F471779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 641 | 310 | 630 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10018996|Ga0105248_100189963 |
| Length | 366 |
| Sequence | LILSRLQVLGQQPMPGARGSPYALAPVNPSLAGVLMNLLARLHSLVVGLGAAAALATFATAANAQTKWDLPAAYPANNFHTENLQQFANDVDKATGGKLKITVHANASLFKANEIKRAVQGGQAQIGEVLLVNFQNEWQPYGIDGLPFLADSYDASMKLYKASKPALEKKLAEQGIMLLYAVAWPPQGIYVKKPISSAADLKGVKWRAYSPATARIAELVGAQPVTVQAXELSQAMATGVIESYMSSGSTGYDTKTYEHIKYWYDTQAWLPKNAVLVNKAAFDALDKPTQAALVKAGADAEARGWALSQQKNGEYIELLKKNGMTILPPPPQLKADMKKVGDTMLKEWLEKAGAEGQAIVDAYRKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 10 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 11 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 277 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 287 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 303 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 304 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.45 |
| Nodule | 0.31 |
| Rhizoplane | 4.06 |
| Rhizosphere | 78.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1001748 | 3300002773 | Bacteria | 8886 |
| 2 | JGI25153J46596_10002270 | 3300003215 | Bacteria | 11209 |
| 3 | JGI25153J46596_10006214 | 3300003215 | Bacteria | 6112 |
| 4 | Ga0055526_1002150 | 3300003771 | Bacteria | 13519 |
| 5 | Ga0055537_1000011 | 3300003773 | Bacteria | 137556 |
| 6 | Ga0055534_1000020 | 3300003784 | Bacteria | 137562 |
| 7 | Ga0055528_1000523 | 3300003790 | Bacteria | 29840 |
| 8 | Ga0055530_10010170 | 3300003791 | Bacteria | 3513 |
| 9 | Ga0055530_10018936 | 3300003791 | Bacteria | 2103 |
| 10 | Ga0055540_1004422 | 3300003792 | Bacteria | 6347 |
| 11 | Ga0055531_10001135 | 3300003794 | Bacteria | 20599 |
| 12 | Ga0055531_10006773 | 3300003794 | Bacteria | 6404 |
| 13 | Ga0065714_10148141 | 3300005288 | Bacteria | 1124 |
| 14 | Ga0065707_10086252 | 3300005295 | Bacteria | 5558 |
| 15 | Ga0070658_10001451 | 3300005327 | Bacteria | 20221 |
| 16 | Ga0070658_10159367 | 3300005327 | Bacteria | 1893 |
| 17 | Ga0070658_10278833 | 3300005327 | Bacteria | 1422 |
| 18 | Ga0070676_10009731 | 3300005328 | Bacteria | 5199 |
| 19 | Ga0070676_10016860 | 3300005328 | Bacteria | 4038 |
| 20 | Ga0070676_10234980 | 3300005328 | Bacteria | 1216 |
| 21 | Ga0070690_100094564 | 3300005330 | Bacteria | 1972 |
| 22 | Ga0070690_100141676 | 3300005330 | Bacteria | 1632 |
| 23 | Ga0070670_100000316 | 3300005331 | Bacteria | 41464 |
| 24 | Ga0070670_100001487 | 3300005331 | Bacteria | 18885 |
| 25 | Ga0070670_100055083 | 3300005331 | Bacteria | 3413 |
| 26 | Ga0070670_100119934 | 3300005331 | Bacteria | 2268 |
| 27 | Ga0070670_100125593 | 3300005331 | Bacteria | 2214 |
| 28 | Ga0070670_100127016 | 3300005331 | Bacteria | 2201 |
| 29 | Ga0070670_100139485 | 3300005331 | Bacteria | 2096 |
| 30 | Ga0070677_10000457 | 3300005333 | Bacteria | 13976 |
| 31 | Ga0070677_10019165 | 3300005333 | Bacteria | 2474 |
| 32 | Ga0070677_10022459 | 3300005333 | Bacteria | 2324 |
| 33 | Ga0070677_10023781 | 3300005333 | Bacteria | 2272 |
| 34 | Ga0068869_100039693 | 3300005334 | Bacteria | 3362 |
| 35 | Ga0070666_10022199 | 3300005335 | Bacteria | 4119 |
| 36 | Ga0070666_10078188 | 3300005335 | Bacteria | 2258 |
| 37 | Ga0070680_100343857 | 3300005336 | Bacteria | 1268 |
| 38 | Ga0068868_100004726 | 3300005338 | Bacteria | 9566 |
| 39 | Ga0068868_100038261 | 3300005338 | Bacteria | 3723 |
| 40 | Ga0068868_100053419 | 3300005338 | Bacteria | 3183 |
| 41 | Ga0070660_100155198 | 3300005339 | Bacteria | 1842 |
| 42 | Ga0070689_100031651 | 3300005340 | Bacteria | 4022 |
| 43 | Ga0070661_100177986 | 3300005344 | Bacteria | 1617 |
| 44 | Ga0070668_100027181 | 3300005347 | Bacteria | 4343 |
| 45 | Ga0070669_100001968 | 3300005353 | Bacteria | 14839 |
| 46 | Ga0070675_100000480 | 3300005354 | Bacteria | 27286 |
| 47 | Ga0070675_100005625 | 3300005354 | Bacteria | 9595 |
| 48 | Ga0070675_100010343 | 3300005354 | Bacteria | 7286 |
| 49 | Ga0070675_100038647 | 3300005354 | Bacteria | 3891 |
| 50 | Ga0070675_100145213 | 3300005354 | Bacteria | 2031 |
| 51 | Ga0070671_100000734 | 3300005355 | Bacteria | 23452 |
| 52 | Ga0070671_100014699 | 3300005355 | Bacteria | 6327 |
| 53 | Ga0070671_100152527 | 3300005355 | Bacteria | 1951 |
| 54 | Ga0070671_100249168 | 3300005355 | Bacteria | 1509 |
| 55 | Ga0070674_100020342 | 3300005356 | Bacteria | 4238 |
| 56 | Ga0070674_100350084 | 3300005356 | Bacteria | 1193 |
| 57 | Ga0070673_100001230 | 3300005364 | Bacteria | 14824 |
| 58 | Ga0070673_100003065 | 3300005364 | Bacteria | 10345 |
| 59 | Ga0070673_100016138 | 3300005364 | Bacteria | 5271 |
| 60 | Ga0070673_100062900 | 3300005364 | Bacteria | 2951 |
| 61 | Ga0070673_100267796 | 3300005364 | Bacteria | 1494 |
| 62 | Ga0070688_100122829 | 3300005365 | Bacteria | 1741 |
| 63 | Ga0070659_100008351 | 3300005366 | Bacteria | 7561 |
| 64 | Ga0070659_100171312 | 3300005366 | Bacteria | 1778 |
| 65 | Ga0070667_100004472 | 3300005367 | Bacteria | 11793 |
| 66 | Ga0070667_100037047 | 3300005367 | Bacteria | 4089 |
| 67 | Ga0070701_10085078 | 3300005438 | Bacteria | 1721 |
| 68 | Ga0070663_100027741 | 3300005455 | Bacteria | 3849 |
| 69 | Ga0070678_100009028 | 3300005456 | Bacteria | 6006 |
| 70 | Ga0070678_100013895 | 3300005456 | Bacteria | 5061 |
| 71 | Ga0070678_100047655 | 3300005456 | Bacteria | 3081 |
| 72 | Ga0070678_100079341 | 3300005456 | Bacteria | 2482 |
| 73 | Ga0070678_100140328 | 3300005456 | Bacteria | 1933 |
| 74 | Ga0070662_100001468 | 3300005457 | Bacteria | 14517 |
