F471779

General Info

Members Datasets Scaffolds Average Seq Length
641 310 630 323

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10018996|Ga0105248_100189963
Length 366
Sequence LILSRLQVLGQQPMPGARGSPYALAPVNPSLAGVLMNLLARLHSLVVGLGAAAALATFATAANAQTKWDLPAAYPANNFHTENLQQFANDVDKATGGKLKITVHANASLFKANEIKRAVQGGQAQIGEVLLVNFQNEWQPYGIDGLPFLADSYDASMKLYKASKPALEKKLAEQGIMLLYAVAWPPQGIYVKKPISSAADLKGVKWRAYSPATARIAELVGAQPVTVQAXELSQAMATGVIESYMSSGSTGYDTKTYEHIKYWYDTQAWLPKNAVLVNKAAFDALDKPTQAALVKAGADAEARGWALSQQKNGEYIELLKKNGMTILPPPPQLKADMKKVGDTMLKEWLEKAGAEGQAIVDAYRKL

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2643221672 Variovorax sp. Root434 Isolate Unclassified
10 2842747753 Variovorax sp. R-72060 Isolate Unclassified
11 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
277 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
304 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 0.31
Rhizoplane 4.06
Rhizosphere 78.78
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001748 3300002773 Bacteria 8886
2 JGI25153J46596_10002270 3300003215 Bacteria 11209
3 JGI25153J46596_10006214 3300003215 Bacteria 6112
4 Ga0055526_1002150 3300003771 Bacteria 13519
5 Ga0055537_1000011 3300003773 Bacteria 137556
6 Ga0055534_1000020 3300003784 Bacteria 137562
7 Ga0055528_1000523 3300003790 Bacteria 29840
8 Ga0055530_10010170 3300003791 Bacteria 3513
9 Ga0055530_10018936 3300003791 Bacteria 2103
10 Ga0055540_1004422 3300003792 Bacteria 6347
11 Ga0055531_10001135 3300003794 Bacteria 20599
12 Ga0055531_10006773 3300003794 Bacteria 6404
13 Ga0065714_10148141 3300005288 Bacteria 1124
14 Ga0065707_10086252 3300005295 Bacteria 5558
15 Ga0070658_10001451 3300005327 Bacteria 20221
16 Ga0070658_10159367 3300005327 Bacteria 1893
17 Ga0070658_10278833 3300005327 Bacteria 1422
18 Ga0070676_10009731 3300005328 Bacteria 5199
19 Ga0070676_10016860 3300005328 Bacteria 4038
20 Ga0070676_10234980 3300005328 Bacteria 1216
21 Ga0070690_100094564 3300005330 Bacteria 1972
22 Ga0070690_100141676 3300005330 Bacteria 1632
23 Ga0070670_100000316 3300005331 Bacteria 41464
24 Ga0070670_100001487 3300005331 Bacteria 18885
25 Ga0070670_100055083 3300005331 Bacteria 3413
26 Ga0070670_100119934 3300005331 Bacteria 2268
27 Ga0070670_100125593 3300005331 Bacteria 2214
28 Ga0070670_100127016 3300005331 Bacteria 2201
29 Ga0070670_100139485 3300005331 Bacteria 2096
30 Ga0070677_10000457 3300005333 Bacteria 13976
31 Ga0070677_10019165 3300005333 Bacteria 2474
32 Ga0070677_10022459 3300005333 Bacteria 2324
33 Ga0070677_10023781 3300005333 Bacteria 2272
34 Ga0068869_100039693 3300005334 Bacteria 3362
35 Ga0070666_10022199 3300005335 Bacteria 4119
36 Ga0070666_10078188 3300005335 Bacteria 2258
37 Ga0070680_100343857 3300005336 Bacteria 1268
38 Ga0068868_100004726 3300005338 Bacteria 9566
39 Ga0068868_100038261 3300005338 Bacteria 3723
40 Ga0068868_100053419 3300005338 Bacteria 3183
41 Ga0070660_100155198 3300005339 Bacteria 1842
42 Ga0070689_100031651 3300005340 Bacteria 4022
43 Ga0070661_100177986 3300005344 Bacteria 1617
44 Ga0070668_100027181 3300005347 Bacteria 4343
45 Ga0070669_100001968 3300005353 Bacteria 14839
46 Ga0070675_100000480 3300005354 Bacteria 27286
47 Ga0070675_100005625 3300005354 Bacteria 9595
48 Ga0070675_100010343 3300005354 Bacteria 7286
49 Ga0070675_100038647 3300005354 Bacteria 3891
50 Ga0070675_100145213 3300005354 Bacteria 2031
51 Ga0070671_100000734 3300005355 Bacteria 23452
52 Ga0070671_100014699 3300005355 Bacteria 6327
53 Ga0070671_100152527 3300005355 Bacteria 1951
54 Ga0070671_100249168 3300005355 Bacteria 1509
55 Ga0070674_100020342 3300005356 Bacteria 4238
56 Ga0070674_100350084 3300005356 Bacteria 1193
57 Ga0070673_100001230 3300005364 Bacteria 14824
58 Ga0070673_100003065 3300005364 Bacteria 10345
59 Ga0070673_100016138 3300005364 Bacteria 5271
60 Ga0070673_100062900 3300005364 Bacteria 2951
61 Ga0070673_100267796 3300005364 Bacteria 1494
62 Ga0070688_100122829 3300005365 Bacteria 1741
63 Ga0070659_100008351 3300005366 Bacteria 7561
64 Ga0070659_100171312 3300005366 Bacteria 1778
65 Ga0070667_100004472 3300005367 Bacteria 11793
66 Ga0070667_100037047 3300005367 Bacteria 4089
67 Ga0070701_10085078 3300005438 Bacteria 1721
68 Ga0070663_100027741 3300005455 Bacteria 3849
69 Ga0070678_100009028 3300005456 Bacteria 6006
70 Ga0070678_100013895 3300005456 Bacteria 5061
71 Ga0070678_100047655 3300005456 Bacteria 3081
72 Ga0070678_100079341 3300005456 Bacteria 2482
73 Ga0070678_100140328 3300005456 Bacteria 1933
74 Ga0070662_100001468 3300005457 Bacteria 14517
75 Ga0070662_100008876 3300005457 Bacteria 6553
76 Ga0068867_100000712 3300005459 Bacteria 22179
77 Ga0068867_100018725 3300005459 Bacteria 4923
78 Ga0068867_100037382 3300005459 Bacteria 3528
79 Ga0068867_100132776 3300005459 Bacteria 1937
80 Ga0068867_100246319 3300005459 Bacteria 1451
81 Ga0070685_10005883 3300005466 Bacteria 6240
82 Ga0070706_100007432 3300005467 Bacteria 10276
83 Ga0070706_100579706 3300005467 Bacteria 1043
84 Ga0070707_100114145 3300005468 Bacteria 2621
85 Ga0070699_100149258 3300005518 Bacteria 2067
86 Ga0070679_100105012 3300005530 Bacteria 2811
87 Ga0070684_100098116 3300005535 Bacteria 2613
88 Ga0070684_100130410 3300005535 Bacteria 2267
89 Ga0068853_100172161 3300005539 Bacteria 1959
90 Ga0068853_100278229 3300005539 Bacteria 1542
91 Ga0070672_100000206 3300005543 Bacteria 32562
92 Ga0070672_100011240 3300005543 Bacteria 6242
93 Ga0070672_100011563 3300005543 Bacteria 6158
94 Ga0070672_100011945 3300005543 Bacteria 6071
95 Ga0070672_100018687 3300005543 Bacteria 5017
96 Ga0070672_100027935 3300005543 Bacteria 4214
97 Ga0070672_100096113 3300005543 Bacteria 2396
98 Ga0070686_100025147 3300005544 Bacteria 3579
99 Ga0070696_100014115 3300005546 Bacteria 5362
100 Ga0070665_100175402 3300005548 Bacteria 2144
101 Ga0070665_100184077 3300005548 Bacteria 2090
102 Ga0068855_100022146 3300005563 Bacteria 7615
103 Ga0068855_100297315 3300005563 Bacteria 1788
104 Ga0070664_100112710 3300005564 Bacteria 2375
105 Ga0070664_100121416 3300005564 Bacteria 2288
106 Ga0070664_100180954 3300005564 Bacteria 1873
107 Ga0068854_100031831 3300005578 Bacteria 3667
108 Ga0068856_100043926 3300005614 Bacteria 4396
109 Ga0068856_100064064 3300005614 Bacteria 3632
110 Ga0068856_100213561 3300005614 Bacteria 1945
111 Ga0068852_100017057 3300005616 Bacteria 5687
112 Ga0068852_100026411 3300005616 Bacteria 4719
113 Ga0068852_100036243 3300005616 Bacteria 4125
114 Ga0068852_100056346 3300005616 Bacteria 3396
115 Ga0068852_100464942 3300005616 Bacteria 1255
116 Ga0068859_100023164 3300005617 Bacteria 6230
117 Ga0068859_100072262 3300005617 Bacteria 3486
118 Ga0068859_100100370 3300005617 Bacteria 2950
119 Ga0068859_100108378 3300005617 Bacteria 2839
120 Ga0068859_100161085 3300005617 Bacteria 2323
121 Ga0068859_100522698 3300005617 Bacteria 1282
122 Ga0068864_100009333 3300005618 Bacteria 8092
123 Ga0068864_100010783 3300005618 Bacteria 7552
124 Ga0068864_100032186 3300005618 Bacteria 4454
125 Ga0068864_100150190 3300005618 Bacteria 2110
126 Ga0068866_10056518 3300005718 Bacteria 2018
127 Ga0068861_100004400 3300005719 Bacteria 9442
128 Ga0068861_100021163 3300005719 Bacteria 4673
129 Ga0068861_100062590 3300005719 Bacteria 2859
130 Ga0068861_100182325 3300005719 Bacteria 1749
131 Ga0068851_10038084 3300005834 Bacteria 2411
132 Ga0068863_100006090 3300005841 Bacteria 11833
133 Ga0068863_100023505 3300005841 Bacteria 5885
134 Ga0068863_100045005 3300005841 Bacteria 4188
135 Ga0068863_100238613 3300005841 Bacteria 1755
136 Ga0068863_100396826 3300005841 Bacteria 1349
137 Ga0068858_100001935 3300005842 Bacteria 21109
138 Ga0068858_100002260 3300005842 Bacteria 19472
139 Ga0068858_100031848 3300005842 Bacteria 4900
140 Ga0068858_100108964 3300005842 Bacteria 2585
141 Ga0068860_100000605 3300005843 Bacteria 42776
142 Ga0068860_100001949 3300005843 Bacteria 21844
143 Ga0068860_100018751 3300005843 Bacteria 6723
144 Ga0068862_100047762 3300005844 Bacteria 3654
145 Ga0068862_100113991 3300005844 Bacteria 2376
146 Ga0068862_100161432 3300005844 Bacteria 2000
147 Ga0081455_10074649 3300005937 Bacteria 2800
148 Ga0075363_100038545 3300006048 Bacteria 2514
149 Ga0075364_10080287 3300006051 Bacteria 2156
150 Ga0075362_10024666 3300006177 Bacteria 2552
151 Ga0075367_10122591 3300006178 Bacteria 1602
152 Ga0075366_10007566 3300006195 Bacteria 6008
153 Ga0075366_10009253 3300006195 Bacteria 5500
154 Ga0075366_10041050 3300006195 Bacteria 2738
155 Ga0097621_100091348 3300006237 Bacteria 2549
156 Ga0097621_100115403 3300006237 Bacteria 2273
157 Ga0097621_100119759 3300006237 Bacteria 2231
158 Ga0097621_100131452 3300006237 Bacteria 2131
159 Ga0097621_100341436 3300006237 Bacteria 1330
160 Ga0075370_10003454 3300006353 Bacteria 7526
161 Ga0075370_10010143 3300006353 Bacteria 4911
162 Ga0075370_10015546 3300006353 Bacteria 4076
163 Ga0068871_100050917 3300006358 Bacteria 3351
164 Ga0068871_100057060 3300006358 Bacteria 3175
