049162 | Ga0501307_017947 | Ga0501307_017947_404_721 | 105 |
| 576 | 3300049569 | Ga0501032_0262477 | Ga0501032_0262477_370_687 | 105 |
| 577 | 3300049571 | Ga0501034_0014987 | Ga0501034_0014987_5028_5345 | 105 |
| 578 | 3300049571 | Ga0501034_0584983 | Ga0501034_0584983_73_390 | 105 |
| 579 | 3300049571 | Ga0501034_0799191 | Ga0501034_0799191_74_400 | 105 |
| 580 | 3300049572 | Ga0501036_1539035 | Ga0501036_1539035_137_463 | 105 |
| 581 | 3300049575 | Ga0501039_0770615 | Ga0501039_0770615_235_561 | 105 |
| 582 | 3300049576 | Ga0501040_0550422 | Ga0501040_0550422_21_347 | 105 |
| 583 | 3300049579 | Ga0501043_0979874 | Ga0501043_0979874_74_400 | 105 |
| 584 | 3300049580 | Ga0501046_0139696 | Ga0501046_0139696_409_726 | 105 |
| 585 | 3300049580 | Ga0501046_0506808 | Ga0501046_0506808_97_417 | 105 |
| 586 | 3300049581 | Ga0501047_0023054 | Ga0501047_0023054_1756_2073 | 105 |
| 587 | 3300049581 | Ga0501047_0557336 | Ga0501047_0557336_347_664 | 105 |
| 588 | 3300049582 | Ga0501048_0058389 | Ga0501048_0058389_939_1256 | 105 |
| 589 | 3300049582 | Ga0501048_0401596 | Ga0501048_0401596_189_515 | 105 |
| 590 | 3300049583 | Ga0501067_0260490 | Ga0501067_0260490_133_450 | 105 |
| 591 | 3300049584 | Ga0501068_0012735 | Ga0501068_0012735_534_851 | 105 |
| 592 | 3300049585 | Ga0501069_0004928 | Ga0501069_0004928_1516_1833 | 105 |
| 593 | 3300049586 | Ga0501070_0017027 | Ga0501070_0017027_5269_5586 | 105 |
| 594 | 3300049587 | Ga0501071_0368191 | Ga0501071_0368191_668_994 | 105 |
| 595 | 3300049587 | Ga0501071_1047662 | Ga0501071_1047662_165_482 | 105 |
| 596 | 3300049589 | Ga0501073_0043526 | Ga0501073_0043526_2713_3030 | 105 |
| 597 | 3300049590 | Ga0501074_0110773 | Ga0501074_0110773_1147_1464 | 105 |
| 598 | 3300049741 | Ga0501079_0080947 | Ga0501079_0080947_1252_1578 | 105 |
| 599 | 3300049742 | Ga0501080_0009625 | Ga0501080_0009625_6292_6609 | 105 |
| 600 | 3300049742 | Ga0501080_0379929 | Ga0501080_0379929_366_692 | 105 |
| 601 | 3300049743 | Ga0501081_0786268 | Ga0501081_0786268_133_459 | 105 |
| 602 | 3300049743 | Ga0501081_1100213 | Ga0501081_1100213_262_579 | 105 |
| 603 | 3300049743 | Ga0501081_1509009 | Ga0501081_1509009_101_427 | 105 |
| 604 | 3300049744 | Ga0501083_0086253 | Ga0501083_0086253_1518_1835 | 105 |
| 605 | 3300049822 | Ga0501035_0091548 | Ga0501035_0091548_71_388 | 105 |
| 606 | 3300049822 | Ga0501035_0760537 | Ga0501035_0760537_163_489 | 105 |
| 607 | 3300049823 | Ga0501044_0888318 | Ga0501044_0888318_428_745 | 105 |
| 608 | 3300050490 | nmdc:mga03n38_300102_c1 | nmdc:mga03n38_300102_c1_245_571 | 105 |
| 609 | 3300050492 | nmdc:mga0yw44_1045237_c1 | nmdc:mga0yw44_1045237_c1_17_340 | 105 |
| 610 | 3300050492 | nmdc:mga0yw44_1239015_c1 | nmdc:mga0yw44_1239015_c1_111_437 | 105 |
| 611 | 3300050492 | nmdc:mga0yw44_698944_c1 | nmdc:mga0yw44_698944_c1_31_357 | 105 |
| 612 | 3300050492 | nmdc:mga0yw44_798739_c1 | nmdc:mga0yw44_798739_c1_55_381 | 105 |
| 613 | 3300050507 | nmdc:mga05p37_543913_c1 | nmdc:mga05p37_543913_c1_715_1041 | 105 |
| 614 | 3300050507 | nmdc:mga05p37_815531_c1 | nmdc:mga05p37_815531_c1_319_639 | 105 |
| 615 | 3300050508 | nmdc:mga09592_38412_c1 | nmdc:mga09592_38412_c1_2739_3059 | 105 |
| 616 | 3300050509 | nmdc:mga0qj67_119451_c1 | nmdc:mga0qj67_119451_c1_856_1176 | 105 |
| 617 | 3300050510 | nmdc:mga06r32_82733_c1 | nmdc:mga06r32_82733_c1_226_546 | 105 |
| 618 | 3300050511 | nmdc:mga08y16_1396023_c1 | nmdc:mga08y16_1396023_c1_233_559 | 105 |