| 75 | Ga0070662_100008876 | 3300005457 | Bacteria | 6553 |
| 76 | Ga0068867_100000712 | 3300005459 | Bacteria | 22179 |
| 77 | Ga0068867_100018725 | 3300005459 | Bacteria | 4923 |
| 78 | Ga0068867_100037382 | 3300005459 | Bacteria | 3528 |
| 79 | Ga0068867_100132776 | 3300005459 | Bacteria | 1937 |
| 80 | Ga0068867_100246319 | 3300005459 | Bacteria | 1451 |
| 81 | Ga0070685_10005883 | 3300005466 | Bacteria | 6240 |
| 82 | Ga0070706_100007432 | 3300005467 | Bacteria | 10276 |
| 83 | Ga0070706_100579706 | 3300005467 | Bacteria | 1043 |
| 84 | Ga0070707_100114145 | 3300005468 | Bacteria | 2621 |
| 85 | Ga0070699_100149258 | 3300005518 | Bacteria | 2067 |
| 86 | Ga0070679_100105012 | 3300005530 | Bacteria | 2811 |
| 87 | Ga0070684_100098116 | 3300005535 | Bacteria | 2613 |
| 88 | Ga0070684_100130410 | 3300005535 | Bacteria | 2267 |
| 89 | Ga0068853_100172161 | 3300005539 | Bacteria | 1959 |
| 90 | Ga0068853_100278229 | 3300005539 | Bacteria | 1542 |
| 91 | Ga0070672_100000206 | 3300005543 | Bacteria | 32562 |
| 92 | Ga0070672_100011240 | 3300005543 | Bacteria | 6242 |
| 93 | Ga0070672_100011563 | 3300005543 | Bacteria | 6158 |
| 94 | Ga0070672_100011945 | 3300005543 | Bacteria | 6071 |
| 95 | Ga0070672_100018687 | 3300005543 | Bacteria | 5017 |
| 96 | Ga0070672_100027935 | 3300005543 | Bacteria | 4214 |
| 97 | Ga0070672_100096113 | 3300005543 | Bacteria | 2396 |
| 98 | Ga0070686_100025147 | 3300005544 | Bacteria | 3579 |
| 99 | Ga0070696_100014115 | 3300005546 | Bacteria | 5362 |
| 100 | Ga0070665_100175402 | 3300005548 | Bacteria | 2144 |
| 101 | Ga0070665_100184077 | 3300005548 | Bacteria | 2090 |
| 102 | Ga0068855_100022146 | 3300005563 | Bacteria | 7615 |
| 103 | Ga0068855_100297315 | 3300005563 | Bacteria | 1788 |
| 104 | Ga0070664_100112710 | 3300005564 | Bacteria | 2375 |
| 105 | Ga0070664_100121416 | 3300005564 | Bacteria | 2288 |
| 106 | Ga0070664_100180954 | 3300005564 | Bacteria | 1873 |
| 107 | Ga0068854_100031831 | 3300005578 | Bacteria | 3667 |
| 108 | Ga0068856_100043926 | 3300005614 | Bacteria | 4396 |
| 109 | Ga0068856_100064064 | 3300005614 | Bacteria | 3632 |
| 110 | Ga0068856_100213561 | 3300005614 | Bacteria | 1945 |
| 111 | Ga0068852_100017057 | 3300005616 | Bacteria | 5687 |
| 112 | Ga0068852_100026411 | 3300005616 | Bacteria | 4719 |
| 113 | Ga0068852_100036243 | 3300005616 | Bacteria | 4125 |
| 114 | Ga0068852_100056346 | 3300005616 | Bacteria | 3396 |
| 115 | Ga0068852_100464942 | 3300005616 | Bacteria | 1255 |
| 116 | Ga0068859_100023164 | 3300005617 | Bacteria | 6230 |
| 117 | Ga0068859_100072262 | 3300005617 | Bacteria | 3486 |
| 118 | Ga0068859_100100370 | 3300005617 | Bacteria | 2950 |
| 119 | Ga0068859_100108378 | 3300005617 | Bacteria | 2839 |
| 120 | Ga0068859_100161085 | 3300005617 | Bacteria | 2323 |
| 121 | Ga0068859_100522698 | 3300005617 | Bacteria | 1282 |
| 122 | Ga0068864_100009333 | 3300005618 | Bacteria | 8092 |
| 123 | Ga0068864_100010783 | 3300005618 | Bacteria | 7552 |
| 124 | Ga0068864_100032186 | 3300005618 | Bacteria | 4454 |
| 125 | Ga0068864_100150190 | 3300005618 | Bacteria | 2110 |
| 126 | Ga0068866_10056518 | 3300005718 | Bacteria | 2018 |
| 127 | Ga0068861_100004400 | 3300005719 | Bacteria | 9442 |
| 128 | Ga0068861_100021163 | 3300005719 | Bacteria | 4673 |
| 129 | Ga0068861_100062590 | 3300005719 | Bacteria | 2859 |
| 130 | Ga0068861_100182325 | 3300005719 | Bacteria | 1749 |
| 131 | Ga0068851_10038084 | 3300005834 | Bacteria | 2411 |
| 132 | Ga0068863_100006090 | 3300005841 | Bacteria | 11833 |
| 133 | Ga0068863_100023505 | 3300005841 | Bacteria | 5885 |
| 134 | Ga0068863_100045005 | 3300005841 | Bacteria | 4188 |
| 135 | Ga0068863_100238613 | 3300005841 | Bacteria | 1755 |
| 136 | Ga0068863_100396826 | 3300005841 | Bacteria | 1349 |
| 137 | Ga0068858_100001935 | 3300005842 | Bacteria | 21109 |
| 138 | Ga0068858_100002260 | 3300005842 | Bacteria | 19472 |
| 139 | Ga0068858_100031848 | 3300005842 | Bacteria | 4900 |
| 140 | Ga0068858_100108964 | 3300005842 | Bacteria | 2585 |
| 141 | Ga0068860_100000605 | 3300005843 | Bacteria | 42776 |
| 142 | Ga0068860_100001949 | 3300005843 | Bacteria | 21844 |
| 143 | Ga0068860_100018751 | 3300005843 | Bacteria | 6723 |
| 144 | Ga0068862_100047762 | 3300005844 | Bacteria | 3654 |
| 145 | Ga0068862_100113991 | 3300005844 | Bacteria | 2376 |
| 146 | Ga0068862_100161432 | 3300005844 | Bacteria | 2000 |
| 147 | Ga0081455_10074649 | 3300005937 | Bacteria | 2800 |
| 148 | Ga0075363_100038545 | 3300006048 | Bacteria | 2514 |
| 149 | Ga0075364_10080287 | 3300006051 | Bacteria | 2156 |
| 150 | Ga0075362_10024666 | 3300006177 | Bacteria | 2552 |
| 151 | Ga0075367_10122591 | 3300006178 | Bacteria | 1602 |
| 152 | Ga0075366_10007566 | 3300006195 | Bacteria | 6008 |
| 153 | Ga0075366_10009253 | 3300006195 | Bacteria | 5500 |
| 154 | Ga0075366_10041050 | 3300006195 | Bacteria | 2738 |
| 155 | Ga0097621_100091348 | 3300006237 | Bacteria | 2549 |
| 156 | Ga0097621_100115403 | 3300006237 | Bacteria | 2273 |
| 157 | Ga0097621_100119759 | 3300006237 | Bacteria | 2231 |
| 158 | Ga0097621_100131452 | 3300006237 | Bacteria | 2131 |
| 159 | Ga0097621_100341436 | 3300006237 | Bacteria | 1330 |
| 160 | Ga0075370_10003454 | 3300006353 | Bacteria | 7526 |
| 161 | Ga0075370_10010143 | 3300006353 | Bacteria | 4911 |
| 162 | Ga0075370_10015546 | 3300006353 | Bacteria | 4076 |
| 163 | Ga0068871_100050917 | 3300006358 | Bacteria | 3351 |
| 164 | Ga0068871_100057060 | 3300006358 | Bacteria | 3175 |
| 165 | Ga0068865_100342528 | 3300006881 | Bacteria | 1208 |
| 166 | Ga0097620_100023164 | 3300006931 | Bacteria | 6230 |
| 167 | Ga0097620_100072264 | 3300006931 | Bacteria | 3486 |
| 168 | Ga0097620_100100368 | 3300006931 | Bacteria | 2950 |
| 169 | Ga0097620_100108379 | 3300006931 | Bacteria | 2839 |
| 170 | Ga0097620_100161093 | 3300006931 | Bacteria | 2323 |
| 171 | Ga0097620_100522709 | 3300006931 | Bacteria | 1282 |
| 172 | Ga0099826_10000157 | 3300006948 | Bacteria | 28404 |
| 173 | Ga0099794_10002963 | 3300007265 | Bacteria | 6402 |
| 174 | Ga0105240_10427033 | 3300009093 | Bacteria | 1488 |
| 175 | Ga0105240_10507864 | 3300009093 | Bacteria | 1339 |
| 176 | Ga0105240_10566180 | 3300009093 | Bacteria | 1255 |
| 177 | Ga0105245_10096754 | 3300009098 | Bacteria | 2725 |
| 178 | Ga0105245_10149085 | 3300009098 | Bacteria | 2210 |
| 179 | Ga0105245_10365519 | 3300009098 | Bacteria | 1433 |
| 180 | Ga0114129_10030937 | 3300009147 | Bacteria | 7570 |
| 181 | Ga0105243_10017179 | 3300009148 | Bacteria | 5473 |
| 182 | Ga0105243_10073714 | 3300009148 | Bacteria | 2767 |
| 183 | Ga0105243_10079624 | 3300009148 | Bacteria | 2671 |
| 184 | Ga0105243_10096542 | 3300009148 | Bacteria | 2445 |
| 185 | Ga0105241_10044466 | 3300009174 | Bacteria | 3365 |
| 186 | Ga0105242_10010661 | 3300009176 | Bacteria | 7055 |
| 187 | Ga0105242_10023954 | 3300009176 | Bacteria | 4817 |
| 188 | Ga0105242_10301046 | 3300009176 | Bacteria | 1464 |
| 189 | Ga0105248_10014904 | 3300009177 | Bacteria | 8560 |
| 190 | Ga0105248_10018996 | 3300009177 | Bacteria | 7600 |
| 191 | Ga0105248_10031634 | 3300009177 | Bacteria | 5911 |
| 192 | Ga0105248_10125609 | 3300009177 | Bacteria | 2894 |
| 193 | Ga0105248_10154638 | 3300009177 | Bacteria | 2588 |
| 194 | Ga0105248_10228499 | 3300009177 | Bacteria | 2094 |
| 195 | Ga0105237_10257489 | 3300009545 | Bacteria | 1747 |
| 196 | Ga0105238_10160530 | 3300009551 | Bacteria | 2223 |
| 197 | Ga0105238_10209623 | 3300009551 | Bacteria | 1924 |
| 198 | Ga0105238_10331849 | 3300009551 | Bacteria | 1508 |
| 199 | Ga0105238_10540303 | 3300009551 | Bacteria | 1169 |
| 200 | Ga0105249_10038932 | 3300009553 | Bacteria | 4315 |
| 201 | Ga0105249_10039217 | 3300009553 | Bacteria | 4300 |
| 202 | Ga0105246_10085345 | 3300011119 | Bacteria | 2261 |
| 203 | Ga0157373_10050849 | 3300013100 | Bacteria | 2951 |
| 204 | Ga0157371_10091085 | 3300013102 | Bacteria | 2160 |
| 205 | Ga0157371_10148154 | 3300013102 | Bacteria | 1673 |
| 206 | Ga0157370_10297900 | 3300013104 | Bacteria | 1489 |
| 207 | Ga0157369_10033694 | 3300013105 | Bacteria | 5627 |
| 208 | Ga0157374_10156302 | 3300013296 | Bacteria | 2220 |
| 209 | Ga0157378_10272705 | 3300013297 | Bacteria | 1628 |
| 210 | Ga0163162_10007037 | 3300013306 | Bacteria | 10907 |
| 211 | Ga0163162_10013137 | 3300013306 | Bacteria | 8085 |
| 212 | Ga0163162_10028873 | 3300013306 | Bacteria | 5490 |
| 213 | Ga0163162_10033703 | 3300013306 | Bacteria | 5090 |
| 214 | Ga0163162_10056547 | 3300013306 | Bacteria | 3951 |
| 215 | Ga0163162_10229351 | 3300013306 | Bacteria | 1987 |
| 216 | Ga0163162_10263873 | 3300013306 | Bacteria | 1854 |
| 217 | Ga0157372_10104054 | 3300013307 | Bacteria | 3245 |
| 218 | Ga0157372_10113334 | 3300013307 | Bacteria | 3108 |
| 219 | Ga0157375_10003084 | 3300013308 | Bacteria | 14466 |
| 220 | Ga0157375_10082795 | 3300013308 | Bacteria | 3252 |
| 221 | Ga0157375_10106295 | 3300013308 | Bacteria | 2898 |
| 222 | Ga0157375_10113993 | 3300013308 | Bacteria | 2805 |
| 223 | Ga0157375_10124563 | 3300013308 | Bacteria | 2691 |
| 224 | Ga0157375_10137673 | 3300013308 | Bacteria | 2567 |
| 225 | Ga0157375_10154740 | 3300013308 | Bacteria | 2431 |
| 226 | Ga0157375_10224419 | 3300013308 | Bacteria | 2038 |
| 227 | Ga0157375_10249409 | 3300013308 | Bacteria | 1936 |
| 228 | Ga0157375_10295803 | 3300013308 | Bacteria | 1782 |
| 229 | Ga0163163_10003856 | 3300014325 | Bacteria | 12771 |
| 230 | Ga0157380_10027756 | 3300014326 | Bacteria | 4308 |
| 231 | Ga0157380_10089863 | 3300014326 | Bacteria | 2532 |
| 232 | Ga0157380_10509252 | 3300014326 | Bacteria | 1171 |
| 233 | Ga0182008_10001113 | 3300014497 | Bacteria | 18484 |
| 234 | Ga0157377_10011668 | 3300014745 | Bacteria | 4393 |
| 235 | Ga0157379_10036974 | 3300014968 | Bacteria | 4353 |
| 236 | Ga0157376_10018710 | 3300014969 | Bacteria | 5320 |
| 237 | Ga0157376_10470971 | 3300014969 | Bacteria | 1229 |
| 238 | Ga0182007_10003841 | 3300015262 | Bacteria | 6985 |
| 239 | Ga0163161_10014680 | 3300017792 | Bacteria | 5455 |
| 240 | Ga0207425_1000565 | 3300025245 | Bacteria | 21780 |
| 241 | Ga0209129_1000075 | 3300025258 | Bacteria | 201273 |
| 242 | Ga0209565_1000058 | 3300025263 | Bacteria | 194126 |
| 243 | Ga0209673_1000053 | 3300025273 | Bacteria | 279449 |
| 244 | Ga0209673_1006691 | 3300025273 | Bacteria | 5501 |
| 245 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 246 | Ga0209676_1002070 | 3300025292 | Bacteria | 15585 |
| 247 | Ga0209676_1016058 | 3300025292 | Bacteria | 2724 |
| 248 | Ga0209025_1008535 | 3300025294 | Bacteria | 7354 |
| 249 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 250 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 251 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 252 | Ga0209050_1000257 | 3300025298 | Bacteria | 114186 |
| 253 | Ga0209050_1001209 | 3300025298 | Bacteria | 30287 |
| 254 | Ga0209051_1000136 | 3300025303 | Bacteria | 138015 |
| 255 | Ga0209051_1000145 | 3300025303 | Bacteria | 134807 |
| 256 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 257 | Ga0209257_1000495 | 3300025304 | Bacteria | 70401 |
| 258 | Ga0209257_1034024 | 3300025304 | Bacteria | 1596 |
| 259 | Ga0207697_10013102 | 3300025315 | Bacteria | 3463 |
| 260 | Ga0207656_10013182 | 3300025321 | Bacteria | 3154 |
| 261 | Ga0207656_10027818 | 3300025321 | Bacteria | 2316 |
| 262 | Ga0207682_10000269 | 3300025893 | Bacteria | 23507 |
| 263 | Ga0207682_10019175 | 3300025893 | Bacteria | 2678 |
| 264 | Ga0207682_10023065 | 3300025893 | Bacteria | 2457 |
| 265 | Ga0207682_10030129 | 3300025893 | Bacteria | 2172 |
| 266 | Ga0207682_10042678 | 3300025893 | Bacteria | 1853 |
| 267 | Ga0207642_10007733 | 3300025899 | Bacteria | 3643 |
| 268 | Ga0207688_10008890 | 3300025901 | Bacteria | 5465 |
| 269 | Ga0207688_10062569 | 3300025901 | Bacteria | 2098 |
| 270 | Ga0207688_10078859 | 3300025901 | Bacteria | 1878 |
| 271 | Ga0207680_10034428 | 3300025903 | Bacteria | 2898 |
| 272 | Ga0207680_10147539 | 3300025903 | Bacteria | 1565 |
| 273 | Ga0207645_10001304 | 3300025907 | Bacteria | 20534 |
| 274 | Ga0207645_10007282 | 3300025907 | Bacteria | 7825 |
| 275 | Ga0207645_10017830 | 3300025907 | Bacteria | 4681 |
| 276 | Ga0207645_10064111 | 3300025907 | Bacteria | 2348 |
| 277 | Ga0207705_10042174 | 3300025909 | Bacteria | 3276 |
| 278 | Ga0207705_10106755 | 3300025909 | Bacteria | 2065 |
| 279 | Ga0207705_10150517 | 3300025909 | Bacteria | 1744 |
| 280 | Ga0207684_10009803 | 3300025910 | Bacteria | 8450 |
| 281 | Ga0207695_10444384 | 3300025913 | Bacteria | 1180 |
| 282 | Ga0207671_10057337 | 3300025914 | Bacteria | 2887 |
| 283 | Ga0207671_10131192 | 3300025914 | Bacteria | 1923 |
| 284 | Ga0207662_10016139 | 3300025918 | Bacteria | 4211 |
| 285 | Ga0207657_10157087 | 3300025919 | Bacteria | 1849 |
| 286 | Ga0207649_10039911 | 3300025920 | Bacteria | 2849 |
| 287 | Ga0207652_10060606 | 3300025921 | Bacteria | 3265 |
| 288 | Ga0207646_10263396 | 3300025922 | Bacteria | 1558 |
| 289 | Ga0207681_10000893 | 3300025923 | Bacteria | 19479 |
| 290 | Ga0207694_10233034 | 3300025924 | Bacteria | 1504 |
| 291 | Ga0207694_10266674 | 3300025924 | Bacteria | 1404 |
| 292 | Ga0207694_10353159 | 3300025924 | Bacteria | 1217 |
| 293 | Ga0207650_10000172 | 3300025925 | Bacteria | 76270 |
| 294 | Ga0207650_10072294 | 3300025925 | Bacteria | 2596 |
| 295 | Ga0207650_10101014 | 3300025925 | Bacteria | 2220 |
| 296 | Ga0207650_10115048 | 3300025925 | Bacteria | 2087 |
| 297 | Ga0207650_10157624 | 3300025925 | Bacteria | 1796 |
| 298 | Ga0207659_10000066 | 3300025926 | Bacteria | 66468 |
| 299 | Ga0207659_10010811 | 3300025926 | Bacteria | 5746 |
| 300 | Ga0207659_10011107 | 3300025926 | Bacteria | 5681 |
| 301 | Ga0207659_10021252 | 3300025926 | Bacteria | 4304 |
| 302 | Ga0207659_10023895 | 3300025926 | Bacteria | 4087 |
| 303 | Ga0207659_10030025 | 3300025926 | Bacteria | 3710 |
| 304 | Ga0207659_10040044 | 3300025926 | Bacteria | 3274 |
| 305 | Ga0207659_10047702 | 3300025926 | Bacteria | 3031 |
| 306 | Ga0207659_10428809 | 3300025926 | Bacteria | 1110 |
| 307 | Ga0207687_10080561 | 3300025927 | Bacteria | 2351 |
| 308 | Ga0207687_10120120 | 3300025927 | Bacteria | 1964 |
| 309 | Ga0207687_10193728 | 3300025927 | Bacteria | 1584 |
| 310 | Ga0207644_10000306 | 3300025931 | Bacteria | 31833 |
| 311 | Ga0207644_10001237 | 3300025931 | Bacteria | 16418 |
| 312 | Ga0207644_10020223 | 3300025931 | Bacteria | 4524 |
| 313 | Ga0207644_10090539 | 3300025931 | Bacteria | 2279 |
| 314 | Ga0207690_10022184 | 3300025932 | Bacteria | 3946 |
| 315 | Ga0207690_10153767 | 3300025932 | Bacteria | 1708 |
| 316 | Ga0207690_10317396 | 3300025932 | Bacteria | 1224 |
| 317 | Ga0207706_10016770 | 3300025933 | Bacteria | 6611 |
| 318 | Ga0207706_10021166 | 3300025933 | Bacteria | 5844 |
| 319 | Ga0207706_10035763 | 3300025933 | Bacteria | 4413 |
| 320 | Ga0207706_10038451 | 3300025933 | Bacteria | 4244 |
| 321 | Ga0207686_10010321 | 3300025934 | Bacteria | 5082 |
| 322 | Ga0207709_10014157 | 3300025935 | Bacteria | 4403 |
| 323 | Ga0207670_10042168 | 3300025936 | Bacteria | 3005 |
| 324 | Ga0207670_10133540 | 3300025936 | Bacteria | 1822 |
| 325 | Ga0207670_10164825 | 3300025936 | Bacteria | 1657 |
| 326 | Ga0207669_10158667 | 3300025937 | Bacteria | 1594 |
| 327 | Ga0207704_10050264 | 3300025938 | Bacteria | 2514 |
| 328 | Ga0207704_10227465 | 3300025938 | Bacteria | 1385 |
| 329 | Ga0207691_10000265 | 3300025940 | Bacteria | 51755 |
| 330 | Ga0207691_10009574 | 3300025940 | Bacteria | 9300 |
| 331 | Ga0207691_10014086 | 3300025940 | Bacteria | 7631 |
| 332 | Ga0207691_10029152 | 3300025940 | Bacteria | 5163 |
| 333 | Ga0207691_10033726 | 3300025940 | Bacteria | 4766 |
| 334 | Ga0207691_10055754 | 3300025940 | Bacteria | 3601 |
| 335 | Ga0207691_10117408 | 3300025940 | Bacteria | 2361 |
| 336 | Ga0207691_10122572 | 3300025940 | Bacteria | 2302 |
| 337 | Ga0207711_10005620 | 3300025941 | Bacteria | 10602 |
| 338 | Ga0207711_10013090 | 3300025941 | Bacteria | 6891 |
| 339 | Ga0207711_10096022 | 3300025941 | Bacteria | 2615 |
| 340 | Ga0207711_10148439 | 3300025941 | Bacteria | 2114 |
| 341 | Ga0207711_10335657 | 3300025941 | Bacteria | 1398 |
| 342 | Ga0207689_10024677 | 3300025942 | Bacteria | 5041 |
| 343 | Ga0207689_10036423 | 3300025942 | Bacteria | 4085 |
| 344 | Ga0207689_10052134 | 3300025942 | Bacteria | 3372 |
| 345 | Ga0207689_10054545 | 3300025942 | Bacteria | 3291 |
| 346 | Ga0207689_10085747 | 3300025942 | Bacteria | 2589 |
| 347 | Ga0207689_10114270 | 3300025942 | Bacteria | 2219 |
| 348 | Ga0207689_10146849 | 3300025942 | Bacteria | 1943 |
| 349 | Ga0207661_10082073 | 3300025944 | Bacteria | 2664 |
| 350 | Ga0207679_10009947 | 3300025945 | Bacteria | 6108 |
| 351 | Ga0207667_10409578 | 3300025949 | Bacteria | 1380 |
| 352 | Ga0207651_10000267 | 3300025960 | Bacteria | 22292 |
| 353 | Ga0207651_10056669 | 3300025960 | Bacteria | 2698 |
| 354 | Ga0207651_10101788 | 3300025960 | Bacteria | 2133 |
| 355 | Ga0207668_10014376 | 3300025972 | Bacteria | 4898 |
| 356 | Ga0207668_10030011 | 3300025972 | Bacteria | 3569 |
| 357 | Ga0207668_10070133 | 3300025972 | Bacteria | 2498 |
| 358 | Ga0207640_10020071 | 3300025981 | Bacteria | 3961 |
| 359 | Ga0207640_10113018 | 3300025981 | Bacteria | 1929 |
| 360 | Ga0207640_10117148 | 3300025981 | Bacteria | 1900 |
| 361 | Ga0207658_10005885 | 3300025986 | Bacteria | 8385 |
| 362 | Ga0207658_10028137 | 3300025986 | Bacteria | 3956 |
| 363 | Ga0207677_10002328 | 3300026023 | Bacteria | 9969 |
| 364 | Ga0207677_10015488 | 3300026023 | Bacteria | 4488 |
| 365 | Ga0207677_10029828 | 3300026023 | Bacteria | 3473 |
| 366 | Ga0207677_10052530 | 3300026023 | Bacteria | 2769 |
| 367 | Ga0207677_10057076 | 3300026023 | Bacteria | 2679 |
| 368 | Ga0207677_10069101 | 3300026023 | Bacteria | 2483 |
| 369 | Ga0207703_10010895 | 3300026035 | Bacteria | 7089 |
| 370 | Ga0207703_10014214 | 3300026035 | Bacteria | 6208 |
| 371 | Ga0207703_10054103 | 3300026035 | Bacteria | 3263 |
| 372 | Ga0207703_10062874 | 3300026035 | Bacteria | 3041 |
| 373 | Ga0207639_10031455 | 3300026041 | Bacteria | 3901 |
| 374 | Ga0207639_10148442 | 3300026041 | Bacteria | 1961 |
| 375 | Ga0207678_10031930 | 3300026067 | Bacteria | 4591 |
| 376 | Ga0207678_10035031 | 3300026067 | Bacteria | 4370 |
| 377 | Ga0207678_10155496 | 3300026067 | Bacteria | 1952 |
| 378 | Ga0207708_10006045 | 3300026075 | Bacteria | 8975 |
| 379 | Ga0207708_10006674 | 3300026075 | Bacteria | 8538 |
| 380 | Ga0207708_10105796 | 3300026075 | Bacteria | 2181 |
| 381 | Ga0207702_10052022 | 3300026078 | Bacteria | 3464 |
| 382 | Ga0207702_10085468 | 3300026078 | Bacteria | 2749 |
| 383 | Ga0207641_10015994 | 3300026088 | Bacteria | 6142 |
| 384 | Ga0207641_10031857 | 3300026088 | Bacteria | 4374 |
| 385 | Ga0207641_10042940 | 3300026088 | Bacteria | 3794 |
| 386 | Ga0207641_10052397 | 3300026088 | Bacteria | 3455 |
| 387 | Ga0207648_10002312 | 3300026089 | Bacteria | 20575 |
| 388 | Ga0207648_10008565 | 3300026089 | Bacteria | 9894 |
| 389 | Ga0207648_10012331 | 3300026089 | Bacteria | 8002 |
| 390 | Ga0207648_10069390 | 3300026089 | Bacteria | 3071 |
| 391 | Ga0207648_10073241 | 3300026089 | Bacteria | 2986 |
| 392 | Ga0207676_10002235 | 3300026095 | Bacteria | 13907 |
| 393 | Ga0207676_10020243 | 3300026095 | Bacteria | 4864 |
| 394 | Ga0207676_10027374 | 3300026095 | Bacteria | 4245 |
| 395 | Ga0207676_10059604 | 3300026095 | Bacteria | 3015 |
| 396 | Ga0207676_10472657 | 3300026095 | Bacteria | 1186 |
| 397 | Ga0207674_10066233 | 3300026116 | Bacteria | 3639 |
| 398 | Ga0207674_10069225 | 3300026116 | Bacteria | 3550 |
| 399 | Ga0207674_10081993 | 3300026116 | Bacteria | 3227 |
| 400 | Ga0207675_100019410 | 3300026118 | Bacteria | 6342 |
| 401 | Ga0207675_100022443 | 3300026118 | Bacteria | 5878 |
| 402 | Ga0207675_100044234 | 3300026118 | Bacteria | 4160 |
| 403 | Ga0207675_100061012 | 3300026118 | Bacteria | 3520 |
| 404 | Ga0207675_100121237 | 3300026118 | Bacteria | 2474 |
| 405 | Ga0207675_100237285 | 3300026118 | Bacteria | 1761 |
| 406 | Ga0207683_10014997 | 3300026121 | Bacteria | 6595 |
| 407 | Ga0207683_10026644 | 3300026121 | Bacteria | 4992 |
| 408 | Ga0207683_10051245 | 3300026121 | Bacteria | 3616 |
| 409 | Ga0207683_10071175 | 3300026121 | Bacteria | 3074 |
| 410 | Ga0207683_10121829 | 3300026121 | Bacteria | 2342 |
| 411 | Ga0207683_10252589 | 3300026121 | Bacteria | 1609 |
| 412 | Ga0207698_10009254 | 3300026142 | Bacteria | 6269 |
| 413 | Ga0207698_10012799 | 3300026142 | Bacteria | 5508 |
| 414 | Ga0207698_10085949 | 3300026142 | Bacteria | 2556 |
| 415 | Ga0207698_10105396 | 3300026142 | Bacteria | 2349 |
| 416 | Ga0207698_10154570 | 3300026142 | Bacteria | 1996 |
| 417 | Ga0207698_10424174 | 3300026142 | Bacteria | 1277 |
| 418 | Ga0209282_1000879 | 3300027666 | Bacteria | 15586 |
| 419 | Ga0209588_1003800 | 3300027671 | Bacteria | 4210 |
| 420 | Ga0209974_10011524 | 3300027876 | Bacteria | 2967 |
| 421 | Ga0268266_10359904 | 3300028379 | Bacteria | 1369 |
| 422 | Ga0268265_10018678 | 3300028380 | Bacteria | 4807 |
| 423 | Ga0268265_10051971 | 3300028380 | Bacteria | 3096 |
| 424 | Ga0268264_10010213 | 3300028381 | Bacteria | 7771 |
| 425 | Ga0268264_10034120 | 3300028381 | Bacteria | 4184 |
| 426 | Ga0268264_10036216 | 3300028381 | Bacteria | 4064 |
| 427 | Ga0268264_10084070 | 3300028381 | Bacteria | 2728 |
| 428 | Ga0307517_10000499 | 3300028786 | Bacteria | 67326 |
| 429 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 430 | Ga0307515_10000103 | 3300028794 | Bacteria | 198308 |
| 431 | Ga0307515_10000366 | 3300028794 | Bacteria | 111195 |
| 432 | Ga0307515_10001653 | 3300028794 | Bacteria | 49625 |
| 433 | Ga0307515_10004991 | 3300028794 | Bacteria | 27066 |
| 434 | Ga0307515_10035753 | 3300028794 | Bacteria | 8066 |
| 435 | Ga0307515_10037079 | 3300028794 | Bacteria | 7856 |
| 436 | Ga0307515_10040755 | 3300028794 | Bacteria | 7331 |
| 437 | Ga0307515_10074011 | 3300028794 | Bacteria | 4565 |
| 438 | Ga0307515_10112578 | 3300028794 | Bacteria | 3164 |
| 439 | Ga0307512_10047332 | 3300030522 | Bacteria | 3496 |
| 440 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 441 | Ga0265325_10004203 | 3300031241 | Bacteria | 9145 |
| 442 | Ga0265340_10067251 | 3300031247 | Bacteria | 1703 |
| 443 | Ga0265327_10001296 | 3300031251 | Bacteria | 32766 |
| 444 | Ga0265327_10009017 | 3300031251 | Bacteria | 7298 |
| 445 | Ga0265316_10040119 | 3300031344 | Bacteria | 3755 |
| 446 | Ga0307513_10034306 | 3300031456 | Bacteria | 5695 |
| 447 | Ga0307513_10036111 | 3300031456 | Bacteria | 5520 |
| 448 | Ga0307513_10097091 | 3300031456 | Bacteria | 2982 |
| 449 | Ga0307513_10290646 | 3300031456 | Bacteria | 1406 |
| 450 | Ga0307509_10040010 | 3300031507 | Bacteria | 5101 |
| 451 | Ga0307509_10048217 | 3300031507 | Bacteria | 4576 |
| 452 | Ga0307509_10204162 | 3300031507 | Bacteria | 1809 |
| 453 | Ga0307508_10000107 | 3300031616 | Bacteria | 97818 |
| 454 | Ga0307508_10001847 | 3300031616 | Bacteria | 23394 |
| 455 | Ga0307508_10006981 | 3300031616 | Bacteria | 10530 |
| 456 | Ga0307514_10000858 | 3300031649 | Bacteria | 48560 |
| 457 | Ga0307514_10012482 | 3300031649 | Bacteria | 7066 |
| 458 | Ga0307514_10101368 | 3300031649 | Bacteria | 2066 |
| 459 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 460 | Ga0307516_10014389 | 3300031730 | Bacteria | 8372 |
| 461 | Ga0307516_10019586 | 3300031730 | Bacteria | 7006 |
| 462 | Ga0307516_10020929 | 3300031730 | Bacteria | 6749 |
| 463 | Ga0307405_10014627 | 3300031731 | Bacteria | 4226 |
| 464 | Ga0307405_10254188 | 3300031731 | Bacteria | 1309 |
| 465 | Ga0307413_10028093 | 3300031824 | Bacteria | 3127 |
| 466 | Ga0307413_10359672 | 3300031824 | Bacteria | 1126 |
| 467 | Ga0307518_10152051 | 3300031838 | Bacteria | 1600 |
| 468 | Ga0307410_10040149 | 3300031852 | Bacteria | 3078 |
| 469 | Ga0307410_10228370 | 3300031852 | Bacteria | 1436 |
| 470 | Ga0307406_10006613 | 3300031901 | Bacteria | 6407 |
| 471 | Ga0307406_10017377 | 3300031901 | Bacteria | 4186 |
| 472 | Ga0307406_10146871 | 3300031901 | Bacteria | 1677 |
| 473 | Ga0307412_10036449 | 3300031911 | Bacteria | 3151 |
| 474 | Ga0307412_10053852 | 3300031911 | Bacteria | 2669 |
| 475 | Ga0307409_100003227 | 3300031995 | Bacteria | 8786 |
| 476 | Ga0307409_100039276 | 3300031995 | Bacteria | 3510 |
| 477 | Ga0307409_100089816 | 3300031995 | Bacteria | 2513 |
| 478 | Ga0307416_100021496 | 3300032002 | Bacteria | 4634 |
| 479 | Ga0307416_100250242 | 3300032002 | Bacteria | 1724 |
| 480 | Ga0307414_10047523 | 3300032004 | Bacteria | 2954 |
| 481 | Ga0307414_10365614 | 3300032004 | Bacteria | 1243 |
| 482 | Ga0307411_10045891 | 3300032005 | Bacteria | 2813 |
| 483 | Ga0307411_10143744 | 3300032005 | Bacteria | 1763 |
| 484 | Ga0307415_100013417 | 3300032126 | Bacteria | 4785 |
| 485 | Ga0307507_10038131 | 3300033179 | Bacteria | 4878 |
| 486 | Ga0307510_10003542 | 3300033180 | Bacteria | 18212 |
| 487 | Ga0307510_10079638 | 3300033180 | Bacteria | 3193 |
| 488 | Ga0307510_10249954 | 3300033180 | Bacteria | 1261 |
| 489 | Ga0373943_0068861 | 3300035170 | Bacteria | 1788 |
| 490 | Ga0373946_0118093 | 3300035171 | Bacteria | 1208 |
| 491 | Ga0373955_0018125 | 3300035172 | Bacteria | 3496 |
| 492 | Ga0373935_0050688 | 3300035692 | Bacteria | 2635 |
| 493 | Ga0373935_0203829 | 3300035692 | Bacteria | 1368 |
| 494 | Ga0373935_0330084 | 3300035692 | Bacteria | 1084 |
| 495 | Ga0373927_0240151 | 3300035695 | Bacteria | 1191 |
| 496 | Ga0373947_0011021 | 3300035725 | Bacteria | 5187 |
| 497 | Ga0373937_0012463 | 3300036401 | Bacteria | 7480 |
| 498 | Ga0373937_0041722 | 3300036401 | Bacteria | 4186 |
| 499 | Ga0373937_0056460 | 3300036401 | Bacteria | 3606 |
| 500 | Ga0373925_0002589 | 3300037068 | Bacteria | 14381 |
| 501 | Ga0373925_0260885 | 3300037068 | Bacteria | 1392 |
| 502 | Ga0373925_0289313 | 3300037068 | Bacteria | 1321 |
| 503 | Ga0395899_0003396 | 3300037312 | Bacteria | 12636 |
| 504 | Ga0395900_0576401 | 3300037418 | Bacteria | 1067 |
| 505 | Ga0395898_0015141 | 3300037466 | Bacteria | 7916 |
| 506 | Ga0395898_0322622 | 3300037466 | Bacteria | 1473 |
| 507 | Ga0395905_0034539 | 3300037471 | Bacteria | 4748 |
| 508 | Ga0395905_0189175 | 3300037471 | Bacteria | 1931 |
| 509 | Ga0395901_0145388 | 3300038443 | Bacteria | 2492 |
| 510 | Ga0395901_0162681 | 3300038443 | Bacteria | 2344 |
| 511 | Ga0451793_0508741 | 3300041452 | Bacteria | 2127 |
| 512 | Ga0451795_0519482 | 3300041456 | Bacteria | 4041 |
| 513 | Ga0451798_0411187 | 3300041458 | Bacteria | 1151 |
| 514 | Ga0451800_0879857 | 3300041459 | Bacteria | 2460 |
| 515 | Ga0451804_1035411 | 3300041463 | Bacteria | 2196 |
| 516 | Ga0451833_0104380 | 3300041491 | Bacteria | 1539 |
| 517 | Ga0451853_0471898 | 3300041512 | Bacteria | 1035 |
| 518 | Ga0451577_0052512 | 3300042876 | Bacteria | 3639 |
| 519 | Ga0451577_0115280 | 3300042876 | Bacteria | 2405 |
| 520 | Ga0466972_0000285 | 3300044658 | Bacteria | 31510 |
| 521 | Ga0453683_0021466 | 3300044673 | Bacteria | 4123 |
| 522 | Ga0453683_0058416 | 3300044673 | Bacteria | 2413 |
| 523 | Ga0453684_0001928 | 3300044712 | Bacteria | 53626 |
| 524 | Ga0453684_0377689 | 3300044712 | Bacteria | 1592 |
| 525 | Ga0453684_0428899 | 3300044712 | Bacteria | 1475 |
| 526 | Ga0451576_0000057 | 3300045051 | Bacteria | 300798 |
| 527 | Ga0451576_0022955 | 3300045051 | Bacteria | 6761 |
| 528 | Ga0451576_0151313 | 3300045051 | Bacteria | 2420 |
| 529 | Ga0451576_0501894 | 3300045051 | Bacteria | 1275 |
| 530 | Ga0466967_0490440 | 3300045976 | Bacteria | 1205 |
| 531 | Ga0495592_0000237 | 3300046454 | Bacteria | 47510 |
| 532 | Ga0495592_0123683 | 3300046454 | Bacteria | 1817 |
| 533 | Ga0495653_0057307 | 3300046463 | Bacteria | 2966 |
| 534 | Ga0495650_0048024 | 3300046471 | Bacteria | 1781 |
| 535 | Ga0495664_0081029 | 3300046477 | Bacteria | 1946 |
| 536 | Ga0495664_0117245 | 3300046477 | Bacteria | 1610 |
| 537 | Ga0495610_0033947 | 3300046512 | Bacteria | 2632 |
| 538 | Ga0495610_0055012 | 3300046512 | Bacteria | 1920 |
| 539 | Ga0495620_0072242 | 3300046515 | Bacteria | 1409 |
| 540 | Ga0495628_0034745 | 3300046516 | Bacteria | 4054 |
| 541 | Ga0495628_0142321 | 3300046516 | Bacteria | 1830 |
| 542 | Ga0495630_0360372 | 3300046517 | Bacteria | 1113 |
| 543 | Ga0495632_0004239 | 3300046519 | Bacteria | 9798 |
| 544 | Ga0495648_0098074 | 3300046524 | Bacteria | 1624 |
| 545 | Ga0495598_0022132 | 3300046537 | Bacteria | 1698 |
| 546 | Ga0495597_0007887 | 3300046542 | Bacteria | 5368 |
| 547 | Ga0495645_0002535 | 3300046543 | Bacteria | 12403 |
| 548 | Ga0495645_0040954 | 3300046543 | Bacteria | 3378 |
| 549 | Ga0495645_0179794 | 3300046543 | Bacteria | 1450 |
| 550 | Ga0495667_0005229 | 3300046559 | Bacteria | 8773 |
| 551 | Ga0495625_0000250 | 3300046660 | Bacteria | 84096 |
| 552 | Ga0495625_0002839 | 3300046660 | Bacteria | 18202 |
| 553 | Ga0495625_0031472 | 3300046660 | Bacteria | 3946 |
| 554 | Ga0495635_0110054 | 3300046663 | Bacteria | 1882 |
| 555 | Ga0495599_0146695 | 3300046678 | Bacteria | 1462 |
| 556 | Ga0495623_0046037 | 3300046679 | Bacteria | 2769 |
| 557 | Ga0495658_0031936 | 3300046683 | Bacteria | 2872 |
| 558 | Ga0495658_0032504 | 3300046683 | Bacteria | 2850 |
| 559 | Ga0495658_0034335 | 3300046683 | Bacteria | 2783 |
| 560 | Ga0495670_0156607 | 3300046691 | Bacteria | 1196 |
| 561 | Ga0495604_0268337 | 3300047317 | Bacteria | 1157 |
| 562 | Ga0495687_002606 | 3300047443 | Bacteria | 14175 |
| 563 | Ga0495684_0084397 | 3300047471 | Bacteria | 2409 |
| 564 | Ga0495686_0094368 | 3300047472 | Bacteria | 1813 |
| 565 | Ga0496100_0001162 | 3300048903 | Bacteria | 12807 |
| 566 | Ga0496101_0020120 | 3300048904 | Bacteria | 4564 |
| 567 | Ga0496102_0029174 | 3300048905 | Bacteria | 4934 |
| 568 | Ga0496103_0005038 | 3300048906 | Bacteria | 7969 |
| 569 | Ga0496104_0003675 | 3300048907 | Bacteria | 13249 |
| 570 | Ga0496104_0035846 | 3300048907 | Bacteria | 4634 |
| 571 | Ga0496104_0055651 | 3300048907 | Bacteria | 3741 |
| 572 | Ga0496105_0002647 | 3300048908 | Bacteria | 13035 |
| 573 | Ga0496105_0089552 | 3300048908 | Bacteria | 2542 |
| 574 | Ga0496106_0032767 | 3300048909 | Bacteria | 3875 |
| 575 | Ga0496107_0201136 | 3300048910 | Bacteria | 1481 |
| 576 | Ga0496108_0058761 | 3300048911 | Bacteria | 3233 |
| 577 | Ga0496108_0350437 | 3300048911 | Bacteria | 1288 |
| 578 | Ga0496109_0026669 | 3300048912 | Bacteria | 5155 |
| 579 | Ga0496109_0126638 | 3300048912 | Bacteria | 2382 |
| 580 | Ga0496110_0014667 | 3300048913 | Bacteria | 6514 |
| 581 | Ga0496110_0052513 | 3300048913 | Bacteria | 3581 |
| 582 | Ga0496111_0057811 | 3300048914 | Bacteria | 2807 |
| 583 | Ga0496111_0218216 | 3300048914 | Bacteria | 1417 |
| 584 | Ga0496112_0270675 | 3300048915 | Bacteria | 1647 |
| 585 | Ga0496114_0157070 | 3300048917 | Bacteria | 1975 |
| 586 | Ga0501292_000357 | 3300049515 | Bacteria | 6218 |
| 587 | Ga0501301_004255 | 3300049524 | Bacteria | 1011 |
| 588 | Ga0501043_0000243 | 3300049579 | Bacteria | 49191 |
| 589 | Ga0501046_0000137 | 3300049580 | Bacteria | 78496 |
| 590 | Ga0501047_0000050 | 3300049581 | Bacteria | 155628 |
| 591 | Ga0501047_0020948 | 3300049581 | Bacteria | 6280 |
| 592 | Ga0501048_0000518 | 3300049582 | Bacteria | 27066 |
| 593 | Ga0501069_0001560 | 3300049585 | Bacteria | 11324 |
| 594 | Ga0501070_0097158 | 3300049586 | Bacteria | 2436 |
| 595 | Ga0501073_0084572 | 3300049589 | Bacteria | 2207 |
| 596 | Ga0501074_0173749 | 3300049590 | Bacteria | 1537 |
| 597 | Ga0501206_005704 | 3300049653 | Bacteria | 1606 |
| 598 | Ga0501079_0038777 | 3300049741 | Bacteria | 3674 |
| 599 | Ga0501083_0074131 | 3300049744 | Bacteria | 2261 |
| 600 | Ga0501265_001586 | 3300049762 | Bacteria | 2558 |
| 601 | Ga0501044_0414340 | 3300049823 | Bacteria | 1258 |
| 602 | Ga0501045_0006004 | 3300049824 | Bacteria | 8405 |
| 603 | nmdc:mga03n38_24185_c1 | 3300050490 | Bacteria | 2481 |
| 604 | nmdc:mga00v17_10750_c1 | 3300050491 | Bacteria | 5014 |
| 605 | nmdc:mga0k408_1828_c1 | 3300050493 | Bacteria | 3176 |
| 606 | nmdc:mga0k408_40930_c1 | 3300050493 | Bacteria | 2668 |
| 607 | nmdc:mga0k408_65527_c1 | 3300050493 | Bacteria | 2115 |
| 608 | nmdc:mga0k408_87409_c1 | 3300050493 | Bacteria | 1831 |
| 609 | nmdc:mga07m45_113000_c1 | 3300050496 | Bacteria | 1565 |
| 610 | nmdc:mga07m45_32625_c1 | 3300050496 | Bacteria | 2484 |
| 611 | nmdc:mga07m45_4349_c1 | 3300050496 | Bacteria | 6930 |
| 612 | nmdc:mga07m45_84521_c1 | 3300050496 | Bacteria | 1815 |
| 613 | nmdc:mga07m45_93090_c1 | 3300050496 | Bacteria | 1728 |
| 614 | nmdc:mga05p37_44213_c1 | 3300050507 | Bacteria | 5480 |
| 615 | nmdc:mga08y16_346981_c1 | 3300050511 | Bacteria | 1525 |
| 616 | nmdc:mga0sz30_92501_c1 | 3300050516 | Bacteria | 1317 |
| 617 | Ga0500578_0000437 | 3300053086 | Bacteria | 51031 |
| 618 | Ga0500644_0001746 | 3300053088 | Bacteria | 5626 |
| 619 | Ga0500651_0097581 | 3300053093 | Bacteria | 1805 |
| 620 | Ga0500562_029872 | 3300053108 | Bacteria | 1435 |
| 621 | Ga0500594_0001437 | 3300053118 | Bacteria | 5165 |
| 622 | Ga0500628_004814 | 3300053129 | Bacteria | 2239 |
| 623 | Ga0500642_0004133 | 3300053130 | Bacteria | 4493 |