165 Ga0068865_100342528 3300006881 Bacteria 1208
166 Ga0097620_100023164 3300006931 Bacteria 6230
167 Ga0097620_100072264 3300006931 Bacteria 3486
168 Ga0097620_100100368 3300006931 Bacteria 2950
169 Ga0097620_100108379 3300006931 Bacteria 2839
170 Ga0097620_100161093 3300006931 Bacteria 2323
171 Ga0097620_100522709 3300006931 Bacteria 1282
172 Ga0099826_10000157 3300006948 Bacteria 28404
173 Ga0099794_10002963 3300007265 Bacteria 6402
174 Ga0105240_10427033 3300009093 Bacteria 1488
175 Ga0105240_10507864 3300009093 Bacteria 1339
176 Ga0105240_10566180 3300009093 Bacteria 1255
177 Ga0105245_10096754 3300009098 Bacteria 2725
178 Ga0105245_10149085 3300009098 Bacteria 2210
179 Ga0105245_10365519 3300009098 Bacteria 1433
180 Ga0114129_10030937 3300009147 Bacteria 7570
181 Ga0105243_10017179 3300009148 Bacteria 5473
182 Ga0105243_10073714 3300009148 Bacteria 2767
183 Ga0105243_10079624 3300009148 Bacteria 2671
184 Ga0105243_10096542 3300009148 Bacteria 2445
185 Ga0105241_10044466 3300009174 Bacteria 3365
186 Ga0105242_10010661 3300009176 Bacteria 7055
187 Ga0105242_10023954 3300009176 Bacteria 4817
188 Ga0105242_10301046 3300009176 Bacteria 1464
189 Ga0105248_10014904 3300009177 Bacteria 8560
190 Ga0105248_10018996 3300009177 Bacteria 7600
191 Ga0105248_10031634 3300009177 Bacteria 5911
192 Ga0105248_10125609 3300009177 Bacteria 2894
193 Ga0105248_10154638 3300009177 Bacteria 2588
194 Ga0105248_10228499 3300009177 Bacteria 2094
195 Ga0105237_10257489 3300009545 Bacteria 1747
196 Ga0105238_10160530 3300009551 Bacteria 2223
197 Ga0105238_10209623 3300009551 Bacteria 1924
198 Ga0105238_10331849 3300009551 Bacteria 1508
199 Ga0105238_10540303 3300009551 Bacteria 1169
200 Ga0105249_10038932 3300009553 Bacteria 4315
201 Ga0105249_10039217 3300009553 Bacteria 4300
202 Ga0105246_10085345 3300011119 Bacteria 2261
203 Ga0157373_10050849 3300013100 Bacteria 2951
204 Ga0157371_10091085 3300013102 Bacteria 2160
205 Ga0157371_10148154 3300013102 Bacteria 1673
206 Ga0157370_10297900 3300013104 Bacteria 1489
207 Ga0157369_10033694 3300013105 Bacteria 5627
208 Ga0157374_10156302 3300013296 Bacteria 2220
209 Ga0157378_10272705 3300013297 Bacteria 1628
210 Ga0163162_10007037 3300013306 Bacteria 10907
211 Ga0163162_10013137 3300013306 Bacteria 8085
212 Ga0163162_10028873 3300013306 Bacteria 5490
213 Ga0163162_10033703 3300013306 Bacteria 5090
214 Ga0163162_10056547 3300013306 Bacteria 3951
215 Ga0163162_10229351 3300013306 Bacteria 1987
216 Ga0163162_10263873 3300013306 Bacteria 1854
217 Ga0157372_10104054 3300013307 Bacteria 3245
218 Ga0157372_10113334 3300013307 Bacteria 3108
219 Ga0157375_10003084 3300013308 Bacteria 14466
220 Ga0157375_10082795 3300013308 Bacteria 3252
221 Ga0157375_10106295 3300013308 Bacteria 2898
222 Ga0157375_10113993 3300013308 Bacteria 2805
223 Ga0157375_10124563 3300013308 Bacteria 2691
224 Ga0157375_10137673 3300013308 Bacteria 2567
225 Ga0157375_10154740 3300013308 Bacteria 2431
226 Ga0157375_10224419 3300013308 Bacteria 2038
227 Ga0157375_10249409 3300013308 Bacteria 1936
228 Ga0157375_10295803 3300013308 Bacteria 1782
229 Ga0163163_10003856 3300014325 Bacteria 12771
230 Ga0157380_10027756 3300014326 Bacteria 4308
231 Ga0157380_10089863 3300014326 Bacteria 2532
232 Ga0157380_10509252 3300014326 Bacteria 1171
233 Ga0182008_10001113 3300014497 Bacteria 18484
234 Ga0157377_10011668 3300014745 Bacteria 4393
235 Ga0157379_10036974 3300014968 Bacteria 4353
236 Ga0157376_10018710 3300014969 Bacteria 5320
237 Ga0157376_10470971 3300014969 Bacteria 1229
238 Ga0182007_10003841 3300015262 Bacteria 6985
239 Ga0163161_10014680 3300017792 Bacteria 5455
240 Ga0207425_1000565 3300025245 Bacteria 21780
241 Ga0209129_1000075 3300025258 Bacteria 201273
242 Ga0209565_1000058 3300025263 Bacteria 194126
243 Ga0209673_1000053 3300025273 Bacteria 279449
244 Ga0209673_1006691 3300025273 Bacteria 5501
245 Ga0209675_1000010 3300025291 Bacteria 541927
246 Ga0209676_1002070 3300025292 Bacteria 15585
247 Ga0209676_1016058 3300025292 Bacteria 2724
248 Ga0209025_1008535 3300025294 Bacteria 7354
249 Ga0209564_1000046 3300025295 Bacteria 373787
250 Ga0209758_1000045 3300025297 Bacteria 369174
251 Ga0209758_1000052 3300025297 Bacteria 338962
252 Ga0209050_1000257 3300025298 Bacteria 114186
253 Ga0209050_1001209 3300025298 Bacteria 30287
254 Ga0209051_1000136 3300025303 Bacteria 138015
255 Ga0209051_1000145 3300025303 Bacteria 134807
256 Ga0209257_1000055 3300025304 Bacteria 415534
257 Ga0209257_1000495 3300025304 Bacteria 70401
258 Ga0209257_1034024 3300025304 Bacteria 1596
259 Ga0207697_10013102 3300025315 Bacteria 3463
260 Ga0207656_10013182 3300025321 Bacteria 3154
261 Ga0207656_10027818 3300025321 Bacteria 2316
262 Ga0207682_10000269 3300025893 Bacteria 23507
263 Ga0207682_10019175 3300025893 Bacteria 2678
264 Ga0207682_10023065 3300025893 Bacteria 2457
265 Ga0207682_10030129 3300025893 Bacteria 2172
266 Ga0207682_10042678 3300025893 Bacteria 1853
267 Ga0207642_10007733 3300025899 Bacteria 3643
268 Ga0207688_10008890 3300025901 Bacteria 5465
269 Ga0207688_10062569 3300025901 Bacteria 2098
270 Ga0207688_10078859 3300025901 Bacteria 1878
271 Ga0207680_10034428 3300025903 Bacteria 2898
272 Ga0207680_10147539 3300025903 Bacteria 1565
273 Ga0207645_10001304 3300025907 Bacteria 20534
274 Ga0207645_10007282 3300025907 Bacteria 7825
275 Ga0207645_10017830 3300025907 Bacteria 4681
276 Ga0207645_10064111 3300025907 Bacteria 2348
277 Ga0207705_10042174 3300025909 Bacteria 3276
278 Ga0207705_10106755 3300025909 Bacteria 2065
279 Ga0207705_10150517 3300025909 Bacteria 1744
280 Ga0207684_10009803 3300025910 Bacteria 8450
281 Ga0207695_10444384 3300025913 Bacteria 1180
282 Ga0207671_10057337 3300025914 Bacteria 2887
283 Ga0207671_10131192 3300025914 Bacteria 1923
284 Ga0207662_10016139 3300025918 Bacteria 4211
285 Ga0207657_10157087 3300025919 Bacteria 1849
286 Ga0207649_10039911 3300025920 Bacteria 2849
287 Ga0207652_10060606 3300025921 Bacteria 3265
288 Ga0207646_10263396 3300025922 Bacteria 1558
289 Ga0207681_10000893 3300025923 Bacteria 19479
290 Ga0207694_10233034 3300025924 Bacteria 1504
291 Ga0207694_10266674 3300025924 Bacteria 1404
292 Ga0207694_10353159 3300025924 Bacteria 1217
293 Ga0207650_10000172 3300025925 Bacteria 76270
294 Ga0207650_10072294 3300025925 Bacteria 2596
295 Ga0207650_10101014 3300025925 Bacteria 2220
296 Ga0207650_10115048 3300025925 Bacteria 2087
297 Ga0207650_10157624 3300025925 Bacteria 1796
298 Ga0207659_10000066 3300025926 Bacteria 66468
299 Ga0207659_10010811 3300025926 Bacteria 5746
300 Ga0207659_10011107 3300025926 Bacteria 5681
301 Ga0207659_10021252 3300025926 Bacteria 4304
302 Ga0207659_10023895 3300025926 Bacteria 4087
303 Ga0207659_10030025 3300025926 Bacteria 3710
304 Ga0207659_10040044 3300025926 Bacteria 3274
305 Ga0207659_10047702 3300025926 Bacteria 3031
306 Ga0207659_10428809 3300025926 Bacteria 1110
307 Ga0207687_10080561 3300025927 Bacteria 2351
308 Ga0207687_10120120 3300025927 Bacteria 1964
309 Ga0207687_10193728 3300025927 Bacteria 1584
310 Ga0207644_10000306 3300025931 Bacteria 31833
311 Ga0207644_10001237 3300025931 Bacteria 16418
312 Ga0207644_10020223 3300025931 Bacteria 4524
313 Ga0207644_10090539 3300025931 Bacteria 2279
314 Ga0207690_10022184 3300025932 Bacteria 3946
315 Ga0207690_10153767 3300025932 Bacteria 1708
316 Ga0207690_10317396 3300025932 Bacteria 1224
317 Ga0207706_10016770 3300025933 Bacteria 6611
318 Ga0207706_10021166 3300025933 Bacteria 5844
319 Ga0207706_10035763 3300025933 Bacteria 4413
320 Ga0207706_10038451 3300025933 Bacteria 4244
321 Ga0207686_10010321 3300025934 Bacteria 5082
322 Ga0207709_10014157 3300025935 Bacteria 4403
323 Ga0207670_10042168 3300025936 Bacteria 3005
324 Ga0207670_10133540 3300025936 Bacteria 1822
325 Ga0207670_10164825 3300025936 Bacteria 1657
326 Ga0207669_10158667 3300025937 Bacteria 1594
327 Ga0207704_10050264 3300025938 Bacteria 2514
328 Ga0207704_10227465 3300025938 Bacteria 1385
329 Ga0207691_10000265 3300025940 Bacteria 51755
330 Ga0207691_10009574 3300025940 Bacteria 9300
331 Ga0207691_10014086 3300025940 Bacteria 7631
332 Ga0207691_10029152 3300025940 Bacteria 5163
333 Ga0207691_10033726 3300025940 Bacteria 4766
334 Ga0207691_10055754 3300025940 Bacteria 3601
335 Ga0207691_10117408 3300025940 Bacteria 2361
336 Ga0207691_10122572 3300025940 Bacteria 2302
337 Ga0207711_10005620 3300025941 Bacteria 10602
338 Ga0207711_10013090 3300025941 Bacteria 6891
339 Ga0207711_10096022 3300025941 Bacteria 2615
340 Ga0207711_10148439 3300025941 Bacteria 2114
341 Ga0207711_10335657 3300025941 Bacteria 1398
342 Ga0207689_10024677 3300025942 Bacteria 5041
343 Ga0207689_10036423 3300025942 Bacteria 4085
344 Ga0207689_10052134 3300025942 Bacteria 3372
345 Ga0207689_10054545 3300025942 Bacteria 3291
346 Ga0207689_10085747 3300025942 Bacteria 2589
347 Ga0207689_10114270 3300025942 Bacteria 2219
348 Ga0207689_10146849 3300025942 Bacteria 1943
349 Ga0207661_10082073 3300025944 Bacteria 2664