| 619 | 3300050511 | nmdc:mga08y16_270689_c1 | nmdc:mga08y16_270689_c1_695_1015 | 105 |
| 620 | 3300050512 | nmdc:mga0n895_189011_c1 | nmdc:mga0n895_189011_c1_190_510 | 105 |
| 621 | 3300050513 | nmdc:mga0rr50_40885_c1 | nmdc:mga0rr50_40885_c1_317_637 | 105 |
| 622 | 3300050513 | nmdc:mga0rr50_88314_c1 | nmdc:mga0rr50_88314_c1_1559_1879 | 105 |
| 623 | 3300050514 | nmdc:mga08x19_187071_c1 | nmdc:mga08x19_187071_c1_558_878 | 105 |
| 624 | 3300050514 | nmdc:mga08x19_41905_c1 | nmdc:mga08x19_41905_c1_2583_2903 | 105 |
| 625 | 3300050515 | nmdc:mga0a205_179499_c1 | nmdc:mga0a205_179499_c1_755_1075 | 105 |
| 626 | 3300050516 | nmdc:mga0sz30_15776_c1 | nmdc:mga0sz30_15776_c1_1849_2166 | 105 |
| 627 | 3300053077 | Ga0495601_0030907 | Ga0495601_0030907_969_1295 | 105 |
| 628 | 3300053078 | Ga0495612_0058802 | Ga0495612_0058802_606_932 | 105 |
| 629 | 3300053084 | Ga0495595_0063731 | Ga0495595_0063731_1123_1443 | 105 |
| 630 | 3300053084 | Ga0495595_0686740 | Ga0495595_0686740_166_492 | 105 |
| 631 | 3300053085 | Ga0495619_0001164 | Ga0495619_0001164_6847_7167 | 105 |
| 632 | 3300053085 | Ga0495619_0296822 | Ga0495619_0296822_636_962 | 105 |
| 633 | 3300053093 | Ga0500651_0630558 | Ga0500651_0630558_151_477 | 105 |
| 634 | 3300053104 | Ga0500556_0000636 | Ga0500556_0000636_21574_21897 | 105 |
| 635 | 3300053108 | Ga0500562_036758 | Ga0500562_036758_131_454 | 105 |
| 636 | 3300053153 | Ga0500616_0003259 | Ga0500616_0003259_8941_9264 | 105 |
| 637 | 3300053153 | Ga0500616_0065923 | Ga0500616_0065923_565_891 | 105 |
| 638 | 3300053730 | Ga0500645_115075 | Ga0500645_115075_188_511 | 105 |
| 639 | 3300054114 | Ga0501084_0039158 | Ga0501084_0039158_3576_3893 | 105 |
| 640 | 3300060353 | Ga0501082_1358039 | Ga0501082_1358039_187_513 | 105 |
| 641 | 3300061734 | Ga0530510_0712691 | Ga0530510_0712691_313_639 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9344 | 5 | 71 |
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.8955 | 5 | 103 |
| 5mmm-assembly1.cif.gz_V | structure of the 70s chloroplast ribosome | 0.883 | 5 | 105 |
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.8805 | 2 | 103 |
| 6eri-assembly1.cif.gz_AU | structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor | 0.8796 | 5 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q653V9_69_173_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9053 | 5 | 101 | 2.30.30.30 |
| 1nppD03 | Mainly Beta;Roll;SH3 type barrels.; | 0.9005 | 6 | 37 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.896 | 5 | 101 | 2.30.30.30 |
| af_Q8I5H8_47_152_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8929 | 5 | 100 | 2.30.30.30 |
| 3kbgA03 | Mainly Beta;Roll;SH3 type barrels.; | 0.8752 | 6 | 38 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1TDX0-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.944 | 5 | 72 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7X3XRY9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9394 | 1 | 73 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0L0LNB9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9362 | 5 | 71 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F6G6P1-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9356 | 4 | 76 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0L0LAE1-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9345 | 4 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar