F471789

General Info

Members Datasets Scaffolds Average Seq Length
641 195 1282 472

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10160866|Ga0207705_101608661
Length 539
Sequence MLALTDFSSRLIAWQRIHGRHDLPWQNTRDAYRIWLSEIMLQQTQVSTVIPYYARFLERFPTVTALADAPIDDVMALWAGLGYYSRARNLHRCAQVVAHEHGGAFPQTVDALAMLPGIVQASYAMPDAHWGYGFPIGGVAAFDPEQGGIVSAGGVGFDISCGVRTMLTGLKVAEILSVQKSLAESLFHQIPAGLGSTGAISLDPVDMDAMLTGGARWAVKRGWGEPRDLDRIEESGAMTGARPDCVSDKAKERQRCEMGTLGSGNHYLEVQAVAEIFDEAVAKRYGLTADDVVVAIHCGSRGLGHQIGTEFLREMAITAKDHGIDLPDRELACAPINSEVGQRYLGAMRAAINCALANREILGHFARRVFGHFFPSHTLDLLFDVSHNTCKVEPHTVAGKRRELFVHRKGATRAFGPGHPSLPATLRDVGQPVLIGGSMGTGSYILAGTASSEAKAFSSACHGAGRAMSRHAALRQWSGRQIQDDLAGHGVLIRSPSTRGIAEEAPGAYKDVNAVVRAAEAAGLASRVARLRPLVCIKG

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
109 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
110 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
111 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
112 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
113 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
189 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
190 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
191 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
192 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
193 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
194 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
195 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 1.25
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0.16
Rhizoplane 1.87
Rhizosphere 92.51
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10160866 3300025909 Bacteria 1687
2 MRS1b_contig_8047960 2162886011 Bacteria 2353
3 Ga0070658_10004889 3300005327 Bacteria 10919
4 Ga0070690_100081209 3300005330 Bacteria 2121
5 Ga0070689_100030721 3300005340 Bacteria 4079
6 Ga0070675_100013721 3300005354 Bacteria 6376
7 Ga0070675_100246393 3300005354 Unclassified 1562
8 Ga0070673_100012664 3300005364 Bacteria 5801
9 Ga0070667_100176376 3300005367 Bacteria 1889
10 Ga0070709_10007063 3300005434 Bacteria 6140
11 Ga0070710_10010896 3300005437 Bacteria 4478
12 Ga0070708_100008581 3300005445 Bacteria 8212
13 Ga0070708_100013522 3300005445 Bacteria 6687
14 Ga0070685_10020742 3300005466 Bacteria 3560
15 Ga0070706_100058310 3300005467 Bacteria 3564
16 Ga0070707_100008782 3300005468 Bacteria 9374
17 Ga0070707_100014660 3300005468 Bacteria 7346
18 Ga0070698_100003405 3300005471 Bacteria 17491
19 Ga0070679_100010641 3300005530 Bacteria 8729
20 Ga0070697_100085468 3300005536 Bacteria 2603
21 Ga0068855_100008858 3300005563 Bacteria 12164
22 Ga0068859_100006407 3300005617 Bacteria 11943
23 Ga0068863_100098029 3300005841 Bacteria 2784
24 Ga0068858_100016167 3300005842 Bacteria 7010
25 Ga0081455_10003630 3300005937 Bacteria 17680
26 Ga0081455_10006944 3300005937 Bacteria 12038
27 Ga0081538_10024102 3300005981 Unclassified 4346
28 Ga0081540_1000020 3300005983 Bacteria 163043
29 Ga0075363_100006958 3300006048 Bacteria 5171
30 Ga0075367_10008995 3300006178 Bacteria 5200
31 Ga0075370_10004843 3300006353 Bacteria 6599
32 Ga0075428_100016024 3300006844 Bacteria 8289
33 Ga0075430_100074341 3300006846 Bacteria 2850
34 Ga0075431_100010791 3300006847 Bacteria 9186
35 Ga0075434_100088693 3300006871 Bacteria 3094
36 Ga0075434_100117409 3300006871 Bacteria 2673
37 Ga0075429_100108587 3300006880 Bacteria 2425
38 Ga0075436_100000019 3300006914 Bacteria 130535
39 Ga0097620_100006407 3300006931 Bacteria 11943
40 Ga0075435_100008198 3300007076 Bacteria 7483
41 Ga0105240_10051816 3300009093 Bacteria 5163
42 Ga0111539_10001023 3300009094 Bacteria 36692
43 Ga0111539_10012127 3300009094 Bacteria 10814
44 Ga0111539_10096219 3300009094 Bacteria 3478
45 Ga0105245_10100132 3300009098 Bacteria 2681
46 Ga0114129_10004470 3300009147 Bacteria 19720
47 Ga0114129_10100794 3300009147 Bacteria 3996
48 Ga0114129_10143072 3300009147 Bacteria 3277
49 Ga0105242_10004225 3300009176 Bacteria 11198
50 Ga0105242_10024784 3300009176 Bacteria 4740
51 Ga0105248_10028672 3300009177 Bacteria 6203
52 Ga0105249_10223082 3300009553 Bacteria 1855
53 Ga0105028_100627 3300009993 Bacteria 3728
54 Ga0157374_10189292 3300013296 Bacteria 2012
55 Ga0163162_10031597 3300013306 Bacteria 5252
56 Ga0157372_10013066 3300013307 Bacteria 8858
57 Ga0157375_10125487 3300013308 Bacteria 2681
58 Ga0163163_10022037 3300014325 Bacteria 6024
59 Ga0157376_10025437 3300014969 Unclassified 4662
60 Ga0207697_10007564 3300025315 Bacteria 4832
61 Ga0207705_10006864 3300025909 Bacteria 8414
62 Ga0207684_10000459 3300025910 Bacteria 53056
63 Ga0207684_10113369 3300025910 Bacteria 2321
64 Ga0207695_10000950 3300025913 Bacteria 51579
65 Ga0207652_10026253 3300025921 Bacteria 4848
66 Ga0207646_10000181 3300025922 Bacteria 85931
67 Ga0207646_10015721 3300025922 Bacteria 7132
68 Ga0207646_10039381 3300025922 Bacteria 4255
69 Ga0207659_10000689 3300025926 Bacteria 20083
70 Ga0207687_10039816 3300025927 Bacteria 3219
71 Ga0207664_10096790 3300025929 Unclassified 2430
72 Ga0207665_10012174 3300025939 Bacteria 5649
73 Ga0207667_10348144 3300025949 Bacteria 1511
74 Ga0207708_10117440 3300026075 Bacteria 2070
75 Ga0207641_10072412 3300026088 Bacteria 2968
76 Ga0209983_1000175 3300027665 Bacteria 12216
77 Ga0209971_1002048 3300027682 Bacteria 4900
78 Ga0209974_10001813 3300027876 Bacteria 7786
79 Ga0207428_10003292 3300027907 Bacteria 15708
80 Ga0207428_10009426 3300027907 Bacteria 8750
81 Ga0265318_10038769 3300028577 Bacteria 1820
82 Ga0265323_10000073 3300028653 Bacteria 56131
83 Ga0265323_10001019 3300028653 Bacteria 14595
84 Ga0265323_10001989 3300028653 Bacteria 9647
85 Ga0265323_10006474 3300028653 Bacteria 4927
86 Ga0265322_10000007 3300028654 Unclassified 220234
87 Ga0265322_10000955 3300028654 Bacteria 10048
88 Ga0265338_10137897 3300028800 Bacteria 1914
89 Ga0265330_10000055 3300031235 Archaea 100805
90 Ga0265330_10003248 3300031235 Bacteria 8561
91 Ga0265330_10013478 3300031235 Bacteria 3809
92 Ga0265332_10002592 3300031238 Bacteria 9146
93 Ga0265332_10013375 3300031238 Bacteria 3637
94 Ga0265332_10060505 3300031238 Bacteria 1620
95 Ga0265329_10000814 3300031242 Bacteria 15877
96 Ga0265339_10004112 3300031249 Bacteria 10030
97 Ga0265331_10050925 3300031250 Bacteria 1984
98 Ga0265327_10025350 3300031251 Bacteria 3459
99 Ga0265316_10000065 3300031344 Bacteria 111353
100 Ga0265316_10001097 3300031344 Bacteria 29331
101 Ga0265316_10002098 3300031344 Archaea 20970
102 Ga0265316_10004575 3300031344 Bacteria 13727
103 Ga0265316_10010874 3300031344 Bacteria 8263
104 Ga0265316_10024941 3300031344 Bacteria 4998
105 Ga0265316_10067066 3300031344 Archaea 2775
106 Ga0265313_10011279 3300031595 Bacteria 5567
107 Ga0307508_10075169 3300031616 Bacteria 2956
108 Ga0316575_10002896 3300031665 Bacteria 5837
109 Ga0316575_10003778 3300031665 Bacteria 5267
110 Ga0316575_10014213 3300031665 Bacteria 2985
111 Ga0316575_10019629 3300031665 Unclassified 2587
112 Ga0316579_10000166 3300031691 Bacteria 19057
113 Ga0316579_10000293 3300031691 Bacteria 15342
114 Ga0316579_10000864 3300031691 Bacteria 10498
115 Ga0316579_10000989 3300031691 Bacteria 9969
116 Ga0316579_10000990 3300031691 Bacteria 9961
117 Ga0316579_10005840 3300031691 Bacteria 4990
118 Ga0316579_10010873 3300031691 Bacteria 3857
119 Ga0316579_10061570 3300031691 Bacteria 1767
120 Ga0265342_10000015 3300031712 Archaea 194661
121 Ga0265342_10000150 3300031712 Bacteria 78890
122 Ga0265342_10006248 3300031712 Bacteria 8895
123 Ga0265342_10032100 3300031712 Unclassified 3240
124 Ga0265342_10045672 3300031712 Bacteria 2636
125 Ga0316576_10004888 3300031727 Bacteria 8102
126 Ga0316576_10006621 3300031727 Bacteria 7235
127 Ga0316576_10006838 3300031727 Bacteria 7128
128 Ga0316576_10018088 3300031727 Archaea 4804
129 Ga0316576_10018426 3300031727 Bacteria 4768
130 Ga0316576_10133050 3300031727 Bacteria 1871
131 Ga0316576_10150330 3300031727 Bacteria 1755
132 Ga0316578_10001761 3300031728 Bacteria 9076
133 Ga0316578_10005865 3300031728 Archaea 6008
134 Ga0316578_10039220 3300031728 Bacteria 2735
135 Ga0316578_10039296 3300031728 Bacteria 2733
136 Ga0316578_10045628 3300031728 Unclassified 2552
137 Ga0316578_10094941 3300031728 Bacteria 1784
138 Ga0316577_10000949 3300031733 Bacteria 12891
139 Ga0316577_10001028 3300031733 Bacteria 12579
140 Ga0316577_10005530 3300031733 Bacteria 6630
141 Ga0316577_10009273 3300031733 Bacteria 5292
142 Ga0316577_10027317 3300031733 Unclassified 3182
143 Ga0307410_10005267 3300031852 Bacteria 6820
144 Ga0316583_10005010 3300032133 Bacteria 4738
145 Ga0316583_10008613 3300032133 Bacteria 3679
146 Ga0316583_10009536 3300032133 Bacteria 3496
147 Ga0316583_10021936 3300032133 Bacteria 2289
148 Ga0316583_10027738 3300032133 Bacteria 2021
149 Ga0316585_10000025 3300032137 Bacteria 22134
150 Ga0316585_10002790 3300032137 Bacteria 4746
151 Ga0316585_10016992 3300032137 Bacteria 2196
152 Ga0316585_10017763 3300032137 Bacteria 2153
153 Ga0316585_10030039 3300032137 Bacteria 1704
154 Ga0316580_10000932 3300032139 Bacteria 7233
155 Ga0316580_10005592 3300032139 Bacteria 3676
156 Ga0316593_10002127 3300032168 Bacteria 4607
157 Ga0316593_10004749 3300032168 Bacteria 3520
158 Ga0316593_10005938 3300032168 Bacteria 3262
159 Ga0316593_10010842 3300032168 Bacteria 2630
160 Ga0316593_10023880 3300032168 Bacteria 1934
161 Ga0316587_1004170 3300033529 Bacteria 2086
162 Ga0316596_1002037 3300033541 Bacteria 4255
163 Ga0316596_1005522 3300033541 Bacteria 2893
164 Ga0373934_0003943 3300035086 Bacteria 5455
165 Ga0373952_0001800 3300035092 Bacteria 3902
166 Ga0373956_0019169 3300035119 Bacteria 2900
167 Ga0373957_0001612 3300035120 Bacteria 6173
168 Ga0373960_0021933 3300035121 Bacteria 1704
169 Ga0316574_0000973 3300035398 Bacteria 12833
170 Ga0316574_0005946 3300035398 Bacteria 6547
171 Ga0316574_0006951 3300035398 Bacteria 6161
172 Ga0316574_0031387 3300035398 Bacteria 3222
173 Ga0316574_0031466 3300035398 Bacteria 3218
174 Ga0316574_0043997 3300035398 Bacteria 2761
175 Ga0316574_0048674 3300035398 Unclassified 2633
176 Ga0316574_0053846 3300035398 Bacteria 2513
177 Ga0316574_0062607 3300035398 Bacteria 2338
178 Ga0316574_0106134 3300035398 Bacteria 1799
179 Ga0373927_0015791 3300035695 Bacteria 4982
180 Ga0373947_0053832 3300035725 Bacteria 2428
181 Ga0373937_0024126 3300036401 Bacteria 5484
182 Ga0373937_0024179 3300036401 Bacteria 5476
183 Ga0373937_0052171 3300036401 Bacteria 3749
184 Ga0373937_0097519 3300036401 Bacteria 2727
185 Ga0373937_0160676 3300036401 Bacteria 2106
186 Ga0316582_0000356 3300036647 Bacteria 16270
187 Ga0316582_0001718 3300036647 Bacteria 9839
188 Ga0316582_0003249 3300036647 Bacteria 7923
189 Ga0316582_0005122 3300036647 Bacteria 6706
190 Ga0316582_0024663 3300036647 Bacteria 3601
191 Ga0316582_0038903 3300036647 Bacteria 2959
192 Ga0316582_0039373 3300036647 Unclassified 2943
193 Ga0316582_0059072 3300036647 Bacteria 2454
194 Ga0316582_0064843 3300036647 Bacteria 2351
195 Ga0316582_0098645 3300036647 Unclassified 1932
196 Ga0316582_0112161 3300036647 Bacteria 1816
197 Ga0316582_0118033 3300036647 Bacteria 1773
198 Ga0316584_0003331 3300036712 Bacteria 10410
199 Ga0316584_0004879 3300036712 Bacteria 8923
200 Ga0316584_0006375 3300036712 Bacteria 7988
201 Ga0316584_0011104 3300036712 Bacteria 6317
202 Ga0316584_0012362 3300036712 Bacteria 6019
203 Ga0316584_0027363 3300036712 Bacteria 4196
204 Ga0316584_0047161 3300036712 Archaea 3218
205 Ga0316584_0059457 3300036712 Bacteria 2862
206 Ga0316584_0077805 3300036712 Bacteria 2484
207 Ga0316584_0086089 3300036712 Bacteria 2353
208 Ga0316584_0101411 3300036712 Bacteria 2155
209 Ga0316584_0169691 3300036712 Bacteria 1619
210 Ga0316584_0191075 3300036712 Bacteria 1513
211 Ga0373925_0036695 3300037068 Unclassified 3617
212 Ga0395905_0003645 3300037471 Bacteria 16340
213 Ga0395905_0005298 3300037471 Bacteria 13187
214 Ga0395905_0021681 3300037471 Bacteria 6076
215 Ga0395905_0113847 3300037471 Bacteria 2542
216 Ga0316581_0000143 3300037588 Bacteria 10876
217 Ga0316581_0000637 3300037588 Bacteria 7012
218 Ga0316581_0003584 3300037588 Bacteria 3882
219 Ga0316581_0007401 3300037588 Bacteria 2944
220 Ga0316581_0017944 3300037588 Bacteria 2049
221 Ga0436364_0825120 3300037853 Bacteria 1626
222 Ga0395901_0234310 3300038443 Bacteria 1916
223 Ga0400484_01676 3300038725 Bacteria 14350
224 Ga0400484_08406 3300038725 Bacteria 6065
225 Ga0400484_18920 3300038725 Bacteria 4712
226 Ga0400484_27283 3300038725 Bacteria 9197
227 Ga0400490_06783 3300038726 Bacteria 58124
228 Ga0400490_23886 3300038726 Bacteria 10943
229 Ga0400490_35312 3300038726 Bacteria 15881
230 Ga0400490_36248 3300038726 Bacteria 5981
231 Ga0400490_49656 3300038726 Bacteria 13207
232 Ga0400488_12502 3300038741 Bacteria 9452
233 Ga0400488_17517 3300038741 Bacteria 2298
234 Ga0400488_18217 3300038741 Bacteria 3681
235 Ga0400488_25323 3300038741 Bacteria 17232
236 Ga0400488_40260 3300038741 Bacteria 3237
237 Ga0400488_52751 3300038741 Bacteria 2770
238 Ga0400483_016805 3300039062 Bacteria 1698
239 Ga0400483_082705 3300039062 Bacteria 32964
240 Ga0400483_154823 3300039062 Bacteria 6367
241 Ga0400483_174128 3300039062 Bacteria 30099
242 Ga0400489_64474 3300039093 Bacteria 10604
243 Ga0400487_00787 3300039110 Bacteria 2334
244 Ga0400487_31940 3300039110 Bacteria 9979
245 Ga0400487_47978 3300039110 Bacteria 63574
246 Ga0400487_48386 3300039110 Bacteria 7222
247 Ga0436361_0066522 3300039447 Bacteria 6750
248 Ga0439461_0012904 3300041410 Bacteria 1569
249 Ga0451577_0000414 3300042876 Bacteria 77382
250 Ga0451577_0001699 3300042876 Bacteria 28417
251 Ga0451577_0006478 3300042876 Bacteria 11664
252 Ga0451577_0007558 3300042876 Bacteria 10657
253 Ga0451577_0008010 3300042876 Bacteria 10314
254 Ga0451577_0023211 3300042876 Bacteria 5660
255 Ga0451577_0049624 3300042876 Bacteria 3747
256 Ga0451577_0107540 3300042876 Bacteria 2493
257 Ga0451577_0310983 3300042876 Unclassified 1428
258 Ga0453683_0000002 3300044673 Bacteria 1244396
259 Ga0453683_0002951 3300044673 Bacteria 12784
260 Ga0453683_0028624 3300044673 Bacteria 3526
261 Ga0453684_0000013 3300044712 Archaea 1034059
262 Ga0453684_0000145 3300044712 Archaea 313029
263 Ga0453684_0000221 3300044712 Bacteria 249908
264 Ga0453684_0000878 3300044712 Bacteria 100519
265 Ga0453684_0001238 3300044712 Bacteria 77801
266 Ga0453684_0003182 3300044712 Bacteria 37655
267 Ga0453684_0004004 3300044712 Bacteria 32120
268 Ga0453684_0005036 3300044712 Archaea 26800
269 Ga0453684_0008912 3300044712 Bacteria 17765
270 Ga0453684_0014929 3300044712 Bacteria 12349
271 Ga0453684_0033213 3300044712 Bacteria 7198
272 Ga0453684_0034436 3300044712 Bacteria 7030
273 Ga0453684_0043670 3300044712 Archaea 6020
274 Ga0453684_0050507 3300044712 Archaea 5469
275 Ga0453684_0051205 3300044712 Bacteria 5417
276 Ga0453684_0055057 3300044712 Bacteria 5174
277 Ga0453684_0105569 3300044712 Bacteria 3435
278 Ga0453684_0181245 3300044712 Bacteria 2472
279 Ga0453684_0193280 3300044712 Bacteria 2379
280 Ga0453684_0214430 3300044712 Bacteria 2235
281 Ga0451576_0013721 3300045051 Bacteria 9051
282 Ga0451576_0021456 3300045051 Bacteria 7019
283 Ga0451576_0029238 3300045051 Bacteria 5897
284 Ga0451576_0033338 3300045051 Bacteria 5474
285 Ga0451576_0045391 3300045051 Bacteria 4628
286 Ga0451576_0051215 3300045051 Bacteria 4329
287 Ga0451576_0074789 3300045051 Archaea 3525
288 Ga0451576_0084708 3300045051 Bacteria 3298
289 Ga0495653_0055687 3300046463 Bacteria 3017
290 Ga0495580_0020878 3300046472 Bacteria 4839
291 Ga0495580_0028432 3300046472 Bacteria 4063
292 Ga0495580_0049799 3300046472 Unclassified 2963
293 Ga0495580_0052533 3300046472 Bacteria 2878
294 Ga0495662_0042344 3300046476 Bacteria 2198
295 Ga0495664_0012981 3300046477 Bacteria 4722
296 Ga0495628_0045296 3300046516 Bacteria 3499
297 Ga0495587_0013171 3300046536 Bacteria 5200
298 Ga0495587_0015955 3300046536 Bacteria 4677
299 Ga0495645_0016325 3300046543 Bacteria 5300
300 Ga0495645_0108592 3300046543 Bacteria 1965
301 Ga0495667_0028473 3300046559 Bacteria 3762
302 Ga0495667_0044207 3300046559 Bacteria 2951
303 Ga0495634_0031236 3300046642 Bacteria 3670
304 Ga0495588_0013687 3300046674 Bacteria 3868
305 Ga0495599_0005304 3300046678 Bacteria 7690
306 Ga0495636_0013233 3300047318 Bacteria 3273
307 Ga0495675_0011807 3300047444 Bacteria 5487
308 Ga0495684_0065988 3300047471 Bacteria 2752
309 Ga0495602_0001002 3300048088 Bacteria 27473
310 Ga0495602_0064063 3300048088 Bacteria 3181
311 Ga0495602_0066802 3300048088 Bacteria 3097
312 Ga0496103_0021696 3300048906 Bacteria 3864
313 Ga0496104_0006789 3300048907 Bacteria 10080
314 Ga0496105_0017835 3300048908 Bacteria 5695
315 Ga0496106_0038857 3300048909 Bacteria 3563
316 Ga0496108_0021010 3300048911 Bacteria 5366
317 Ga0496109_0000047 3300048912 Bacteria 130578
318 Ga0496109_0001209 3300048912 Bacteria 21496
319 Ga0496110_0013085 3300048913 Bacteria 6848
320 Ga0496110_0202852 3300048913 Bacteria 1802
321 Ga0496111_0037273 3300048914 Bacteria 3479
322 Ga0496112_0055095 3300048915 Bacteria 3909
323 Ga0496113_0005079 3300048916 Bacteria 8171
324 Ga0501031_0023822 3300049568 Bacteria 3991
325 Ga0501033_0130496 3300049570 Bacteria 1821
326 Ga0501034_0111141 3300049571 Bacteria 2731
327 Ga0501034_0268895 3300049571 Bacteria 1646
328 Ga0501036_0014601 3300049572 Bacteria 6542
329 Ga0501036_0029637 3300049572 Bacteria 4622
330 Ga0501036_0132597 3300049572 Bacteria 2103
331 Ga0501036_0170092 3300049572 Bacteria 1836
332 Ga0501037_0009990 3300049573 Bacteria 6962
333 Ga0501037_0045239 3300049573 Bacteria 3232
334 Ga0501037_0063574 3300049573 Bacteria 2690
335 Ga0501037_0072399 3300049573 Bacteria 2507
336 Ga0501037_0137617 3300049573 Bacteria 1749
337 Ga0501038_0006798 3300049574 Bacteria 10564
338 Ga0501038_0013327 3300049574 Bacteria 7499
339 Ga0501038_0017555 3300049574 Bacteria 6470
340 Ga0501038_0032265 3300049574 Bacteria 4622
341 Ga0501038_0084207 3300049574 Bacteria 2676
342 Ga0501039_0001276 3300049575 Bacteria 18409
343 Ga0501039_0004339 3300049575 Bacteria 10692
344 Ga0501039_0004381 3300049575 Bacteria 10645
345 Ga0501039_0015321 3300049575 Bacteria 5868
346 Ga0501039_0018654 3300049575 Bacteria 5327
347 Ga0501039_0028786 3300049575 Bacteria 4278
348 Ga0501039_0052445 3300049575 Bacteria 3156
349 Ga0501039_0054129 3300049575 Bacteria 3106
350 Ga0501039_0061015 3300049575 Bacteria 2920
351 Ga0501039_0103182 3300049575 Bacteria 2226
352 Ga0501039_0115197 3300049575 Bacteria 2104
353 Ga0501040_0001422 3300049576 Bacteria 15149
354 Ga0501040_0004172 3300049576 Bacteria 9402
355 Ga0501040_0005609 3300049576 Bacteria 8112
356 Ga0501040_0010747 3300049576 Bacteria 5986
357 Ga0501040_0010924 3300049576 Bacteria 5937
358 Ga0501040_0013441 3300049576 Bacteria 5380
359 Ga0501040_0017631 3300049576 Bacteria 4740
360 Ga0501040_0021983 3300049576 Bacteria 4265
361 Ga0501040_0048994 3300049576 Bacteria 2888
362 Ga0501040_0049012 3300049576 Bacteria 2887
363 Ga0501040_0050120 3300049576 Bacteria 2855
364 Ga0501040_0076377 3300049576 Bacteria 2316
365 Ga0501040_0079021 3300049576 Bacteria 2277
366 Ga0501040_0084077 3300049576 Bacteria 2207
367 Ga0501040_0093540 3300049576 Bacteria 2091
368 Ga0501041_0000482 3300049577 Bacteria 20320
369 Ga0501041_0000676 3300049577 Bacteria 18062
370 Ga0501041_0007704 3300049577 Bacteria 6320
371 Ga0501041_0013379 3300049577 Bacteria 4863
372 Ga0501041_0014179 3300049577 Bacteria 4731
373 Ga0501041_0020914 3300049577 Bacteria 3918
374 Ga0501041_0045060 3300049577 Bacteria 2681
375 Ga0501041_0072757 3300049577 Bacteria 2112
376 Ga0501041_0073651 3300049577 Bacteria 2098
377 Ga0501041_0105216 3300049577 Bacteria 1749
378 Ga0501042_0001913 3300049578 Bacteria 12518
379 Ga0501042_0003208 3300049578 Bacteria 10217
380 Ga0501042_0014815 3300049578 Bacteria 5326
381 Ga0501042_0015327 3300049578 Bacteria 5248
382 Ga0501042_0015948 3300049578 Bacteria 5153
383 Ga0501042_0015997 3300049578 Bacteria 5146
384 Ga0501042_0048721 3300049578 Bacteria 3021
385 Ga0501042_0055949 3300049578 Bacteria 2815
386 Ga0501042_0062444 3300049578 Bacteria 2662
387 Ga0501042_0141441 3300049578 Bacteria 1735
388 Ga0501042_0172461 3300049578 Unclassified 1561
389 Ga0501043_0066285 3300049579 Bacteria 2835
390 Ga0501043_0090305 3300049579 Bacteria 2408
391 Ga0501046_0003726 3300049580 Bacteria 13951
392 Ga0501046_0013943 3300049580 Bacteria 6788
393 Ga0501046_0026833 3300049580 Bacteria 4704
394 Ga0501046_0035135 3300049580 Bacteria 4040
395 Ga0501046_0050820 3300049580 Bacteria 3273
396 Ga0501046_0050891 3300049580 Bacteria 3271
397 Ga0501046_0055612 3300049580 Bacteria 3108
398 Ga0501046_0062351 3300049580 Bacteria 2913
399 Ga0501046_0065764 3300049580 Bacteria 2828
400 Ga0501047_0218155 3300049581 Bacteria 1764
401 Ga0501048_0002429 3300049582 Bacteria 14224
402 Ga0501048_0004200 3300049582 Bacteria 10981
403 Ga0501048_0007038 3300049582 Bacteria 8542
404 Ga0501048_0010323 3300049582 Bacteria 6982
405 Ga0501048_0024563 3300049582 Bacteria 4398
406 Ga0501048_0025781 3300049582 Bacteria 4283
407 Ga0501048_0036557 3300049582 Bacteria 3529
408 Ga0501048_0040282 3300049582 Bacteria 3349
409 Ga0501068_0006276 3300049584 Bacteria 6543
410 Ga0501068_0013285 3300049584 Bacteria 4683
411 Ga0501068_0020291 3300049584 Bacteria 3869
412 Ga0501068_0037001 3300049584 Bacteria 2921
413 Ga0501068_0122223 3300049584 Bacteria 1624
414 Ga0501068_0147370 3300049584 Bacteria 1478
415 Ga0501070_0039698 3300049586 Bacteria 3924
416 Ga0501070_0048378 3300049586 Bacteria 3533
417 Ga0501070_0106122 3300049586 Bacteria 2322
418 Ga0501070_0177966 3300049586 Bacteria 1751
419 Ga0501070_0234506 3300049586 Bacteria 1503
420 Ga0501071_0000406 3300049587 Bacteria 21324
421 Ga0501071_0001835 3300049587 Bacteria 12600
422 Ga0501071_0002666 3300049587 Bacteria 10931
423 Ga0501071_0002865 3300049587 Bacteria 10633
424 Ga0501071_0011064 3300049587 Bacteria 6063
425 Ga0501071_0015995 3300049587 Bacteria 5155
426 Ga0501071_0021892 3300049587 Bacteria 4456
427 Ga0501071_0039906 3300049587 Bacteria 3359
428 Ga0501071_0064155 3300049587 Bacteria 2665
429 Ga0501071_0083695 3300049587 Bacteria 2337
430 Ga0501071_0225341 3300049587 Bacteria 1412
431 Ga0501072_0001254 3300049588 Bacteria 18957
432 Ga0501072_0004898 3300049588 Bacteria 10184
433 Ga0501072_0006201 3300049588 Bacteria 9103
434 Ga0501072_0007233 3300049588 Bacteria 8425
435 Ga0501072_0008012 3300049588 Bacteria 8018
436 Ga0501072_0011520 3300049588 Bacteria 6758
437 Ga0501072_0031772 3300049588 Bacteria 4133
438 Ga0501072_0052148 3300049588 Bacteria 3220
439 Ga0501072_0052815 3300049588 Bacteria 3200
440 Ga0501072_0064640 3300049588 Bacteria 2885
441 Ga0501072_0118883 3300049588 Bacteria 2106
442 Ga0501072_0143957 3300049588 Bacteria 1901
443 Ga0501072_0181179 3300049588 Bacteria 1680
444 Ga0501073_0035587 3300049589 Bacteria 3538
445 Ga0501073_0090262 3300049589 Bacteria 2130
446 Ga0501073_0146128 3300049589 Bacteria 1638
447 Ga0501074_0084886 3300049590 Bacteria 2269
448 Ga0501074_0088954 3300049590 Bacteria 2211
449 Ga0501074_0104586 3300049590 Bacteria 2027
450 Ga0501074_0107727 3300049590 Bacteria 1995
451 Ga0501074_0109985 3300049590 Bacteria 1972
452 Ga0501074_0185134 3300049590 Bacteria 1485
453 Ga0501075_0000650 3300049591 Bacteria 21307
454 Ga0501075_0002465 3300049591 Bacteria 12340
455 Ga0501075_0003152 3300049591 Bacteria 11040
456 Ga0501075_0005765 3300049591 Bacteria 8472
457 Ga0501075_0013492 3300049591 Bacteria 5832
458 Ga0501075_0014545 3300049591 Bacteria 5640
459 Ga0501075_0014668 3300049591 Bacteria 5615
460 Ga0501075_0016143 3300049591 Bacteria 5374
461 Ga0501075_0031518 3300049591 Bacteria 3935
462 Ga0501075_0034044 3300049591 Bacteria 3792
463 Ga0501075_0049686 3300049591 Bacteria 3152
464 Ga0501075_0055417 3300049591 Bacteria 2983
465 Ga0501075_0077140 3300049591 Bacteria 2521
466 Ga0501075_0111928 3300049591 Bacteria 2076
467 Ga0501075_0113439 3300049591 Bacteria 2061
468 Ga0501075_0119990 3300049591 Bacteria 2001
469 Ga0501075_0135409 3300049591 Bacteria 1877
470 Ga0501075_0149961 3300049591 Bacteria 1777
471 Ga0501076_0001813 3300049592 Bacteria 14502
472 Ga0501076_0003028 3300049592 Bacteria 11678
473 Ga0501076_0004161 3300049592 Bacteria 10238
474 Ga0501076_0010003 3300049592 Bacteria 7017
475 Ga0501076_0013859 3300049592 Bacteria 6053
476 Ga0501076_0022639 3300049592 Bacteria 4831
477 Ga0501076_0025965 3300049592 Bacteria 4534
478 Ga0501076_0028797 3300049592 Bacteria 4316
479 Ga0501076_0033746 3300049592 Bacteria 3996
480 Ga0501076_0039860 3300049592 Bacteria 3689
481 Ga0501076_0048975 3300049592 Bacteria 3340
482 Ga0501076_0057328 3300049592 Bacteria 3092
483 Ga0501076_0069562 3300049592 Bacteria 2813
484 Ga0501076_0122674 3300049592 Archaea 2104
485 Ga0501076_0124622 3300049592 Bacteria 2087
486 Ga0501076_0134466 3300049592 Bacteria 2007
487 Ga0501076_0143731 3300049592 Bacteria 1939
488 Ga0501076_0145667 3300049592 Bacteria 1926
489 Ga0501077_0001435 3300049593 Bacteria 14326
490 Ga0501077_0002170 3300049593 Bacteria 11857
491 Ga0501077_0003187 3300049593 Bacteria 9885
492 Ga0501077_0004571 3300049593 Bacteria 8412
493 Ga0501077_0007707 3300049593 Bacteria 6644
494 Ga0501077_0024131 3300049593 Bacteria 3860
495 Ga0501077_0050007 3300049593 Bacteria 2657
496 Ga0501077_0051971 3300049593 Unclassified 2603
497 Ga0501077_0052925 3300049593 Bacteria 2577
498 Ga0501077_0059422 3300049593 Bacteria 2427
499 Ga0501077_0063493 3300049593 Bacteria 2343
500 Ga0501077_0069893 3300049593 Bacteria 2225
501 Ga0501077_0101969 3300049593 Bacteria 1819
502 Ga0501079_0002043 3300049741 Bacteria 14458
503 Ga0501079_0004586 3300049741 Bacteria 10247
504 Ga0501079_0004615 3300049741 Bacteria 10205
505 Ga0501079_0005137 3300049741 Bacteria 9729
506 Ga0501079_0006411 3300049741 Bacteria 8832
507 Ga0501079_0010249 3300049741 Bacteria 7116
508 Ga0501079_0018538 3300049741 Bacteria 5317
509 Ga0501079_0020293 3300049741 Bacteria 5078
510 Ga0501079_0023697 3300049741 Bacteria 4709
511 Ga0501079_0030145 3300049741 Bacteria 4168
512 Ga0501079_0047815 3300049741 Bacteria 3301
513 Ga0501079_0048524 3300049741 Unclassified 3276
514 Ga0501079_0049394 3300049741 Bacteria 3246
515 Ga0501079_0053042 3300049741 Bacteria 3129
516 Ga0501079_0053164 3300049741 Bacteria 3125
517 Ga0501079_0063551 3300049741 Bacteria 2848
518 Ga0501079_0065267 3300049741 Bacteria 2808
519 Ga0501079_0078525 3300049741 Bacteria 2553
520 Ga0501079_0082134 3300049741 Bacteria 2492
521 Ga0501079_0083135 3300049741 Bacteria 2477
522 Ga0501080_0000674 3300049742 Bacteria 27220
523 Ga0501080_0002727 3300049742 Bacteria 15489
524 Ga0501080_0028871 3300049742 Bacteria 5164
525 Ga0501080_0110872 3300049742 Bacteria 2543
526 Ga0501080_0121025 3300049742 Bacteria 2425
527 Ga0501080_0138724 3300049742 Bacteria 2249
528 Ga0501080_0143125 3300049742 Bacteria 2211
529 Ga0501080_0190574 3300049742 Bacteria 1884
530 Ga0501081_0000335 3300049743 Bacteria 25267
531 Ga0501081_0001131 3300049743 Bacteria 16076
532 Ga0501081_0001234 3300049743 Bacteria 15556
533 Ga0501081_0004000 3300049743 Bacteria 9449
534 Ga0501081_0004706 3300049743 Bacteria 8775
535 Ga0501081_0012882 3300049743 Bacteria 5500
536 Ga0501081_0013015 3300049743 Bacteria 5472
537 Ga0501081_0013065 3300049743 Bacteria 5461
538 Ga0501081_0016164 3300049743 Bacteria 4929
539 Ga0501081_0023366 3300049743 Bacteria 4143
540 Ga0501081_0025535 3300049743 Bacteria 3974
541 Ga0501081_0027108 3300049743 Bacteria 3867
542 Ga0501081_0042765 3300049743 Bacteria 3106
543 Ga0501081_0056381 3300049743 Bacteria 2715
544 Ga0501081_0063666 3300049743 Unclassified 2560
545 Ga0501081_0121343 3300049743 Bacteria 1862
546 Ga0501081_0128686 3300049743 Bacteria 1808
547 Ga0501081_0128741 3300049743 Bacteria 1807
548 Ga0501081_0153177 3300049743 Bacteria 1657
549 Ga0501083_0019176 3300049744 Bacteria 4764
550 Ga0501083_0033682 3300049744 Bacteria 3506
551 Ga0501083_0044104 3300049744 Bacteria 3019
552 Ga0501083_0067683 3300049744 Bacteria 2377
553 Ga0501083_0075078 3300049744 Bacteria 2246
554 Ga0501035_0021624 3300049822 Bacteria 5915
555 Ga0501035_0033320 3300049822 Bacteria 4685
556 Ga0501035_0063219 3300049822 Bacteria 3293
557 Ga0501035_0083241 3300049822 Bacteria 2823
558 Ga0501035_0147899 3300049822 Bacteria 2040
559 Ga0501035_0210367 3300049822 Bacteria 1664
560 Ga0501035_0223554 3300049822 Bacteria 1607
561 Ga0501035_0299987 3300049822 Bacteria 1354
562 Ga0501044_0021419 3300049823 Bacteria 6896
563 Ga0501044_0108535 3300049823 Bacteria 2785
564 Ga0501044_0284001 3300049823 Bacteria 1588
565 Ga0501045_0003719 3300049824 Bacteria 10495
566 Ga0501045_0004151 3300049824 Bacteria 10009
567 Ga0501045_0016152 3300049824 Bacteria 5298
568 Ga0501045_0022927 3300049824 Bacteria 4473
569 Ga0501045_0031167 3300049824 Bacteria 3861
570 Ga0501045_0034864 3300049824 Bacteria 3653
571 Ga0501045_0043777 3300049824 Bacteria 3260
572 Ga0501045_0052474 3300049824 Unclassified 2977
573 Ga0501045_0054099 3300049824 Bacteria 2934
574 Ga0501045_0063084 3300049824 Bacteria 2719
575 Ga0501045_0113884 3300049824 Bacteria 2006
576 Ga0501045_0141377 3300049824 Bacteria 1790
577 Ga0501045_0157885 3300049824 Bacteria 1688
578 Ga0501045_0165630 3300049824 Bacteria 1646
579 Ga0501045_0189087 3300049824 Bacteria 1534
580 Ga0501045_0197705 3300049824 Bacteria 1498
581 Ga0501045_0223780 3300049824 Bacteria 1401
582 nmdc:mga06z11_8841_c1 3300050494 Bacteria 4219
583 nmdc:mga07m45_6960_c1 3300050496 Bacteria 5751
584 nmdc:mga05p37_117050_c1 3300050507 Bacteria 3275
585 nmdc:mga09592_169907_c1 3300050508 Bacteria 1885
586 nmdc:mga08y16_3835_c1 3300050511 Bacteria 15645
587 nmdc:mga08y16_58106_c1 3300050511 Bacteria 4041
588 nmdc:mga08y16_6655_c1 3300050511 Bacteria 12124
589 nmdc:mga0n895_31434_c1 3300050512 Bacteria 5084
590 nmdc:mga0n895_99690_c1 3300050512 Bacteria 2913
591 nmdc:mga0rr50_11041_c1 3300050513 Bacteria 5761
592 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
593 nmdc:mga0a205_274359_c1 3300050515 Bacteria 1563
594 Ga0495601_0016010 3300053077 Bacteria 4537
595 Ga0495601_0023906 3300053077 Bacteria 3759
596 Ga0501084_0002129 3300054114 Bacteria 15834
597 Ga0501084_0002514 3300054114 Bacteria 14765
598 Ga0501084_0003981 3300054114 Bacteria 12034
599 Ga0501084_0012454 3300054114 Bacteria 7050
600 Ga0501084_0012710 3300054114 Bacteria 6974
601 Ga0501084_0032854 3300054114 Unclassified 4342
602 Ga0501084_0045859 3300054114 Bacteria 3659
603 Ga0501084_0061271 3300054114 Bacteria 3150
604 Ga0501084_0172762 3300054114 Bacteria 1824
605 Ga0501082_0003503 3300060353 Bacteria 13698
606 Ga0501082_0004420 3300060353 Bacteria 12276
607 Ga0501082_0008168 3300060353 Bacteria 9031
608 Ga0501082_0009470 3300060353 Bacteria 8386
609 Ga0501082_0014387 3300060353 Bacteria 6808
610 Ga0501082_0014741 3300060353 Bacteria 6730
611 Ga0501082_0024288 3300060353 Bacteria 5225
612 Ga0501082_0026302 3300060353 Bacteria 5014
613 Ga0501082_0038809 3300060353 Bacteria 4107
614 Ga0501082_0051330 3300060353 Bacteria 3555
615 Ga0501082_0060384 3300060353 Bacteria 3265
616 Ga0501082_0077646 3300060353 Bacteria 2863
617 Ga0501082_0091729 3300060353 Bacteria 2623
618 Ga0501082_0096072 3300060353 Bacteria 2562
619 Ga0501082_0152364 3300060353 Bacteria 2008
620 Ga0501082_0188243 3300060353 Bacteria 1796
621 Ga0530510_0000441 3300061734 Bacteria 26789
622 Ga0530510_0013312 3300061734 Bacteria 5782
623 Ga0530510_0013387 3300061734 Bacteria 5767
624 Ga0530510_0016399 3300061734 Bacteria 5244
625 Ga0530510_0025584 3300061734 Bacteria 4221
626 Ga0530510_0026304 3300061734 Bacteria 4164
627 Ga0530510_0035583 3300061734 Bacteria 3589
628 Ga0530510_0037015 3300061734 Bacteria 3516
629 Ga0530510_0038272 3300061734 Bacteria 3463
630 Ga0530510_0040533 3300061734 Archaea 3361
631 Ga0530510_0102263 3300061734 Bacteria 2095
632 Ga0530510_0145460 3300061734 Bacteria 1748
633 Ga0530510_0146174 3300061734 Bacteria 1744
634 2688067381 2687453257 Bacteria 6784659
635 2889419421 2889415604 Bacteria 8048700
636 2891634103 2891633521 Bacteria 4602265
637 2896389530 2896384573 Bacteria 7700774
638 2906633149 2906626472 Bacteria 8826946
639 2920113085 2920107658 Bacteria 10042636
640 8001523855 8001522603 Bacteria 4726425
641 8016585990 8016583857 Bacteria 10421953
642 Ga0207705_10160866
643 MRS1b_contig_8047960
644 Ga0070658_10004889
645 Ga0070690_100081209
646 Ga0070689_100030721
647 Ga0070675_100013721
648 Ga0070675_100246393
649 Ga0070673_100012664
650 Ga0070667_100176376
651 Ga0070709_10007063
652 Ga0070710_10010896
653 Ga0070708_100008581
654 Ga0070708_100013522
655 Ga0070685_10020742
656 Ga0070706_100058310
657 Ga0070707_100008782
658 Ga0070707_100014660
659 Ga0070698_100003405
660 Ga0070679_100010641
661 Ga0070697_100085468
662 Ga0068855_100008858
663 Ga0068859_100006407
664 Ga0068863_100098029
665 Ga0068858_100016167
666 Ga0081455_10003630
667 Ga0081455_10006944
668 Ga0081538_10024102
669 Ga0081540_1000020
670 Ga0075363_100006958
671 Ga0075367_10008995
672 Ga0075370_10004843
673 Ga0075428_100016024
674 Ga0075430_100074341
675 Ga0075431_100010791
676 Ga0075434_100088693
677 Ga0075434_100117409
678 Ga0075429_100108587
679 Ga0075436_100000019
680 Ga0097620_100006407
681 Ga0075435_100008198
682 Ga0105240_10051816
683 Ga0111539_10001023
684 Ga0111539_10012127
685 Ga0111539_10096219
686 Ga0105245_10100132
687 Ga0114129_10004470
688 Ga0114129_10100794
689 Ga0114129_10143072
690 Ga0105242_10004225
691 Ga0105242_10024784
692 Ga0105248_10028672
693 Ga0105249_10223082
694 Ga0105028_100627
695 Ga0157374_10189292
696 Ga0163162_10031597
697 Ga0157372_10013066
698 Ga0157375_10125487
699 Ga0163163_10022037
700 Ga0157376_10025437
701 Ga0207697_10007564
702 Ga0207705_10006864
703 Ga0207684_10000459
704 Ga0207684_10113369
705 Ga0207695_10000950
706 Ga0207652_10026253
707 Ga0207646_10000181
708 Ga0207646_10015721
709 Ga0207646_10039381
710 Ga0207659_10000689
711 Ga0207687_10039816
712 Ga0207664_10096790
713 Ga0207665_10012174
714 Ga0207667_10348144
715 Ga0207708_10117440
716 Ga0207641_10072412
717 Ga0209983_1000175
718 Ga0209971_1002048
719 Ga0209974_10001813
720 Ga0207428_10003292
721 Ga0207428_10009426
722 Ga0265318_10038769
723 Ga0265323_10000073
724 Ga0265323_10001019
725 Ga0265323_10001989
726 Ga0265323_10006474
727 Ga0265322_10000007
728 Ga0265322_10000955
729 Ga0265338_10137897
730 Ga0265330_10000055
731 Ga0265330_10003248
732 Ga0265330_10013478
733 Ga0265332_10002592
734 Ga0265332_10013375
735 Ga0265332_10060505
736 Ga0265329_10000814
737 Ga0265339_10004112
738 Ga0265331_10050925
739 Ga0265327_10025350
740 Ga0265316_10000065
741 Ga0265316_10001097
742 Ga0265316_10002098
743 Ga0265316_10004575
744 Ga0265316_10010874
745 Ga0265316_10024941
746 Ga0265316_10067066
747 Ga0265313_10011279
748 Ga0307508_10075169
749 Ga0316575_10002896
750 Ga0316575_10003778
751 Ga0316575_10014213
752 Ga0316575_10019629
753 Ga0316579_10000166
754 Ga0316579_10000293
755 Ga0316579_10000864
756 Ga0316579_10000989
757 Ga0316579_10000990
758 Ga0316579_10005840
759 Ga0316579_10010873
760 Ga0316579_10061570
761 Ga0265342_10000015
762 Ga0265342_10000150
763 Ga0265342_10006248
764 Ga0265342_10032100
765 Ga0265342_10045672
766 Ga0316576_10004888
767 Ga0316576_10006621
768 Ga0316576_10006838
769 Ga0316576_10018088
770 Ga0316576_10018426
771 Ga0316576_10133050
772 Ga0316576_10150330
773 Ga0316578_10001761
774 Ga0316578_10005865
775 Ga0316578_10039220
776 Ga0316578_10039296
777 Ga0316578_10045628
778 Ga0316578_10094941
779 Ga0316577_10000949
780 Ga0316577_10001028
781 Ga0316577_10005530
782 Ga0316577_10009273
783 Ga0316577_10027317
784 Ga0307410_10005267
785 Ga0316583_10005010
786 Ga0316583_10008613
787 Ga0316583_10009536
788 Ga0316583_10021936
789 Ga0316583_10027738
790 Ga0316585_10000025
791 Ga0316585_10002790
792 Ga0316585_10016992
793 Ga0316585_10017763
794 Ga0316585_10030039
795 Ga0316580_10000932
796 Ga0316580_10005592
797 Ga0316593_10002127
798 Ga0316593_10004749
799 Ga0316593_10005938
800 Ga0316593_10010842
801 Ga0316593_10023880
802 Ga0316587_1004170
803 Ga0316596_1002037
804 Ga0316596_1005522
805 Ga0373934_0003943
806 Ga0373952_0001800
807 Ga0373956_0019169
808 Ga0373957_0001612
809 Ga0373960_0021933
810 Ga0316574_0000973
811 Ga0316574_0005946
812 Ga0316574_0006951
813 Ga0316574_0031387
814 Ga0316574_0031466
815 Ga0316574_0043997
816 Ga0316574_0048674
817 Ga0316574_0053846
818 Ga0316574_0062607
819 Ga0316574_0106134
820 Ga0373927_0015791
821 Ga0373947_0053832
822 Ga0373937_0024126
823 Ga0373937_0024179
824 Ga0373937_0052171
825 Ga0373937_0097519
826 Ga0373937_0160676
827 Ga0316582_0000356
828 Ga0316582_0001718
829 Ga0316582_0003249
830 Ga0316582_0005122
831 Ga0316582_0024663
832 Ga0316582_0038903
833 Ga0316582_0039373
834 Ga0316582_0059072
835 Ga0316582_0064843
836 Ga0316582_0098645
837 Ga0316582_0112161
838 Ga0316582_0118033
839 Ga0316584_0003331
840 Ga0316584_0004879
841 Ga0316584_0006375
842 Ga0316584_0011104
843 Ga0316584_0012362
844 Ga0316584_0027363
845 Ga0316584_0047161
846 Ga0316584_0059457
847 Ga0316584_0077805
848 Ga0316584_0086089
849 Ga0316584_0101411
850 Ga0316584_0169691
851 Ga0316584_0191075
852 Ga0373925_0036695
853 Ga0395905_0003645
854 Ga0395905_0005298
855 Ga0395905_0021681
856 Ga0395905_0113847
857 Ga0316581_0000143
858 Ga0316581_0000637
859 Ga0316581_0003584
860 Ga0316581_0007401
861 Ga0316581_0017944
862 Ga0436364_0825120
863 Ga0395901_0234310
864 Ga0400484_01676
865 Ga0400484_08406
866 Ga0400484_18920
867 Ga0400484_27283
868 Ga0400490_06783
869 Ga0400490_23886
870 Ga0400490_35312
871 Ga0400490_36248
872 Ga0400490_49656
873 Ga0400488_12502
874 Ga0400488_17517
875 Ga0400488_18217
876 Ga0400488_25323
877 Ga0400488_40260
878 Ga0400488_52751
879 Ga0400483_016805
880 Ga0400483_082705
881 Ga0400483_154823
882 Ga0400483_174128
883 Ga0400489_64474
884 Ga0400487_00787
885 Ga0400487_31940
886 Ga0400487_47978
887 Ga0400487_48386
888 Ga0436361_0066522
889 Ga0439461_0012904
890 Ga0451577_0000414
891 Ga0451577_0001699
892 Ga0451577_0006478
893 Ga0451577_0007558
894 Ga0451577_0008010
895 Ga0451577_0023211
896 Ga0451577_0049624
897 Ga0451577_0107540
898 Ga0451577_0310983
899 Ga0453683_0000002
900 Ga0453683_0002951
901 Ga0453683_0028624
902 Ga0453684_0000013
903 Ga0453684_0000145
904 Ga0453684_0000221
905 Ga0453684_0000878
906 Ga0453684_0001238
907 Ga0453684_0003182
908 Ga0453684_0004004
909 Ga0453684_0005036
910 Ga0453684_0008912
911 Ga0453684_0014929
912 Ga0453684_0033213
913 Ga0453684_0034436
914 Ga0453684_0043670
915 Ga0453684_0050507
916 Ga0453684_0051205
917 Ga0453684_0055057
918 Ga0453684_0105569
919 Ga0453684_0181245
920 Ga0453684_0193280
921 Ga0453684_0214430
922 Ga0451576_0013721
923 Ga0451576_0021456
924 Ga0451576_0029238
925 Ga0451576_0033338
926 Ga0451576_0045391
927 Ga0451576_0051215
928 Ga0451576_0074789
929 Ga0451576_0084708
930 Ga0495653_0055687
931 Ga0495580_0020878
932 Ga0495580_0028432
933 Ga0495580_0049799
934 Ga0495580_0052533
935 Ga0495662_0042344
936 Ga0495664_0012981
937 Ga0495628_0045296
938 Ga0495587_0013171
939 Ga0495587_0015955
940 Ga0495645_0016325
941 Ga0495645_0108592
942 Ga0495667_0028473
943 Ga0495667_0044207
944 Ga0495634_0031236
945 Ga0495588_0013687
946 Ga0495599_0005304
947 Ga0495636_0013233
948 Ga0495675_0011807
949 Ga0495684_0065988
950 Ga0495602_0001002
951 Ga0495602_0064063
952 Ga0495602_0066802
953 Ga0496103_0021696
954 Ga0496104_0006789
955 Ga0496105_0017835
956 Ga0496106_0038857
957 Ga0496108_0021010
958 Ga0496109_0000047
959 Ga0496109_0001209
960 Ga0496110_0013085
961 Ga0496110_0202852
962 Ga0496111_0037273
963 Ga0496112_0055095
964 Ga0496113_0005079
965 Ga0501031_0023822
966 Ga0501033_0130496
967 Ga0501034_0111141
968 Ga0501034_0268895
969 Ga0501036_0014601
970 Ga0501036_0029637
971 Ga0501036_0132597
972 Ga0501036_0170092
973 Ga0501037_0009990
974 Ga0501037_0045239
975 Ga0501037_0063574
976 Ga0501037_0072399
977 Ga0501037_0137617
978 Ga0501038_0006798
979 Ga0501038_0013327
980 Ga0501038_0017555
981 Ga0501038_0032265
982 Ga0501038_0084207
983 Ga0501039_0001276
984 Ga0501039_0004339
985 Ga0501039_0004381
986 Ga0501039_0015321
987 Ga0501039_0018654
988 Ga0501039_0028786
989 Ga0501039_0052445
990 Ga0501039_0054129
991 Ga0501039_0061015
992 Ga0501039_0103182
993 Ga0501039_0115197
994 Ga0501040_0001422
995 Ga0501040_0004172
996 Ga0501040_0005609
997 Ga0501040_0010747
998 Ga0501040_0010924
999 Ga0501040_0013441
1000 Ga0501040_0017631
1001 Ga0501040_0021983
1002 Ga0501040_0048994
1003 Ga0501040_0049012
1004 Ga0501040_0050120
1005 Ga0501040_0076377
1006 Ga0501040_0079021
1007 Ga0501040_0084077
1008 Ga0501040_0093540
1009 Ga0501041_0000482
1010 Ga0501041_0000676
1011 Ga0501041_0007704
1012 Ga0501041_0013379
1013 Ga0501041_0014179
1014 Ga0501041_0020914
1015 Ga0501041_0045060
1016 Ga0501041_0072757
1017 Ga0501041_0073651
1018 Ga0501041_0105216
1019 Ga0501042_0001913
1020 Ga0501042_0003208
1021 Ga0501042_0014815
1022 Ga0501042_0015327
1023 Ga0501042_0015948
1024 Ga0501042_0015997
1025 Ga0501042_0048721
1026 Ga0501042_0055949
1027 Ga0501042_0062444
1028 Ga0501042_0141441
1029 Ga0501042_0172461
1030 Ga0501043_0066285
1031 Ga0501043_0090305
1032 Ga0501046_0003726
1033 Ga0501046_0013943
1034 Ga0501046_0026833
1035 Ga0501046_0035135
1036 Ga0501046_0050820
1037 Ga0501046_0050891
1038 Ga0501046_0055612
1039 Ga0501046_0062351
1040 Ga0501046_0065764
1041 Ga0501047_0218155
1042 Ga0501048_0002429
1043 Ga0501048_0004200
1044 Ga0501048_0007038
1045 Ga0501048_0010323
1046 Ga0501048_0024563
1047 Ga0501048_0025781
1048 Ga0501048_0036557
1049 Ga0501048_0040282
1050 Ga0501068_0006276
1051 Ga0501068_0013285
1052 Ga0501068_0020291
1053 Ga0501068_0037001
1054 Ga0501068_0122223
1055 Ga0501068_0147370
1056 Ga0501070_0039698
1057 Ga0501070_0048378
1058 Ga0501070_0106122
1059 Ga0501070_0177966
1060 Ga0501070_0234506
1061 Ga0501071_0000406
1062 Ga0501071_0001835
1063 Ga0501071_0002666
1064 Ga0501071_0002865
1065 Ga0501071_0011064
1066 Ga0501071_0015995
1067 Ga0501071_0021892
1068 Ga0501071_0039906
1069 Ga0501071_0064155
1070 Ga0501071_0083695
1071 Ga0501071_0225341
1072 Ga0501072_0001254
1073 Ga0501072_0004898
1074 Ga0501072_0006201
1075 Ga0501072_0007233
1076 Ga0501072_0008012
1077 Ga0501072_0011520
1078 Ga0501072_0031772
1079 Ga0501072_0052148
1080 Ga0501072_0052815
1081 Ga0501072_0064640
1082 Ga0501072_0118883
1083 Ga0501072_0143957
1084 Ga0501072_0181179
1085 Ga0501073_0035587
1086 Ga0501073_0090262
1087 Ga0501073_0146128
1088 Ga0501074_0084886
1089 Ga0501074_0088954
1090 Ga0501074_0104586
1091 Ga0501074_0107727
1092 Ga0501074_0109985
1093 Ga0501074_0185134
1094 Ga0501075_0000650
1095 Ga0501075_0002465
1096 Ga0501075_0003152
1097 Ga0501075_0005765
1098 Ga0501075_0013492
1099 Ga0501075_0014545
1100 Ga0501075_0014668
1101 Ga0501075_0016143
1102 Ga0501075_0031518
1103 Ga0501075_0034044
1104 Ga0501075_0049686
1105 Ga0501075_0055417
1106 Ga0501075_0077140
1107 Ga0501075_0111928
1108 Ga0501075_0113439
1109 Ga0501075_0119990
1110 Ga0501075_0135409
1111 Ga0501075_0149961
1112 Ga0501076_0001813
1113 Ga0501076_0003028
1114 Ga0501076_0004161
1115 Ga0501076_0010003
1116 Ga0501076_0013859
1117 Ga0501076_0022639
1118 Ga0501076_0025965
1119 Ga0501076_0028797
1120 Ga0501076_0033746
1121 Ga0501076_0039860
1122 Ga0501076_0048975
1123 Ga0501076_0057328
1124 Ga0501076_0069562
1125 Ga0501076_0122674
1126 Ga0501076_0124622
1127 Ga0501076_0134466
1128 Ga0501076_0143731
1129 Ga0501076_0145667
1130 Ga0501077_0001435
1131 Ga0501077_0002170
1132 Ga0501077_0003187
1133 Ga0501077_0004571
1134 Ga0501077_0007707
1135 Ga0501077_0024131
1136 Ga0501077_0050007
1137 Ga0501077_0051971
1138 Ga0501077_0052925
1139 Ga0501077_0059422
1140 Ga0501077_0063493
1141 Ga0501077_0069893
1142 Ga0501077_0101969
1143 Ga0501079_0002043
1144 Ga0501079_0004586
1145 Ga0501079_0004615
1146 Ga0501079_0005137
1147 Ga0501079_0006411
1148 Ga0501079_0010249
1149 Ga0501079_0018538
1150 Ga0501079_0020293
1151 Ga0501079_0023697
1152 Ga0501079_0030145
1153 Ga0501079_0047815
1154 Ga0501079_0048524
1155 Ga0501079_0049394
1156 Ga0501079_0053042
1157 Ga0501079_0053164
1158 Ga0501079_0063551
1159 Ga0501079_0065267
1160 Ga0501079_0078525
1161 Ga0501079_0082134
1162 Ga0501079_0083135
1163 Ga0501080_0000674
1164 Ga0501080_0002727
1165 Ga0501080_0028871
1166 Ga0501080_0110872
1167 Ga0501080_0121025
1168 Ga0501080_0138724
1169 Ga0501080_0143125
1170 Ga0501080_0190574
1171 Ga0501081_0000335
1172 Ga0501081_0001131
1173 Ga0501081_0001234
1174 Ga0501081_0004000
1175 Ga0501081_0004706
1176 Ga0501081_0012882
1177 Ga0501081_0013015
1178 Ga0501081_0013065
1179 Ga0501081_0016164
1180 Ga0501081_0023366
1181 Ga0501081_0025535
1182 Ga0501081_0027108
1183 Ga0501081_0042765
1184 Ga0501081_0056381
1185 Ga0501081_0063666
1186 Ga0501081_0121343
1187 Ga0501081_0128686
1188 Ga0501081_0128741
1189 Ga0501081_0153177
1190 Ga0501083_0019176
1191 Ga0501083_0033682
1192 Ga0501083_0044104
1193 Ga0501083_0067683
1194 Ga0501083_0075078
1195 Ga0501035_0021624
1196 Ga0501035_0033320
1197 Ga0501035_0063219
1198 Ga0501035_0083241
1199 Ga0501035_0147899
1200 Ga0501035_0210367
1201 Ga0501035_0223554
1202 Ga0501035_0299987
1203 Ga0501044_0021419
1204 Ga0501044_0108535
1205 Ga0501044_0284001
1206 Ga0501045_0003719
1207 Ga0501045_0004151
1208 Ga0501045_0016152
1209 Ga0501045_0022927
1210 Ga0501045_0031167
1211 Ga0501045_0034864
1212 Ga0501045_0043777
1213 Ga0501045_0052474
1214 Ga0501045_0054099
1215 Ga0501045_0063084
1216 Ga0501045_0113884
1217 Ga0501045_0141377
1218 Ga0501045_0157885
1219 Ga0501045_0165630
1220 Ga0501045_0189087
1221 Ga0501045_0197705
1222 Ga0501045_0223780
1223 nmdc:mga06z11_8841_c1
1224 nmdc:mga07m45_6960_c1
1225 nmdc:mga05p37_117050_c1
1226 nmdc:mga09592_169907_c1
1227 nmdc:mga08y16_3835_c1
1228 nmdc:mga08y16_58106_c1
1229 nmdc:mga08y16_6655_c1
1230 nmdc:mga0n895_31434_c1
1231 nmdc:mga0n895_99690_c1
1232 nmdc:mga0rr50_11041_c1
1233 nmdc:mga08x19_1_c1
1234 nmdc:mga0a205_274359_c1
1235 Ga0495601_0016010
1236 Ga0495601_0023906
1237 Ga0501084_0002129
1238 Ga0501084_0002514
1239 Ga0501084_0003981
1240 Ga0501084_0012454
1241 Ga0501084_0012710
1242 Ga0501084_0032854
1243 Ga0501084_0045859
1244 Ga0501084_0061271
1245 Ga0501084_0172762
1246 Ga0501082_0003503
1247 Ga0501082_0004420
1248 Ga0501082_0008168
1249 Ga0501082_0009470
1250 Ga0501082_0014387
1251 Ga0501082_0014741
1252 Ga0501082_0024288
1253 Ga0501082_0026302
1254 Ga0501082_0038809
1255 Ga0501082_0051330
1256 Ga0501082_0060384
1257 Ga0501082_0077646
1258 Ga0501082_0091729
1259 Ga0501082_0096072
1260 Ga0501082_0152364
1261 Ga0501082_0188243
1262 Ga0530510_0000441
1263 Ga0530510_0013312
1264 Ga0530510_0013387
1265 Ga0530510_0016399
1266 Ga0530510_0025584
1267 Ga0530510_0026304
1268 Ga0530510_0035583
1269 Ga0530510_0037015
1270 Ga0530510_0038272
1271 Ga0530510_0040533
1272 Ga0530510_0102263
1273 Ga0530510_0145460
1274 Ga0530510_0146174
1275 2688067381
1276 2889419421
1277 2891634103
1278 2896389530
1279 2906633149
1280 2920113085
1281 8001523855
1282 8016585990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01139

RtcB

tRNA-splicing ligase RtcB

108

539

0.99

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

36

291

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dcb-assembly2.cif.gz_B rna ligase rtcb from pyrococcus horikoshii in complex with ni2+ and gtp 0.9851 6 476
4dwr-assembly3.cif.gz_C rna ligase rtcb/mn2+ complex 0.9757 6 476
8dcb-assembly2.cif.gz_B rna ligase rtcb from pyrococcus horikoshii in complex with ni2+ and gtp 0.9728 6 476
7p3b-assembly2.cif.gz_B human rna ligase rtcb in complex with gmp and co(ii) 0.9671 4 476
4dwr-assembly3.cif.gz_C rna ligase rtcb/mn2+ complex 0.9635 6 476
ID Description Score Start End Superfamily
1uc2A00 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9866 6 476 3.90.1860.10
af_Q99LF4_9_505_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9819 4 476 3.90.1860.10
af_Q58095_565_968_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9803 98 476 3.90.1860.10
1uc2A00 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9743 6 476 3.90.1860.10
af_Q99LF4_9_505_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.9737 4 476 3.90.1860.10
ID Description Score Start End GO Terms
AF-A0A352Q280-F1-model_v4 3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8) 1.003 1 80 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A2W4R528-F1-model_v4 3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8) 0.9997 1 108 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A533BCY7-F1-model_v4 tRNA-splicing ligase RtcB (EC 6.5.1.-) 0.9989 1 476 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A3D2FJW7-F1-model_v4 3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8) 0.9985 374 476 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057
AF-A0A1G3HVG1-F1-model_v4 tRNA-splicing ligase RtcB (EC 6.5.1.-) 0.998 64 476 GO:0003972
GO:0005525
GO:0006396
GO:0042245
GO:0046872
GO:0170057

Map