350 Ga0207679_10009947 3300025945 Bacteria 6108
351 Ga0207667_10409578 3300025949 Bacteria 1380
352 Ga0207651_10000267 3300025960 Bacteria 22292
353 Ga0207651_10056669 3300025960 Bacteria 2698
354 Ga0207651_10101788 3300025960 Bacteria 2133
355 Ga0207668_10014376 3300025972 Bacteria 4898
356 Ga0207668_10030011 3300025972 Bacteria 3569
357 Ga0207668_10070133 3300025972 Bacteria 2498
358 Ga0207640_10020071 3300025981 Bacteria 3961
359 Ga0207640_10113018 3300025981 Bacteria 1929
360 Ga0207640_10117148 3300025981 Bacteria 1900
361 Ga0207658_10005885 3300025986 Bacteria 8385
362 Ga0207658_10028137 3300025986 Bacteria 3956
363 Ga0207677_10002328 3300026023 Bacteria 9969
364 Ga0207677_10015488 3300026023 Bacteria 4488
365 Ga0207677_10029828 3300026023 Bacteria 3473
366 Ga0207677_10052530 3300026023 Bacteria 2769
367 Ga0207677_10057076 3300026023 Bacteria 2679
368 Ga0207677_10069101 3300026023 Bacteria 2483
369 Ga0207703_10010895 3300026035 Bacteria 7089
370 Ga0207703_10014214 3300026035 Bacteria 6208
371 Ga0207703_10054103 3300026035 Bacteria 3263
372 Ga0207703_10062874 3300026035 Bacteria 3041
373 Ga0207639_10031455 3300026041 Bacteria 3901
374 Ga0207639_10148442 3300026041 Bacteria 1961
375 Ga0207678_10031930 3300026067 Bacteria 4591
376 Ga0207678_10035031 3300026067 Bacteria 4370
377 Ga0207678_10155496 3300026067 Bacteria 1952
378 Ga0207708_10006045 3300026075 Bacteria 8975
379 Ga0207708_10006674 3300026075 Bacteria 8538
380 Ga0207708_10105796 3300026075 Bacteria 2181
381 Ga0207702_10052022 3300026078 Bacteria 3464
382 Ga0207702_10085468 3300026078 Bacteria 2749
383 Ga0207641_10015994 3300026088 Bacteria 6142
384 Ga0207641_10031857 3300026088 Bacteria 4374
385 Ga0207641_10042940 3300026088 Bacteria 3794
386 Ga0207641_10052397 3300026088 Bacteria 3455
387 Ga0207648_10002312 3300026089 Bacteria 20575
388 Ga0207648_10008565 3300026089 Bacteria 9894
389 Ga0207648_10012331 3300026089 Bacteria 8002
390 Ga0207648_10069390 3300026089 Bacteria 3071
391 Ga0207648_10073241 3300026089 Bacteria 2986
392 Ga0207676_10002235 3300026095 Bacteria 13907
393 Ga0207676_10020243 3300026095 Bacteria 4864
394 Ga0207676_10027374 3300026095 Bacteria 4245
395 Ga0207676_10059604 3300026095 Bacteria 3015
396 Ga0207676_10472657 3300026095 Bacteria 1186
397 Ga0207674_10066233 3300026116 Bacteria 3639
398 Ga0207674_10069225 3300026116 Bacteria 3550
399 Ga0207674_10081993 3300026116 Bacteria 3227
400 Ga0207675_100019410 3300026118 Bacteria 6342
401 Ga0207675_100022443 3300026118 Bacteria 5878
402 Ga0207675_100044234 3300026118 Bacteria 4160
403 Ga0207675_100061012 3300026118 Bacteria 3520
404 Ga0207675_100121237 3300026118 Bacteria 2474
405 Ga0207675_100237285 3300026118 Bacteria 1761
406 Ga0207683_10014997 3300026121 Bacteria 6595
407 Ga0207683_10026644 3300026121 Bacteria 4992
408 Ga0207683_10051245 3300026121 Bacteria 3616
409 Ga0207683_10071175 3300026121 Bacteria 3074
410 Ga0207683_10121829 3300026121 Bacteria 2342
411 Ga0207683_10252589 3300026121 Bacteria 1609
412 Ga0207698_10009254 3300026142 Bacteria 6269
413 Ga0207698_10012799 3300026142 Bacteria 5508
414 Ga0207698_10085949 3300026142 Bacteria 2556
415 Ga0207698_10105396 3300026142 Bacteria 2349
416 Ga0207698_10154570 3300026142 Bacteria 1996
417 Ga0207698_10424174 3300026142 Bacteria 1277
418 Ga0209282_1000879 3300027666 Bacteria 15586
419 Ga0209588_1003800 3300027671 Bacteria 4210
420 Ga0209974_10011524 3300027876 Bacteria 2967
421 Ga0268266_10359904 3300028379 Bacteria 1369
422 Ga0268265_10018678 3300028380 Bacteria 4807
423 Ga0268265_10051971 3300028380 Bacteria 3096
424 Ga0268264_10010213 3300028381 Bacteria 7771
425 Ga0268264_10034120 3300028381 Bacteria 4184
426 Ga0268264_10036216 3300028381 Bacteria 4064
427 Ga0268264_10084070 3300028381 Bacteria 2728
428 Ga0307517_10000499 3300028786 Bacteria 67326
429 Ga0307515_10000066 3300028794 Bacteria 244076
430 Ga0307515_10000103 3300028794 Bacteria 198308
431 Ga0307515_10000366 3300028794 Bacteria 111195
432 Ga0307515_10001653 3300028794 Bacteria 49625
433 Ga0307515_10004991 3300028794 Bacteria 27066
434 Ga0307515_10035753 3300028794 Bacteria 8066
435 Ga0307515_10037079 3300028794 Bacteria 7856
436 Ga0307515_10040755 3300028794 Bacteria 7331
437 Ga0307515_10074011 3300028794 Bacteria 4565
438 Ga0307515_10112578 3300028794 Bacteria 3164
439 Ga0307512_10047332 3300030522 Bacteria 3496
440 Ga0265332_10000001 3300031238 Bacteria 863783
441 Ga0265325_10004203 3300031241 Bacteria 9145
442 Ga0265340_10067251 3300031247 Bacteria 1703
443 Ga0265327_10001296 3300031251 Bacteria 32766
444 Ga0265327_10009017 3300031251 Bacteria 7298
445 Ga0265316_10040119 3300031344 Bacteria 3755
446 Ga0307513_10034306 3300031456 Bacteria 5695
447 Ga0307513_10036111 3300031456 Bacteria 5520
448 Ga0307513_10097091 3300031456 Bacteria 2982
449 Ga0307513_10290646 3300031456 Bacteria 1406
450 Ga0307509_10040010 3300031507 Bacteria 5101
451 Ga0307509_10048217 3300031507 Bacteria 4576
452 Ga0307509_10204162 3300031507 Bacteria 1809
453 Ga0307508_10000107 3300031616 Bacteria 97818
454 Ga0307508_10001847 3300031616 Bacteria 23394
455 Ga0307508_10006981 3300031616 Bacteria 10530
456 Ga0307514_10000858 3300031649 Bacteria 48560
457 Ga0307514_10012482 3300031649 Bacteria 7066
458 Ga0307514_10101368 3300031649 Bacteria 2066
459 Ga0265314_10000013 3300031711 Bacteria 403405
460 Ga0307516_10014389 3300031730 Bacteria 8372
461 Ga0307516_10019586 3300031730 Bacteria 7006
462 Ga0307516_10020929 3300031730 Bacteria 6749
463 Ga0307405_10014627 3300031731 Bacteria 4226
464 Ga0307405_10254188 3300031731 Bacteria 1309
465 Ga0307413_10028093 3300031824 Bacteria 3127
466 Ga0307413_10359672 3300031824 Bacteria 1126
467 Ga0307518_10152051 3300031838 Bacteria 1600
468 Ga0307410_10040149 3300031852 Bacteria 3078
469 Ga0307410_10228370 3300031852 Bacteria 1436
470 Ga0307406_10006613 3300031901 Bacteria 6407
471 Ga0307406_10017377 3300031901 Bacteria 4186
472 Ga0307406_10146871 3300031901 Bacteria 1677
473 Ga0307412_10036449 3300031911 Bacteria 3151
474 Ga0307412_10053852 3300031911 Bacteria 2669
475 Ga0307409_100003227 3300031995 Bacteria 8786
476 Ga0307409_100039276 3300031995 Bacteria 3510
477 Ga0307409_100089816 3300031995 Bacteria 2513
478 Ga0307416_100021496 3300032002 Bacteria 4634
479 Ga0307416_100250242 3300032002 Bacteria 1724
480 Ga0307414_10047523 3300032004 Bacteria 2954
481 Ga0307414_10365614 3300032004 Bacteria 1243
482 Ga0307411_10045891 3300032005 Bacteria 2813
483 Ga0307411_10143744 3300032005 Bacteria 1763
484 Ga0307415_100013417 3300032126 Bacteria 4785
485 Ga0307507_10038131 3300033179 Bacteria 4878
486 Ga0307510_10003542 3300033180 Bacteria 18212
487 Ga0307510_10079638 3300033180 Bacteria 3193
488 Ga0307510_10249954 3300033180 Bacteria 1261
489 Ga0373943_0068861 3300035170 Bacteria 1788
490 Ga0373946_0118093 3300035171 Bacteria 1208
491 Ga0373955_0018125 3300035172 Bacteria 3496
492 Ga0373935_0050688 3300035692 Bacteria 2635
493 Ga0373935_0203829 3300035692 Bacteria 1368
494 Ga0373935_0330084 3300035692 Bacteria 1084
495 Ga0373927_0240151 3300035695 Bacteria 1191
496 Ga0373947_0011021 3300035725 Bacteria 5187
497 Ga0373937_0012463 3300036401 Bacteria 7480
498 Ga0373937_0041722 3300036401 Bacteria 4186
499 Ga0373937_0056460 3300036401 Bacteria 3606
500 Ga0373925_0002589 3300037068 Bacteria 14381
501 Ga0373925_0260885 3300037068 Bacteria 1392
502 Ga0373925_0289313 3300037068 Bacteria 1321
503 Ga0395899_0003396 3300037312 Bacteria 12636
504 Ga0395900_0576401 3300037418 Bacteria 1067
505 Ga0395898_0015141 3300037466 Bacteria 7916
506 Ga0395898_0322622 3300037466 Bacteria 1473
507 Ga0395905_0034539 3300037471 Bacteria 4748
508 Ga0395905_0189175 3300037471 Bacteria 1931
509 Ga0395901_0145388 3300038443 Bacteria 2492
510 Ga0395901_0162681 3300038443 Bacteria 2344
511 Ga0451793_0508741 3300041452 Bacteria 2127
512 Ga0451795_0519482 3300041456 Bacteria 4041
513 Ga0451798_0411187 3300041458 Bacteria 1151
514 Ga0451800_0879857 3300041459 Bacteria 2460
515 Ga0451804_1035411 3300041463 Bacteria 2196
516 Ga0451833_0104380 3300041491 Bacteria 1539
517 Ga0451853_0471898 3300041512 Bacteria 1035
518 Ga0451577_0052512 3300042876 Bacteria 3639
519 Ga0451577_0115280 3300042876 Bacteria 2405
520 Ga0466972_0000285 3300044658 Bacteria 31510
521 Ga0453683_0021466 3300044673 Bacteria 4123
522 Ga0453683_0058416 3300044673 Bacteria 2413
523 Ga0453684_0001928 3300044712 Bacteria 53626
524 Ga0453684_0377689 3300044712 Bacteria 1592
525 Ga0453684_0428899 3300044712 Bacteria 1475
526 Ga0451576_0000057 3300045051 Bacteria 300798
527 Ga0451576_0022955 3300045051 Bacteria 6761
528 Ga0451576_0151313 3300045051 Bacteria 2420
529 Ga0451576_0501894 3300045051 Bacteria 1275
530 Ga0466967_0490440 3300045976 Bacteria 1205
531 Ga0495592_0000237 3300046454 Bacteria 47510
532 Ga0495592_0123683 3300046454 Bacteria 1817
533 Ga0495653_0057307 3300046463 Bacteria 2966
534 Ga0495650_0048024 3300046471 Bacteria 1781
535 Ga0495664_0081029 3300046477 Bacteria 1946
536 Ga0495664_0117245 3300046477 Bacteria 1610
537 Ga0495610_0033947 3300046512 Bacteria 2632
538 Ga0495610_0055012 3300046512 Bacteria 1920
539 Ga0495620_0072242 3300046515 Bacteria 1409
540 Ga0495628_0034745 3300046516 Bacteria 4054
541 Ga0495628_0142321 3300046516 Bacteria 1830
542 Ga0495630_0360372 3300046517 Bacteria 1113
543 Ga0495632_0004239 3300046519 Bacteria 9798
544 Ga0495648_0098074 3300046524 Bacteria 1624
545 Ga0495598_0022132 3300046537 Bacteria 1698
546 Ga0495597_0007887 3300046542 Bacteria 5368
547 Ga0495645_0002535 3300046543 Bacteria 12403
548 Ga0495645_0040954 3300046543 Bacteria 3378
549 Ga0495645_0179794 3300046543 Bacteria 1450
550 Ga0495667_0005229 3300046559 Bacteria 8773
551 Ga0495625_0000250 3300046660 Bacteria 84096
552 Ga0495625_0002839 3300046660 Bacteria 18202
553 Ga0495625_0031472 3300046660 Bacteria 3946
554 Ga0495635_0110054 3300046663 Bacteria 1882
555 Ga0495599_0146695 3300046678 Bacteria 1462
556 Ga0495623_0046037 3300046679 Bacteria 2769
557 Ga0495658_0031936 3300046683 Bacteria 2872
558 Ga0495658_0032504 3300046683 Bacteria 2850
559 Ga0495658_0034335 3300046683 Bacteria 2783
560 Ga0495670_0156607 3300046691 Bacteria 1196
561 Ga0495604_0268337 3300047317 Bacteria 1157
562 Ga0495687_002606 3300047443 Bacteria 14175
563 Ga0495684_0084397 3300047471 Bacteria 2409
564 Ga0495686_0094368 3300047472 Bacteria 1813
565 Ga0496100_0001162 3300048903 Bacteria 12807
566 Ga0496101_0020120 3300048904 Bacteria 4564
567 Ga0496102_0029174 3300048905 Bacteria 4934
568 Ga0496103_0005038 3300048906 Bacteria 7969
569 Ga0496104_0003675 3300048907 Bacteria 13249
570 Ga0496104_0035846 3300048907 Bacteria 4634
571 Ga0496104_0055651 3300048907 Bacteria 3741
572 Ga0496105_0002647 3300048908 Bacteria 13035
573 Ga0496105_0089552 3300048908 Bacteria 2542
574 Ga0496106_0032767 3300048909 Bacteria 3875
575 Ga0496107_0201136 3300048910 Bacteria 1481
576 Ga0496108_0058761 3300048911 Bacteria 3233
577 Ga0496108_0350437 3300048911 Bacteria 1288
578 Ga0496109_0026669 3300048912 Bacteria 5155
579 Ga0496109_0126638 3300048912 Bacteria 2382
580 Ga0496110_0014667 3300048913 Bacteria 6514
581 Ga0496110_0052513 3300048913 Bacteria 3581
582 Ga0496111_0057811 3300048914 Bacteria 2807
583 Ga0496111_0218216 3300048914 Bacteria 1417
584 Ga0496112_0270675 3300048915 Bacteria 1647
585 Ga0496114_0157070 3300048917 Bacteria 1975
586 Ga0501292_000357 3300049515 Bacteria 6218
587 Ga0501301_004255 3300049524 Bacteria 1011
588 Ga0501043_0000243 3300049579 Bacteria 49191
589 Ga0501046_0000137 3300049580 Bacteria 78496
590 Ga0501047_0000050 3300049581 Bacteria 155628
591 Ga0501047_0020948 3300049581 Bacteria 6280
592 Ga0501048_0000518 3300049582 Bacteria 27066
593 Ga0501069_0001560 3300049585 Bacteria 11324
594 Ga0501070_0097158 3300049586 Bacteria 2436
595 Ga0501073_0084572 3300049589 Bacteria 2207
596 Ga0501074_0173749 3300049590 Bacteria 1537
597 Ga0501206_005704 3300049653 Bacteria 1606
598 Ga0501079_0038777 3300049741 Bacteria 3674
599 Ga0501083_0074131 3300049744 Bacteria 2261
600 Ga0501265_001586 3300049762 Bacteria 2558
601 Ga0501044_0414340 3300049823 Bacteria 1258
602 Ga0501045_0006004 3300049824 Bacteria 8405
603 nmdc:mga03n38_24185_c1 3300050490 Bacteria 2481
604 nmdc:mga00v17_10750_c1 3300050491 Bacteria 5014
605 nmdc:mga0k408_1828_c1 3300050493 Bacteria 3176
606 nmdc:mga0k408_40930_c1 3300050493 Bacteria 2668
607 nmdc:mga0k408_65527_c1 3300050493 Bacteria 2115
608 nmdc:mga0k408_87409_c1 3300050493 Bacteria 1831
609 nmdc:mga07m45_113000_c1 3300050496 Bacteria 1565
610 nmdc:mga07m45_32625_c1 3300050496 Bacteria 2484
611 nmdc:mga07m45_4349_c1 3300050496 Bacteria 6930
612 nmdc:mga07m45_84521_c1 3300050496 Bacteria 1815
613 nmdc:mga07m45_93090_c1 3300050496 Bacteria 1728
614 nmdc:mga05p37_44213_c1 3300050507 Bacteria 5480
615 nmdc:mga08y16_346981_c1 3300050511 Bacteria 1525
616 nmdc:mga0sz30_92501_c1 3300050516 Bacteria 1317
617 Ga0500578_0000437 3300053086 Bacteria 51031
618 Ga0500644_0001746 3300053088 Bacteria 5626
619 Ga0500651_0097581 3300053093 Bacteria 1805
620 Ga0500562_029872 3300053108 Bacteria 1435
621 Ga0500594_0001437 3300053118 Bacteria 5165
622 Ga0500628_004814 3300053129 Bacteria 2239
623 Ga0500642_0004133 3300053130 Bacteria 4493
624 Ga0500652_000312 3300053131 Bacteria 17547
625 Ga0500559_0000602 3300053136 Bacteria 24517
626 Ga0500568_0018889 3300053139 Bacteria 3007
627 Ga0500622_0000164 3300053156 Bacteria 70630
628 Ga0500622_0017664 3300053156 Bacteria 3796
629 Ga0500587_006521 3300053739 Bacteria 1544
630 Ga0500587_008828 3300053739 Bacteria 1294

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100249168 Ga0070671_1002491682 280
2 3300005356 Ga0070674_100020342 Ga0070674_1000203422 284
3 3300025937 Ga0207669_10158667 Ga0207669_101586672 285
4 3300005618 Ga0068864_100032186 Ga0068864_1000321862 286
5 3300025940 Ga0207691_10055754 Ga0207691_100557543 286
6 3300031995 Ga0307409_100089816 Ga0307409_1000898162 286
7 3300005328 Ga0070676_10234980 Ga0070676_102349801 287
8 3300005331 Ga0070670_100119934 Ga0070670_1001199342 287
9 3300005333 Ga0070677_10019165 Ga0070677_100191652 287
10 3300005459 Ga0068867_100246319 Ga0068867_1002463192 287
11 3300005548 Ga0070665_100184077 Ga0070665_1001840771 287
12 3300005563 Ga0068855_100297315 Ga0068855_1002973151 287
13 3300025901 Ga0207688_10008890 Ga0207688_100088904 287
14 3300025936 Ga0207670_10164825 Ga0207670_101648252 287
15 3300025940 Ga0207691_10117408 Ga0207691_101174083 287
16 3300025960 Ga0207651_10056669 Ga0207651_100566693 287
17 3300028794 Ga0307515_10112578 Ga0307515_101125782 287
18 3300049581 Ga0501047_0020948 Ga0501047_0020948_101_1069 287
19 3300049585 Ga0501069_0001560 Ga0501069_0001560_10225_11193 287
20 3300049589 Ga0501073_0084572 Ga0501073_0084572_550_1518 287
21 3300049823 Ga0501044_0414340 Ga0501044_0414340_37_1005 287
22 3300050511 nmdc:mga08y16_346981_c1 nmdc:mga08y16_346981_c1_424_1416 287
23 3300053108 Ga0500562_029872 Ga0500562_029872_78_1043 287
24 3300005330 Ga0070690_100094564 Ga0070690_1000945643 290
25 3300009176 Ga0105242_10301046 Ga0105242_103010462 290
26 3300009177 Ga0105248_10014904 Ga0105248_100149046 290
27 3300009551 Ga0105238_10209623 Ga0105238_102096233 290
28 3300013296 Ga0157374_10156302 Ga0157374_101563022 290
29 3300014745 Ga0157377_10011668 Ga0157377_100116683 290
30 3300025922 Ga0207646_10263396 Ga0207646_102633962 290
31 3300025927 Ga0207687_10080561 Ga0207687_100805612 290
32 3300025936 Ga0207670_10133540 Ga0207670_101335402 290
33 3300025941 Ga0207711_10096022 Ga0207711_100960223 290
34 3300025941 Ga0207711_10335657 Ga0207711_103356572 290
35 3300035172 Ga0373955_0018125 Ga0373955_0018125_94_1062 290
36 3300035692 Ga0373935_0330084 Ga0373935_0330084_82_1050 290
37 3300046454 Ga0495592_0123683 Ga0495592_0123683_127_1095 290
38 3300046463 Ga0495653_0057307 Ga0495653_0057307_671_1639 290
39 3300046477 Ga0495664_0081029 Ga0495664_0081029_575_1543 290
40 3300046516 Ga0495628_0034745 Ga0495628_0034745_234_1202 290
41 3300046543 Ga0495645_0002535 Ga0495645_0002535_4735_5703 290
42 3300046559 Ga0495667_0005229 Ga0495667_0005229_2962_3930 290
43 3300046678 Ga0495599_0146695 Ga0495599_0146695_391_1359 290
44 3300046679 Ga0495623_0046037 Ga0495623_0046037_1224_2192 290
45 3300003773 Ga0055537_1000011 Ga0055537_10000116 292
46 3300003784 Ga0055534_1000020 Ga0055534_1000020129 292
47 3300003790 Ga0055528_1000523 Ga0055528_100052328 292
48 3300005468 Ga0070707_100114145 Ga0070707_1001141453 292
49 3300005546 Ga0070696_100014115 Ga0070696_1000141152 292
50 3300006353 Ga0075370_10003454 Ga0075370_100034546 292
51 3300006948 Ga0099826_10000157 Ga0099826_1000015726 292
52 3300025263 Ga0209565_1000058 Ga0209565_1000058168 292
53 3300025273 Ga0209673_1000053 Ga0209673_1000053244 292
54 3300025291 Ga0209675_1000010 Ga0209675_1000010525 292
55 3300025292 Ga0209676_1016058 Ga0209676_10160582 292
56 3300025294 Ga0209025_1008535 Ga0209025_10085353 292
57 3300027666 Ga0209282_1000879 Ga0209282_100087910 292
58 3300046660 Ga0495625_0000250 Ga0495625_0000250_2828_3796 292
59 3300005333 Ga0070677_10023781 Ga0070677_100237812 293
60 3300028379 Ga0268266_10359904 Ga0268266_103599042 293
61 3300009093 Ga0105240_10566180 Ga0105240_105661802 294
62 3300048911 Ga0496108_0350437 Ga0496108_0350437_158_1126 294
63 3300049586 Ga0501070_0097158 Ga0501070_0097158_1425_2393 294
64 3300049590 Ga0501074_0173749 Ga0501074_0173749_129_1097 294
65 3300049741 Ga0501079_0038777 Ga0501079_0038777_1389_2357 294
66 3300049744 Ga0501083_0074131 Ga0501083_0074131_1171_2139 294
67 3300005295 Ga0065707_10086252 Ga0065707_100862525 295
68 3300005563 Ga0068855_100022146 Ga0068855_1000221469 295
69 3300009093 Ga0105240_10427033 Ga0105240_104270331 295
70 3300013307 Ga0157372_10113334 Ga0157372_101133342 295
71 3300025949 Ga0207667_10409578 Ga0207667_104095782 295
72 3300045976 Ga0466967_0490440 Ga0466967_0490440_79_1047 295
73 3300037466 Ga0395898_0015141 Ga0395898_0015141_6963_7856 296
74 3300047317 Ga0495604_0268337 Ga0495604_0268337_26_994 296
75 3300005438 Ga0070701_10085078 Ga0070701_100850782 297
76 3300005564 Ga0070664_100180954 Ga0070664_1001809542 297
77 3300044712 Ga0453684_0428899 Ga0453684_0428899_397_1422 297
78 3300005844 Ga0068862_100113991 Ga0068862_1001139913 299
79 3300006051 Ga0075364_10080287 Ga0075364_100802872 299
80 3300007265 Ga0099794_10002963 Ga0099794_100029633 299
81 3300025942 Ga0207689_10114270 Ga0207689_101142703 299
82 3300027671 Ga0209588_1003800 Ga0209588_10038003 299
83 3300031901 Ga0307406_10146871 Ga0307406_101468711 299
84 3300031995 Ga0307409_100003227 Ga0307409_1000032278 299
85 3300032126 Ga0307415_100013417 Ga0307415_1000134173 299
86 3300050491 nmdc:mga00v17_10750_c1 nmdc:mga00v17_10750_c1_3456_4454 299
87 3300006177 Ga0075362_10024666 Ga0075362_100246662 300
88 3300025901 Ga0207688_10062569 Ga0207688_100625693 300
89 3300025914 Ga0207671_10057337 Ga0207671_100573373 300
90 3300025933 Ga0207706_10021166 Ga0207706_100211667 300
91 3300025933 Ga0207706_10038451 Ga0207706_100384512 300
92 3300026142 Ga0207698_10154570 Ga0207698_101545702 300
93 3300037068 Ga0373925_0002589 Ga0373925_0002589_11359_12468 300
94 3300005338 Ga0068868_100004726 Ga0068868_1000047268 301
95 3300005338 Ga0068868_100038261 Ga0068868_1000382613 301
96 3300005339 Ga0070660_100155198 Ga0070660_1001551981 301
97 3300005340 Ga0070689_100031651 Ga0070689_1000316515 301
98 3300005344 Ga0070661_100177986 Ga0070661_1001779861 301
99 3300005347 Ga0070668_100027181 Ga0070668_1000271813 301
100 3300005353 Ga0070669_100001968 Ga0070669_1000019684 301
101 3300005354 Ga0070675_100005625 Ga0070675_1000056253 301
102 3300005356 Ga0070674_100350084 Ga0070674_1003500841 301
103 3300005365 Ga0070688_100122829 Ga0070688_1001228292 301
104 3300005366 Ga0070659_100008351 Ga0070659_1000083516 301
105 3300005367 Ga0070667_100004472 Ga0070667_1000044727 301
106 3300005457 Ga0070662_100001468 Ga0070662_10000146813 301
107 3300005459 Ga0068867_100018725 Ga0068867_1000187253 301
108 3300005459 Ga0068867_100132776 Ga0068867_1001327761 301
109 3300005466 Ga0070685_10005883 Ga0070685_100058837 301
110 3300005535 Ga0070684_100098116 Ga0070684_1000981162 301
111 3300005543 Ga0070672_100011945 Ga0070672_1000119454 301
112 3300005543 Ga0070672_100096113 Ga0070672_1000961133 301
113 3300005544 Ga0070686_100025147 Ga0070686_1000251473 301
114 3300005564 Ga0070664_100121416 Ga0070664_1001214162 301
115 3300005616 Ga0068852_100017057 Ga0068852_1000170573 301
116 3300005616 Ga0068852_100026411 Ga0068852_1000264113 301
117 3300005616 Ga0068852_100036243 Ga0068852_1000362434 301
118 3300005617 Ga0068859_100072262 Ga0068859_1000722624 301
119 3300005617 Ga0068859_100100370 Ga0068859_1001003702 301
120 3300005617 Ga0068859_100108378 Ga0068859_1001083784 301
121 3300005718 Ga0068866_10056518 Ga0068866_100565183 301
122 3300005719 Ga0068861_100004400 Ga0068861_1000044002 301
123 3300005719 Ga0068861_100021163 Ga0068861_1000211633 301
124 3300005834 Ga0068851_10038084 Ga0068851_100380842 301
125 3300005841 Ga0068863_100006090 Ga0068863_1000060907 301
126 3300005842 Ga0068858_100001935 Ga0068858_1000019354 301
127 3300005842 Ga0068858_100031848 Ga0068858_1000318483 301
128 3300005843 Ga0068860_100000605 Ga0068860_10000060514 301
129 3300005843 Ga0068860_100001949 Ga0068860_10000194916 301
130 3300005844 Ga0068862_100047762 Ga0068862_1000477624 301
131 3300006237 Ga0097621_100119759 Ga0097621_1001197593 301
132 3300006237 Ga0097621_100341436 Ga0097621_1003414362 301
133 3300006881 Ga0068865_100342528 Ga0068865_1003425282 301
134 3300006931 Ga0097620_100072264 Ga0097620_1000722644 301
135 3300006931 Ga0097620_100100368 Ga0097620_1001003683 301
136 3300006931 Ga0097620_100108379 Ga0097620_1001083791 301
137 3300009093 Ga0105240_10507864 Ga0105240_105078642 301
138 3300009098 Ga0105245_10365519 Ga0105245_103655191 301
139 3300009148 Ga0105243_10017179 Ga0105243_100171793 301
140 3300009148 Ga0105243_10096542 Ga0105243_100965422 301
141 3300009174 Ga0105241_10044466 Ga0105241_100444663 301
142 3300009176 Ga0105242_10010661 Ga0105242_100106613 301
143 3300009176 Ga0105242_10023954 Ga0105242_100239544 301
144 3300009551 Ga0105238_10160530 Ga0105238_101605303 301
145 3300009551 Ga0105238_10540303 Ga0105238_105403031 301
146 3300009553 Ga0105249_10038932 Ga0105249_100389323 301
147 3300013100 Ga0157373_10050849 Ga0157373_100508493 301
148 3300013102 Ga0157371_10148154 Ga0157371_101481542 301
149 3300013306 Ga0163162_10007037 Ga0163162_100070373 301
150 3300013306 Ga0163162_10028873 Ga0163162_100288734 301
151 3300013306 Ga0163162_10033703 Ga0163162_100337033 301
152 3300013306 Ga0163162_10229351 Ga0163162_102293513 301
153 3300013307 Ga0157372_10104054 Ga0157372_101040543 301
154 3300013308 Ga0157375_10003084 Ga0157375_1000308414 301
155 3300013308 Ga0157375_10082795 Ga0157375_100827954 301
156 3300013308 Ga0157375_10106295 Ga0157375_101062953 301
157 3300013308 Ga0157375_10224419 Ga0157375_102244192 301
158 3300014326 Ga0157380_10027756 Ga0157380_100277564 301
159 3300014326 Ga0157380_10089863 Ga0157380_100898632 301
160 3300014326 Ga0157380_10509252 Ga0157380_105092521 301
161 3300014968 Ga0157379_10036974 Ga0157379_100369743 301
162 3300025321 Ga0207656_10027818 Ga0207656_100278183 301
163 3300025893 Ga0207682_10019175 Ga0207682_100191752 301
164 3300025899 Ga0207642_10007733 Ga0207642_100077333 301
165 3300025901 Ga0207688_10078859 Ga0207688_100788592 301
166 3300025903 Ga0207680_10034428 Ga0207680_100344283 301
167 3300025907 Ga0207645_10064111 Ga0207645_100641113 301
168 3300025909 Ga0207705_10150517 Ga0207705_101505171 301
169 3300025913 Ga0207695_10444384 Ga0207695_104443841 301
170 3300025918 Ga0207662_10016139 Ga0207662_100161393 301
171 3300025923 Ga0207681_10000893 Ga0207681_100008934 301
172 3300025924 Ga0207694_10233034 Ga0207694_102330342 301
173 3300025924 Ga0207694_10353159 Ga0207694_103531591 301
174 3300025926 Ga0207659_10023895 Ga0207659_100238955 301
175 3300025926 Ga0207659_10047702 Ga0207659_100477022 301
176 3300025926 Ga0207659_10428809 Ga0207659_104288091 301
177 3300025932 Ga0207690_10022184 Ga0207690_100221842 301
178 3300025932 Ga0207690_10317396 Ga0207690_103173962 301
179 3300025934 Ga0207686_10010321 Ga0207686_100103212 301
180 3300025935 Ga0207709_10014157 Ga0207709_100141573 301
181 3300025938 Ga0207704_10050264 Ga0207704_100502641 301
182 3300025940 Ga0207691_10029152 Ga0207691_100291522 301
183 3300025940 Ga0207691_10122572 Ga0207691_101225722 301
184 3300025941 Ga0207711_10148439 Ga0207711_101484393 301
185 3300025942 Ga0207689_10024677 Ga0207689_100246774 301
186 3300025942 Ga0207689_10036423 Ga0207689_100364233 301
187 3300025942 Ga0207689_10146849 Ga0207689_101468492 301
188 3300025944 Ga0207661_10082073 Ga0207661_100820733 301
189 3300025945 Ga0207679_10009947 Ga0207679_100099475 301
190 3300025960 Ga0207651_10101788 Ga0207651_101017882 301
191 3300025972 Ga0207668_10030011 Ga0207668_100300114 301
192 3300025981 Ga0207640_10117148 Ga0207640_101171482 301
193 3300025986 Ga0207658_10005885 Ga0207658_100058854 301
194 3300026023 Ga0207677_10029828 Ga0207677_100298282 301
195 3300026023 Ga0207677_10052530 Ga0207677_100525302 301
196 3300026023 Ga0207677_10057076 Ga0207677_100570763 301
197 3300026035 Ga0207703_10014214 Ga0207703_100142143 301
198 3300026035 Ga0207703_10062874 Ga0207703_100628743 301
199 3300026041 Ga0207639_10031455 Ga0207639_100314553 301
200 3300026067 Ga0207678_10035031 Ga0207678_100350313 301
201 3300026067 Ga0207678_10155496 Ga0207678_101554962 301
202 3300026075 Ga0207708_10006045 Ga0207708_100060454 301
203 3300026075 Ga0207708_10006674 Ga0207708_100066744 301
204 3300026075 Ga0207708_10105796 Ga0207708_101057962 301
205 3300026078 Ga0207702_10085468 Ga0207702_100854681 301
206 3300026088 Ga0207641_10031857 Ga0207641_100318574 301
207 3300026089 Ga0207648_10008565 Ga0207648_100085654 301
208 3300026089 Ga0207648_10012331 Ga0207648_100123314 301
209 3300026089 Ga0207648_10069390 Ga0207648_100693902 301
210 3300026095 Ga0207676_10002235 Ga0207676_100022353 301
211 3300026095 Ga0207676_10059604 Ga0207676_100596044 301
212 3300026095 Ga0207676_10472657 Ga0207676_104726571 301
213 3300026116 Ga0207674_10066233 Ga0207674_100662332 301
214 3300026116 Ga0207674_10069225 Ga0207674_100692253 301
215 3300026118 Ga0207675_100019410 Ga0207675_1000194104 301
216 3300026118 Ga0207675_100022443 Ga0207675_1000224433 301
217 3300026118 Ga0207675_100044234 Ga0207675_1000442342 301
218 3300026121 Ga0207683_10252589 Ga0207683_102525892 301
219 3300026142 Ga0207698_10009254 Ga0207698_100092543 301
220 3300026142 Ga0207698_10012799 Ga0207698_100127993 301
221 3300026142 Ga0207698_10085949 Ga0207698_100859493 301
222 3300028380 Ga0268265_10018678 Ga0268265_100186782 301
223 3300028380 Ga0268265_10051971 Ga0268265_100519713 301
224 3300028381 Ga0268264_10010213 Ga0268264_100102134 301
225 3300028381 Ga0268264_10034120 Ga0268264_100341203 301
226 3300035695 Ga0373927_0240151 Ga0373927_0240151_148_1119 301
227 3300048907 Ga0496104_0055651 Ga0496104_0055651_2323_3294 301
228 3300048910 Ga0496107_0201136 Ga0496107_0201136_47_1096 301
229 3300048911 Ga0496108_0058761 Ga0496108_0058761_177_1226 301
230 3300048912 Ga0496109_0026669 Ga0496109_0026669_1540_2589 301
231 3300048913 Ga0496110_0014667 Ga0496110_0014667_1927_2898 301
232 3300048914 Ga0496111_0218216 Ga0496111_0218216_18_989 301
233 3300048915 Ga0496112_0270675 Ga0496112_0270675_524_1573 301
234 3300005354 Ga0070675_100038647 Ga0070675_1000386472 302
235 3300005355 Ga0070671_100152527 Ga0070671_1001525272 302
236 3300005367 Ga0070667_100037047 Ga0070667_1000370473 302
237 3300005539 Ga0068853_100172161 Ga0068853_1001721612 302
238 3300005543 Ga0070672_100011563 Ga0070672_1000115633 302
239 3300005614 Ga0068856_100043926 Ga0068856_1000439262 302
240 3300005617 Ga0068859_100161085 Ga0068859_1001610853 302
241 3300005719 Ga0068861_100062590 Ga0068861_1000625903 302
242 3300005841 Ga0068863_100023505 Ga0068863_1000235054 302
243 3300005841 Ga0068863_100045005 Ga0068863_1000450054 302
244 3300005842 Ga0068858_100108964 Ga0068858_1001089642 302
245 3300005843 Ga0068860_100018751 Ga0068860_1000187513 302
246 3300006237 Ga0097621_100115403 Ga0097621_1001154032 302
247 3300006931 Ga0097620_100161093 Ga0097620_1001610933 302
248 3300009177 Ga0105248_10154638 Ga0105248_101546382 302
249 3300009177 Ga0105248_10228499 Ga0105248_102284991 302
250 3300013105 Ga0157369_10033694 Ga0157369_100336943 302
251 3300013306 Ga0163162_10013137 Ga0163162_100131373 302
252 3300013306 Ga0163162_10263873 Ga0163162_102638733 302
253 3300013308 Ga0157375_10113993 Ga0157375_101139933 302
254 3300025919 Ga0207657_10157087 Ga0207657_101570872 302
255 3300025920 Ga0207649_10039911 Ga0207649_100399113 302
256 3300025926 Ga0207659_10021252 Ga0207659_100212522 302
257 3300025940 Ga0207691_10014086 Ga0207691_100140863 302
258 3300025986 Ga0207658_10028137 Ga0207658_100281373 302
259 3300026035 Ga0207703_10054103 Ga0207703_100541033 302
260 3300026088 Ga0207641_10052397 Ga0207641_100523971 302
261 3300026118 Ga0207675_100061012 Ga0207675_1000610123 302
262 3300026142 Ga0207698_10105396 Ga0207698_101053962 302
263 3300028381 Ga0268264_10036216 Ga0268264_100362165 302
264 3300031456 Ga0307513_10290646 Ga0307513_102906462 302
265 iso_pu_bacteria 2643221672 2644396628 303
266 3300005530 Ga0070679_100105012 Ga0070679_1001050124 304
267 3300025921 Ga0207652_10060606 Ga0207652_100606061 304
268 3300026121 Ga0207683_10121829 Ga0207683_101218292 304
269 3300031824 Ga0307413_10359672 Ga0307413_103596721 304
270 3300031852 Ga0307410_10228370 Ga0307410_102283702 304
271 3300041458 Ga0451798_0411187 Ga0451798_0411187_18_968 304
272 3300003791 Ga0055530_10010170 Ga0055530_100101704 305
273 3300003792 Ga0055540_1004422 Ga0055540_10044225 305
274 3300003794 Ga0055531_10006773 Ga0055531_100067735 305
275 3300005288 Ga0065714_10148141 Ga0065714_101481411 305
276 3300005335 Ga0070666_10078188 Ga0070666_100781882 305
277 3300005844 Ga0068862_100161432 Ga0068862_1001614323 305
278 3300013104 Ga0157370_10297900 Ga0157370_102979001 305
279 3300013306 Ga0163162_10056547 Ga0163162_100565474 305
280 3300013308 Ga0157375_10249409 Ga0157375_102494092 305
281 3300014497 Ga0182008_10001113 Ga0182008_1000111321 305
282 3300015262 Ga0182007_10003841 Ga0182007_100038415 305
283 3300025292 Ga0209676_1002070 Ga0209676_100207012 305
284 3300025298 Ga0209050_1001209 Ga0209050_100120926 305
285 3300025303 Ga0209051_1000145 Ga0209051_1000145129 305
286 3300025304 Ga0209257_1000495 Ga0209257_100049552 305
287 3300025893 Ga0207682_10023065 Ga0207682_100230654 305
288 3300025903 Ga0207680_10147539 Ga0207680_101475392 305
289 3300025924 Ga0207694_10266674 Ga0207694_102666742 305
290 3300031238 Ga0265332_10000001 Ga0265332_10000001452 305
291 3300031241 Ga0265325_10004203 Ga0265325_100042032 305
292 3300031247 Ga0265340_10067251 Ga0265340_100672512 305
293 3300031251 Ga0265327_10001296 Ga0265327_100012966 305
294 3300031251 Ga0265327_10009017 Ga0265327_100090176 305
295 3300031711 Ga0265314_10000013 Ga0265314_10000013367 305
296 3300031901 Ga0307406_10006613 Ga0307406_100066135 305
297 3300041512 Ga0451853_0471898 Ga0451853_0471898_57_1025 305
298 3300044712 Ga0453684_0001928 Ga0453684_0001928_7691_8653 305
299 3300048903 Ga0496100_0001162 Ga0496100_0001162_2728_3696 305
300 3300048904 Ga0496101_0020120 Ga0496101_0020120_1500_2468 305
301 3300048905 Ga0496102_0029174 Ga0496102_0029174_2562_3530 305
302 3300048906 Ga0496103_0005038 Ga0496103_0005038_2189_3157 305
303 3300048907 Ga0496104_0003675 Ga0496104_0003675_4204_5172 305
304 3300048908 Ga0496105_0002647 Ga0496105_0002647_7981_8949 305
305 3300048909 Ga0496106_0032767 Ga0496106_0032767_2810_3778 305
306 3300048913 Ga0496110_0052513 Ga0496110_0052513_2072_3040 305
307 3300048914 Ga0496111_0057811 Ga0496111_0057811_226_1194 305
308 3300049579 Ga0501043_0000243 Ga0501043_0000243_27107_28075 305
309 3300049580 Ga0501046_0000137 Ga0501046_0000137_32403_33371 305
310 3300049581 Ga0501047_0000050 Ga0501047_0000050_133786_134754 305
311 3300049582 Ga0501048_0000518 Ga0501048_0000518_22721_23689 305
312 3300049824 Ga0501045_0006004 Ga0501045_0006004_6504_7472 305
313 iso_pu_bacteria 2842747753 2842749265 305
314 iso_pu_bacteria 2891633521 2891634391 306
315 3300005327 Ga0070658_10001451 Ga0070658_1000145110 307
316 3300005336 Ga0070680_100343857 Ga0070680_1003438572 307
317 3300025909 Ga0207705_10042174 Ga0207705_100421741 307
318 3300031344 Ga0265316_10040119 Ga0265316_100401193 307
319 3300035171 Ga0373946_0118093 Ga0373946_0118093_194_1165 307
320 3300035692 Ga0373935_0050688 Ga0373935_0050688_924_1895 307
321 3300035725 Ga0373947_0011021 Ga0373947_0011021_1643_2614 307
322 3300037312 Ga0395899_0003396 Ga0395899_0003396_1787_2770 307
323 3300037418 Ga0395900_0576401 Ga0395900_0576401_26_1009 307
324 3300037471 Ga0395905_0034539 Ga0395905_0034539_352_1335 307
325 3300038443 Ga0395901_0145388 Ga0395901_0145388_442_1425 307
326 3300042876 Ga0451577_0052512 Ga0451577_0052512_1781_2749 307
327 3300042876 Ga0451577_0115280 Ga0451577_0115280_46_1017 307
328 3300044673 Ga0453683_0021466 Ga0453683_0021466_1405_2373 307
329 3300045051 Ga0451576_0000057 Ga0451576_0000057_224777_225745 307
330 iso_pu_bacteria 2585428062 2587754453 307
331 3300005548 Ga0070665_100175402 Ga0070665_1001754022 308
332 3300006048 Ga0075363_100038545 Ga0075363_1000385452 308
333 3300028794 Ga0307515_10000103 Ga0307515_10000103123 308
334 3300050490 nmdc:mga03n38_24185_c1 nmdc:mga03n38_24185_c1_1385_2350 308
335 iso_pu_bacteria 2585428057 2587730117 308
336 iso_pu_bacteria 2585428058 2587734852 308
337 iso_pu_bacteria 2588253510 2588293190 308
338 iso_pu_bacteria 2643221592 2643968424 308
339 iso_pu_bacteria 2643221625 2644141784 308
340 iso_pu_bacteria 2643221648 2644272546 308
341 iso_pu_bacteria 2643221654 2644302705 308
342 3300005328 Ga0070676_10016860 Ga0070676_100168604 309
343 3300005331 Ga0070670_100000316 Ga0070670_10000031628 309
344 3300005333 Ga0070677_10000457 Ga0070677_100004575 309
345 3300005354 Ga0070675_100000480 Ga0070675_1000004809 309
346 3300005355 Ga0070671_100000734 Ga0070671_1000007349 309
347 3300005364 Ga0070673_100001230 Ga0070673_1000012302 309
348 3300005456 Ga0070678_100013895 Ga0070678_1000138954 309
349 3300005459 Ga0068867_100000712 Ga0068867_10000071218 309
350 3300005543 Ga0070672_100000206 Ga0070672_1000002064 309
351 3300005618 Ga0068864_100010783 Ga0068864_1000107834 309
352 3300005841 Ga0068863_100238613 Ga0068863_1002386131 309
353 3300005937 Ga0081455_10074649 Ga0081455_100746493 309
354 3300006237 Ga0097621_100091348 Ga0097621_1000913482 309
355 3300006353 Ga0075370_10010143 Ga0075370_100101434 309
356 3300006358 Ga0068871_100057060 Ga0068871_1000570602 309
357 3300009148 Ga0105243_10079624 Ga0105243_100796242 309
358 3300013308 Ga0157375_10295803 Ga0157375_102958032 309
359 3300017792 Ga0163161_10014680 Ga0163161_100146804 309
360 3300025315 Ga0207697_10013102 Ga0207697_100131023 309
361 3300025893 Ga0207682_10000269 Ga0207682_100002696 309
362 3300025907 Ga0207645_10007282 Ga0207645_100072823 309
363 3300025914 Ga0207671_10131192 Ga0207671_101311921 309
364 3300025925 Ga0207650_10000172 Ga0207650_1000017246 309
365 3300025926 Ga0207659_10000066 Ga0207659_1000006637 309
366 3300025931 Ga0207644_10001237 Ga0207644_1000123715 309
367 3300025940 Ga0207691_10000265 Ga0207691_1000026537 309
368 3300025960 Ga0207651_10000267 Ga0207651_100002678 309
369 3300025972 Ga0207668_10070133 Ga0207668_100701332 309
370 3300026121 Ga0207683_10014997 Ga0207683_100149974 309
371 3300028381 Ga0268264_10084070 Ga0268264_100840703 309
372 3300031456 Ga0307513_10034306 Ga0307513_100343062 309
373 3300031730 Ga0307516_10020929 Ga0307516_100209294 309
374 3300031731 Ga0307405_10254188 Ga0307405_102541882 309
375 3300031911 Ga0307412_10053852 Ga0307412_100538522 309
376 3300032002 Ga0307416_100250242 Ga0307416_1002502422 309
377 3300036401 Ga0373937_0041722 Ga0373937_0041722_3141_4106 309
378 3300046471 Ga0495650_0048024 Ga0495650_0048024_779_1756 309
379 3300046660 Ga0495625_0031472 Ga0495625_0031472_1593_2573 309
380 3300049515 Ga0501292_000357 Ga0501292_000357_4780_5754 309
381 3300049524 Ga0501301_004255 Ga0501301_004255_27_1001 309
382 3300049653 Ga0501206_005704 Ga0501206_005704_51_1025 309
383 3300049762 Ga0501265_001586 Ga0501265_001586_384_1358 309
384 3300050493 nmdc:mga0k408_40930_c1 nmdc:mga0k408_40930_c1_1299_2279 309
385 3300050496 nmdc:mga07m45_32625_c1 nmdc:mga07m45_32625_c1_394_1374 309
386 3300050496 nmdc:mga07m45_84521_c1 nmdc:mga07m45_84521_c1_610_1590 309
387 3300050516 nmdc:mga0sz30_92501_c1 nmdc:mga0sz30_92501_c1_69_1049 309
388 3300003794 Ga0055531_10001135 Ga0055531_100011359 310
389 3300005614 Ga0068856_100064064 Ga0068856_1000640643 310
390 3300005614 Ga0068856_100213561 Ga0068856_1002135613 310
391 3300005841 Ga0068863_100396826 Ga0068863_1003968261 310
392 3300006178 Ga0075367_10122591 Ga0075367_101225912 310
393 3300009098 Ga0105245_10149085 Ga0105245_101490852 310
394 3300009147 Ga0114129_10030937 Ga0114129_100309373 310
395 3300009551 Ga0105238_10331849 Ga0105238_103318492 310
396 3300025273 Ga0209673_1006691 Ga0209673_10066914 310
397 3300025303 Ga0209051_1000136 Ga0209051_1000136112 310
398 3300025304 Ga0209257_1000055 Ga0209257_1000055295 310
399 3300025927 Ga0207687_10120120 Ga0207687_101201203 310
400 3300025942 Ga0207689_10085747 Ga0207689_100857472 310
401 3300026078 Ga0207702_10052022 Ga0207702_100520223 310
402 3300026116 Ga0207674_10081993 Ga0207674_100819932 310
403 3300028786 Ga0307517_10000499 Ga0307517_1000049951 310
404 3300028794 Ga0307515_10000066 Ga0307515_1000006612 310
405 3300028794 Ga0307515_10004991 Ga0307515_100049913 310
406 3300031456 Ga0307513_10097091 Ga0307513_100970913 310
407 3300031649 Ga0307514_10000858 Ga0307514_100008582 310
408 3300031649 Ga0307514_10101368 Ga0307514_101013682 310
409 3300032004 Ga0307414_10365614 Ga0307414_103656141 310
410 3300033180 Ga0307510_10003542 Ga0307510_100035423 310
411 3300037466 Ga0395898_0322622 Ga0395898_0322622_107_1075 310
412 3300037471 Ga0395905_0189175 Ga0395905_0189175_160_1128 310
413 3300038443 Ga0395901_0162681 Ga0395901_0162681_375_1343 310
414 3300044673 Ga0453683_0058416 Ga0453683_0058416_591_1559 310
415 3300044712 Ga0453684_0377689 Ga0453684_0377689_401_1369 310
416 3300045051 Ga0451576_0022955 Ga0451576_0022955_2637_3605 310
417 3300045051 Ga0451576_0151313 Ga0451576_0151313_898_1869 310
418 3300045051 Ga0451576_0501894 Ga0451576_0501894_158_1129 310
419 3300046512 Ga0495610_0033947 Ga0495610_0033947_169_1137 310
420 3300047472 Ga0495686_0094368 Ga0495686_0094368_228_1196 310
421 3300050493 nmdc:mga0k408_65527_c1 nmdc:mga0k408_65527_c1_189_1169 310
422 3300050507 nmdc:mga05p37_44213_c1 nmdc:mga05p37_44213_c1_3239_4210 310
423 3300053088 Ga0500644_0001746 Ga0500644_0001746_843_1811 310
424 3300053118 Ga0500594_0001437 Ga0500594_0001437_2378_3346 310
425 3300053136 Ga0500559_0000602 Ga0500559_0000602_5612_6580 310
426 3300053156 Ga0500622_0017664 Ga0500622_0017664_479_1447 310
427 3300053739 Ga0500587_008828 Ga0500587_008828_275_1243 310
428 3300005331 Ga0070670_100139485 Ga0070670_1001394852 311
429 3300005355 Ga0070671_100014699 Ga0070671_1000146994 311
430 3300005364 Ga0070673_100016138 Ga0070673_1000161383 311
431 3300005455 Ga0070663_100027741 Ga0070663_1000277414 311
432 3300005456 Ga0070678_100047655 Ga0070678_1000476553 311
433 3300005456 Ga0070678_100140328 Ga0070678_1001403282 311
434 3300005616 Ga0068852_100056346 Ga0068852_1000563462 311
435 3300006237 Ga0097621_100131452 Ga0097621_1001314522 311
436 3300009148 Ga0105243_10073714 Ga0105243_100737143 311
437 3300009177 Ga0105248_10031634 Ga0105248_100316344 311
438 3300009177 Ga0105248_10125609 Ga0105248_101256093 311
439 3300013297 Ga0157378_10272705 Ga0157378_102727052 311
440 3300014969 Ga0157376_10470971 Ga0157376_104709712 311
441 3300025925 Ga0207650_10072294 Ga0207650_100722942 311
442 3300025931 Ga0207644_10000306 Ga0207644_100003064 311
443 3300025931 Ga0207644_10090539 Ga0207644_100905392 311
444 3300025981 Ga0207640_10113018 Ga0207640_101130183 311
445 3300026067 Ga0207678_10031930 Ga0207678_100319303 311
446 3300026121 Ga0207683_10051245 Ga0207683_100512451 311
447 3300027876 Ga0209974_10011524 Ga0209974_100115243 311
448 3300028794 Ga0307515_10000366 Ga0307515_1000036640 311
449 3300028794 Ga0307515_10001653 Ga0307515_1000165315 311
450 3300028794 Ga0307515_10037079 Ga0307515_100370792 311
451 3300031507 Ga0307509_10204162 Ga0307509_102041622 311
452 3300031616 Ga0307508_10000107 Ga0307508_100001075 311
453 3300031649 Ga0307514_10012482 Ga0307514_100124822 311
454 3300031730 Ga0307516_10014389 Ga0307516_100143896 311
455 3300033179 Ga0307507_10038131 Ga0307507_100381313 311
456 3300037068 Ga0373925_0289313 Ga0373925_0289313_231_1223 311
457 3300041491 Ga0451833_0104380 Ga0451833_0104380_232_1200 311
458 3300046512 Ga0495610_0055012 Ga0495610_0055012_874_1842 311
459 3300046660 Ga0495625_0002839 Ga0495625_0002839_13979_14947 311
460 3300046683 Ga0495658_0032504 Ga0495658_0032504_419_1414 311
461 3300046691 Ga0495670_0156607 Ga0495670_0156607_114_1097 311
462 3300048907 Ga0496104_0035846 Ga0496104_0035846_1254_2291 311
463 3300048908 Ga0496105_0089552 Ga0496105_0089552_855_1892 311
464 3300048917 Ga0496114_0157070 Ga0496114_0157070_225_1262 311
465 3300050493 nmdc:mga0k408_87409_c1 nmdc:mga0k408_87409_c1_39_1007 311
466 3300050496 nmdc:mga07m45_113000_c1 nmdc:mga07m45_113000_c1_72_1043 311
467 3300050496 nmdc:mga07m45_4349_c1 nmdc:mga07m45_4349_c1_693_1688 311
468 3300050496 nmdc:mga07m45_93090_c1 nmdc:mga07m45_93090_c1_713_1681 311
469 3300053739 Ga0500587_006521 Ga0500587_006521_43_1011 311
470 3300002773 JGI25152J39213_1001748 JGI25152J39213_10017485 312
471 3300003215 JGI25153J46596_10002270 JGI25153J46596_100022709 312
472 3300003215 JGI25153J46596_10006214 JGI25153J46596_100062146 312
473 3300003771 Ga0055526_1002150 Ga0055526_100215010 312
474 3300003791 Ga0055530_10018936 Ga0055530_100189362 312
475 3300005327 Ga0070658_10159367 Ga0070658_101593672 312
476 3300005327 Ga0070658_10278833 Ga0070658_102788332 312
477 3300005328 Ga0070676_10009731 Ga0070676_100097314 312
478 3300005330 Ga0070690_100141676 Ga0070690_1001416762 312
479 3300005331 Ga0070670_100001487 Ga0070670_10000148718 312
480 3300005331 Ga0070670_100055083 Ga0070670_1000550833 312
481 3300005331 Ga0070670_100125593 Ga0070670_1001255932 312
482 3300005331 Ga0070670_100127016 Ga0070670_1001270163 312
483 3300005333 Ga0070677_10022459 Ga0070677_100224592 312
484 3300005334 Ga0068869_100039693 Ga0068869_1000396934 312
485 3300005335 Ga0070666_10022199 Ga0070666_100221993 312
486 3300005338 Ga0068868_100053419 Ga0068868_1000534193 312
487 3300005354 Ga0070675_100010343 Ga0070675_1000103436 312
488 3300005354 Ga0070675_100145213 Ga0070675_1001452133 312
489 3300005364 Ga0070673_100003065 Ga0070673_1000030658 312
490 3300005364 Ga0070673_100062900 Ga0070673_1000629002 312
491 3300005364 Ga0070673_100267796 Ga0070673_1002677961 312
492 3300005366 Ga0070659_100171312 Ga0070659_1001713122 312
493 3300005456 Ga0070678_100009028 Ga0070678_1000090285 312
494 3300005456 Ga0070678_100079341 Ga0070678_1000793412 312
495 3300005457 Ga0070662_100008876 Ga0070662_1000088764 312
496 3300005459 Ga0068867_100037382 Ga0068867_1000373825 312
497 3300005467 Ga0070706_100007432 Ga0070706_1000074325 312
498 3300005467 Ga0070706_100579706 Ga0070706_1005797061 312
499 3300005518 Ga0070699_100149258 Ga0070699_1001492583 312
500 3300005535 Ga0070684_100130410 Ga0070684_1001304103 312
501 3300005539 Ga0068853_100278229 Ga0068853_1002782292 312
502 3300005543 Ga0070672_100011240 Ga0070672_1000112404 312
503 3300005543 Ga0070672_100018687 Ga0070672_1000186873 312
504 3300005543 Ga0070672_100027935 Ga0070672_1000279353 312
505 3300005564 Ga0070664_100112710 Ga0070664_1001127102 312
506 3300005578 Ga0068854_100031831 Ga0068854_1000318312 312
507 3300005616 Ga0068852_100464942 Ga0068852_1004649421 312
508 3300005617 Ga0068859_100023164 Ga0068859_1000231644 312
509 3300005617 Ga0068859_100522698 Ga0068859_1005226981 312
510 3300005618 Ga0068864_100009333 Ga0068864_1000093334 312
511 3300005618 Ga0068864_100150190 Ga0068864_1001501903 312
512 3300005719 Ga0068861_100182325 Ga0068861_1001823252 312
513 3300005842 Ga0068858_100002260 Ga0068858_1000022604 312
514 3300006195 Ga0075366_10007566 Ga0075366_100075665 312
515 3300006195 Ga0075366_10009253 Ga0075366_100092534 312
516 3300006195 Ga0075366_10041050 Ga0075366_100410503 312
517 3300006353 Ga0075370_10015546 Ga0075370_100155463 312
518 3300006358 Ga0068871_100050917 Ga0068871_1000509174 312
519 3300006931 Ga0097620_100023164 Ga0097620_1000231644 312
520 3300006931 Ga0097620_100522709 Ga0097620_1005227091 312
521 3300009098 Ga0105245_10096754 Ga0105245_100967542 312
522 3300009177 Ga0105248_10018996 Ga0105248_100189963 312
523 3300009545 Ga0105237_10257489 Ga0105237_102574892 312
524 3300009553 Ga0105249_10039217 Ga0105249_100392173 312
525 3300011119 Ga0105246_10085345 Ga0105246_100853453 312
526 3300013102 Ga0157371_10091085 Ga0157371_100910853 312
527 3300013308 Ga0157375_10124563 Ga0157375_101245632 312
528 3300013308 Ga0157375_10137673 Ga0157375_101376733 312
529 3300013308 Ga0157375_10154740 Ga0157375_101547404 312
530 3300014325 Ga0163163_10003856 Ga0163163_100038565 312
531 3300014969 Ga0157376_10018710 Ga0157376_100187104 312
532 3300025245 Ga0207425_1000565 Ga0207425_100056513 312
533 3300025258 Ga0209129_1000075 Ga0209129_1000075135 312
534 3300025295 Ga0209564_1000046 Ga0209564_1000046299 312
535 3300025297 Ga0209758_1000045 Ga0209758_1000045300 312
536 3300025297 Ga0209758_1000052 Ga0209758_1000052164 312
537 3300025298 Ga0209050_1000257 Ga0209050_100025761 312
538 3300025304 Ga0209257_1034024 Ga0209257_10340242 312
539 3300025321 Ga0207656_10013182 Ga0207656_100131821 312
540 3300025893 Ga0207682_10030129 Ga0207682_100301291 312
541 3300025893 Ga0207682_10042678 Ga0207682_100426782 312
542 3300025907 Ga0207645_10001304 Ga0207645_1000130411 312
543 3300025907 Ga0207645_10017830 Ga0207645_100178304 312
544 3300025909 Ga0207705_10106755 Ga0207705_101067552 312
545 3300025910 Ga0207684_10009803 Ga0207684_100098033 312
546 3300025925 Ga0207650_10101014 Ga0207650_101010142 312
547 3300025925 Ga0207650_10115048 Ga0207650_101150483 312
548 3300025925 Ga0207650_10157624 Ga0207650_101576243 312
549 3300025926 Ga0207659_10010811 Ga0207659_100108114 312
550 3300025926 Ga0207659_10011107 Ga0207659_100111071 312
551 3300025926 Ga0207659_10030025 Ga0207659_100300253 312
552 3300025926 Ga0207659_10040044 Ga0207659_100400444 312
553 3300025927 Ga0207687_10193728 Ga0207687_101937282 312
554 3300025931 Ga0207644_10020223 Ga0207644_100202234 312
555 3300025932 Ga0207690_10153767 Ga0207690_101537672 312
556 3300025933 Ga0207706_10016770 Ga0207706_100167704 312
557 3300025933 Ga0207706_10035763 Ga0207706_100357632 312
558 3300025936 Ga0207670_10042168 Ga0207670_100421683 312
559 3300025938 Ga0207704_10227465 Ga0207704_102274651 312
560 3300025940 Ga0207691_10009574 Ga0207691_100095744 312
561 3300025940 Ga0207691_10033726 Ga0207691_100337263 312
562 3300025941 Ga0207711_10005620 Ga0207711_100056204 312
563 3300025941 Ga0207711_10013090 Ga0207711_100130904 312
564 3300025942 Ga0207689_10052134 Ga0207689_100521342 312
565 3300025942 Ga0207689_10054545 Ga0207689_100545452 312
566 3300025972 Ga0207668_10014376 Ga0207668_100143764 312
567 3300025981 Ga0207640_10020071 Ga0207640_100200713 312
568 3300026023 Ga0207677_10002328 Ga0207677_100023287 312
569 3300026023 Ga0207677_10015488 Ga0207677_100154885 312
570 3300026023 Ga0207677_10069101 Ga0207677_100691013 312
571 3300026035 Ga0207703_10010895 Ga0207703_100108954 312
572 3300026041 Ga0207639_10148442 Ga0207639_101484422 312
573 3300026088 Ga0207641_10015994 Ga0207641_100159944 312
574 3300026088 Ga0207641_10042940 Ga0207641_100429402 312
575 3300026089 Ga0207648_10002312 Ga0207648_1000231211 312
576 3300026089 Ga0207648_10073241 Ga0207648_100732413 312
577 3300026095 Ga0207676_10020243 Ga0207676_100202434 312
578 3300026095 Ga0207676_10027374 Ga0207676_100273741 312
579 3300026118 Ga0207675_100121237 Ga0207675_1001212371 312
580 3300026118 Ga0207675_100237285 Ga0207675_1002372852 312
581 3300026121 Ga0207683_10026644 Ga0207683_100266444 312
582 3300026121 Ga0207683_10071175 Ga0207683_100711753 312
583 3300026142 Ga0207698_10424174 Ga0207698_104241742 312
584 3300028794 Ga0307515_10035753 Ga0307515_100357536 312
585 3300028794 Ga0307515_10040755 Ga0307515_100407554 312
586 3300028794 Ga0307515_10074011 Ga0307515_100740114 312
587 3300030522 Ga0307512_10047332 Ga0307512_100473324 312
588 3300031456 Ga0307513_10036111 Ga0307513_100361113 312
589 3300031507 Ga0307509_10040010 Ga0307509_100400102 312
590 3300031507 Ga0307509_10048217 Ga0307509_100482173 312
591 3300031616 Ga0307508_10001847 Ga0307508_1000184714 312
592 3300031616 Ga0307508_10006981 Ga0307508_1000698111 312
593 3300031730 Ga0307516_10019586 Ga0307516_100195866 312
594 3300031731 Ga0307405_10014627 Ga0307405_100146273 312
595 3300031824 Ga0307413_10028093 Ga0307413_100280932 312
596 3300031838 Ga0307518_10152051 Ga0307518_101520511 312
597 3300031852 Ga0307410_10040149 Ga0307410_100401492 312
598 3300031901 Ga0307406_10017377 Ga0307406_100173774 312
599 3300031911 Ga0307412_10036449 Ga0307412_100364493 312
600 3300031995 Ga0307409_100039276 Ga0307409_1000392763 312
601 3300032002 Ga0307416_100021496 Ga0307416_1000214962 312
602 3300032004 Ga0307414_10047523 Ga0307414_100475232 312
603 3300032005 Ga0307411_10045891 Ga0307411_100458913 312
604 3300032005 Ga0307411_10143744 Ga0307411_101437442 312
605 3300033180 Ga0307510_10079638 Ga0307510_100796384 312
606 3300033180 Ga0307510_10249954 Ga0307510_102499541 312
607 3300035170 Ga0373943_0068861 Ga0373943_0068861_673_1647 312
608 3300035692 Ga0373935_0203829 Ga0373935_0203829_332_1324 312
609 3300036401 Ga0373937_0012463 Ga0373937_0012463_5352_6344 312
610 3300036401 Ga0373937_0056460 Ga0373937_0056460_1620_2615 312
611 3300037068 Ga0373925_0260885 Ga0373925_0260885_351_1325 312
612 3300041452 Ga0451793_0508741 Ga0451793_0508741_409_1383 312
613 3300041456 Ga0451795_0519482 Ga0451795_0519482_409_1383 312
614 3300041459 Ga0451800_0879857 Ga0451800_0879857_330_1304 312
615 3300041463 Ga0451804_1035411 Ga0451804_1035411_349_1323 312
616 3300044658 Ga0466972_0000285 Ga0466972_0000285_16156_17190 312
617 3300046454 Ga0495592_0000237 Ga0495592_0000237_4051_5040 312
618 3300046477 Ga0495664_0117245 Ga0495664_0117245_59_1054 312
619 3300046515 Ga0495620_0072242 Ga0495620_0072242_52_1038 312
620 3300046516 Ga0495628_0142321 Ga0495628_0142321_539_1531 312
621 3300046517 Ga0495630_0360372 Ga0495630_0360372_111_1103 312
622 3300046519 Ga0495632_0004239 Ga0495632_0004239_7807_8781 312
623 3300046524 Ga0495648_0098074 Ga0495648_0098074_533_1519 312
624 3300046537 Ga0495598_0022132 Ga0495598_0022132_11_1006 312
625 3300046542 Ga0495597_0007887 Ga0495597_0007887_2537_3520 312
626 3300046543 Ga0495645_0040954 Ga0495645_0040954_671_1663 312
627 3300046543 Ga0495645_0179794 Ga0495645_0179794_49_1044 312
628 3300046663 Ga0495635_0110054 Ga0495635_0110054_44_1039 312
629 3300046683 Ga0495658_0031936 Ga0495658_0031936_1391_2386 312
630 3300046683 Ga0495658_0034335 Ga0495658_0034335_1462_2454 312
631 3300047443 Ga0495687_002606 Ga0495687_002606_7845_8828 312
632 3300047471 Ga0495684_0084397 Ga0495684_0084397_699_1736 312
633 3300048912 Ga0496109_0126638 Ga0496109_0126638_532_1527 312
634 3300050493 nmdc:mga0k408_1828_c1 nmdc:mga0k408_1828_c1_796_1845 312
635 3300053086 Ga0500578_0000437 Ga0500578_0000437_36189_37163 312
636 3300053093 Ga0500651_0097581 Ga0500651_0097581_399_1388 312
637 3300053129 Ga0500628_004814 Ga0500628_004814_861_1835 312
638 3300053130 Ga0500642_0004133 Ga0500642_0004133_3029_4003 312
639 3300053131 Ga0500652_000312 Ga0500652_000312_14752_15726 312
640 3300053139 Ga0500568_0018889 Ga0500568_0018889_1320_2294 312
641 3300053156 Ga0500622_0000164 Ga0500622_0000164_36169_37143 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

72

352

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfz-assembly1.cif.gz_A crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.9951 13 311
2pfy-assembly4.cif.gz_D crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.9913 13 312
2pfz-assembly1.cif.gz_A crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.9853 13 311
2pfy-assembly4.cif.gz_D crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.9847 13 312
6wgm-assembly1.cif.gz_A crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate 0.9832 12 311
ID Description Score Start End Superfamily
2pfzA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9951 13 311 3.40.190.170
2pfyD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9893 13 312 3.40.190.170
2pfzA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9853 13 311 3.40.190.170
2pfyD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9827 13 312 3.40.190.170
4nhbB00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9357 13 312 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A328W474-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9917 18 311 GO:0055085
AF-A0A350AIN9-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9894 1 312 GO:0042597
GO:0055085
AF-A0A3D0JK86-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9881 91 311 GO:0055085
AF-A0A350AIN9-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9863 1 312 GO:0042597
GO:0055085
AF-A0A5S3VPV7-F1-model_v4 deleted 0.9812 8 311

Feature Viewer

pLDDT pTM Quality
95.35 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map