| 624 | Ga0500652_000312 | 3300053131 | Bacteria | 17547 |
| 625 | Ga0500559_0000602 | 3300053136 | Bacteria | 24517 |
| 626 | Ga0500568_0018889 | 3300053139 | Bacteria | 3007 |
| 627 | Ga0500622_0000164 | 3300053156 | Bacteria | 70630 |
| 628 | Ga0500622_0017664 | 3300053156 | Bacteria | 3796 |
| 629 | Ga0500587_006521 | 3300053739 | Bacteria | 1544 |
| 630 | Ga0500587_008828 | 3300053739 | Bacteria | 1294 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100249168 | Ga0070671_1002491682 | 280 |
| 2 | 3300005356 | Ga0070674_100020342 | Ga0070674_1000203422 | 284 |
| 3 | 3300025937 | Ga0207669_10158667 | Ga0207669_101586672 | 285 |
| 4 | 3300005618 | Ga0068864_100032186 | Ga0068864_1000321862 | 286 |
| 5 | 3300025940 | Ga0207691_10055754 | Ga0207691_100557543 | 286 |
| 6 | 3300031995 | Ga0307409_100089816 | Ga0307409_1000898162 | 286 |
| 7 | 3300005328 | Ga0070676_10234980 | Ga0070676_102349801 | 287 |
| 8 | 3300005331 | Ga0070670_100119934 | Ga0070670_1001199342 | 287 |
| 9 | 3300005333 | Ga0070677_10019165 | Ga0070677_100191652 | 287 |
| 10 | 3300005459 | Ga0068867_100246319 | Ga0068867_1002463192 | 287 |
| 11 | 3300005548 | Ga0070665_100184077 | Ga0070665_1001840771 | 287 |
| 12 | 3300005563 | Ga0068855_100297315 | Ga0068855_1002973151 | 287 |
| 13 | 3300025901 | Ga0207688_10008890 | Ga0207688_100088904 | 287 |
| 14 | 3300025936 | Ga0207670_10164825 | Ga0207670_101648252 | 287 |
| 15 | 3300025940 | Ga0207691_10117408 | Ga0207691_101174083 | 287 |
| 16 | 3300025960 | Ga0207651_10056669 | Ga0207651_100566693 | 287 |
| 17 | 3300028794 | Ga0307515_10112578 | Ga0307515_101125782 | 287 |
| 18 | 3300049581 | Ga0501047_0020948 | Ga0501047_0020948_101_1069 | 287 |
| 19 | 3300049585 | Ga0501069_0001560 | Ga0501069_0001560_10225_11193 | 287 |
| 20 | 3300049589 | Ga0501073_0084572 | Ga0501073_0084572_550_1518 | 287 |
| 21 | 3300049823 | Ga0501044_0414340 | Ga0501044_0414340_37_1005 | 287 |
| 22 | 3300050511 | nmdc:mga08y16_346981_c1 | nmdc:mga08y16_346981_c1_424_1416 | 287 |
| 23 | 3300053108 | Ga0500562_029872 | Ga0500562_029872_78_1043 | 287 |
| 24 | 3300005330 | Ga0070690_100094564 | Ga0070690_1000945643 | 290 |
| 25 | 3300009176 | Ga0105242_10301046 | Ga0105242_103010462 | 290 |
| 26 | 3300009177 | Ga0105248_10014904 | Ga0105248_100149046 | 290 |
| 27 | 3300009551 | Ga0105238_10209623 | Ga0105238_102096233 | 290 |
| 28 | 3300013296 | Ga0157374_10156302 | Ga0157374_101563022 | 290 |
| 29 | 3300014745 | Ga0157377_10011668 | Ga0157377_100116683 | 290 |
| 30 | 3300025922 | Ga0207646_10263396 | Ga0207646_102633962 | 290 |
| 31 | 3300025927 | Ga0207687_10080561 | Ga0207687_100805612 | 290 |
| 32 | 3300025936 | Ga0207670_10133540 | Ga0207670_101335402 | 290 |
| 33 | 3300025941 | Ga0207711_10096022 | Ga0207711_100960223 | 290 |
| 34 | 3300025941 | Ga0207711_10335657 | Ga0207711_103356572 | 290 |
| 35 | 3300035172 | Ga0373955_0018125 | Ga0373955_0018125_94_1062 | 290 |
| 36 | 3300035692 | Ga0373935_0330084 | Ga0373935_0330084_82_1050 | 290 |
| 37 | 3300046454 | Ga0495592_0123683 | Ga0495592_0123683_127_1095 | 290 |
| 38 | 3300046463 | Ga0495653_0057307 | Ga0495653_0057307_671_1639 | 290 |
| 39 | 3300046477 | Ga0495664_0081029 | Ga0495664_0081029_575_1543 | 290 |
| 40 | 3300046516 | Ga0495628_0034745 | Ga0495628_0034745_234_1202 | 290 |
| 41 | 3300046543 | Ga0495645_0002535 | Ga0495645_0002535_4735_5703 | 290 |
| 42 | 3300046559 | Ga0495667_0005229 | Ga0495667_0005229_2962_3930 | 290 |
| 43 | 3300046678 | Ga0495599_0146695 | Ga0495599_0146695_391_1359 | 290 |
| 44 | 3300046679 | Ga0495623_0046037 | Ga0495623_0046037_1224_2192 | 290 |
| 45 | 3300003773 | Ga0055537_1000011 | Ga0055537_10000116 | 292 |
| 46 | 3300003784 | Ga0055534_1000020 | Ga0055534_1000020129 | 292 |
| 47 | 3300003790 | Ga0055528_1000523 | Ga0055528_100052328 | 292 |
| 48 | 3300005468 | Ga0070707_100114145 | Ga0070707_1001141453 | 292 |
| 49 | 3300005546 | Ga0070696_100014115 | Ga0070696_1000141152 | 292 |
| 50 | 3300006353 | Ga0075370_10003454 | Ga0075370_100034546 | 292 |
| 51 | 3300006948 | Ga0099826_10000157 | Ga0099826_1000015726 | 292 |
| 52 | 3300025263 | Ga0209565_1000058 | Ga0209565_1000058168 | 292 |
| 53 | 3300025273 | Ga0209673_1000053 | Ga0209673_1000053244 | 292 |
| 54 | 3300025291 | Ga0209675_1000010 | Ga0209675_1000010525 | 292 |
| 55 | 3300025292 | Ga0209676_1016058 | Ga0209676_10160582 | 292 |
| 56 | 3300025294 | Ga0209025_1008535 | Ga0209025_10085353 | 292 |
| 57 | 3300027666 | Ga0209282_1000879 | Ga0209282_100087910 | 292 |
| 58 | 3300046660 | Ga0495625_0000250 | Ga0495625_0000250_2828_3796 | 292 |
| 59 | 3300005333 | Ga0070677_10023781 | Ga0070677_100237812 | 293 |
| 60 | 3300028379 | Ga0268266_10359904 | Ga0268266_103599042 | 293 |
| 61 | 3300009093 | Ga0105240_10566180 | Ga0105240_105661802 | 294 |
| 62 | 3300048911 | Ga0496108_0350437 | Ga0496108_0350437_158_1126 | 294 |
| 63 | 3300049586 | Ga0501070_0097158 | Ga0501070_0097158_1425_2393 | 294 |
| 64 | 3300049590 | Ga0501074_0173749 | Ga0501074_0173749_129_1097 | 294 |
| 65 | 3300049741 | Ga0501079_0038777 | Ga0501079_0038777_1389_2357 | 294 |
| 66 | 3300049744 | Ga0501083_0074131 | Ga0501083_0074131_1171_2139 | 294 |
| 67 | 3300005295 | Ga0065707_10086252 | Ga0065707_100862525 | 295 |
| 68 | 3300005563 | Ga0068855_100022146 | Ga0068855_1000221469 | 295 |
| 69 | 3300009093 | Ga0105240_10427033 | Ga0105240_104270331 | 295 |
| 70 | 3300013307 | Ga0157372_10113334 | Ga0157372_101133342 | 295 |
| 71 | 3300025949 | Ga0207667_10409578 | Ga0207667_104095782 | 295 |
| 72 | 3300045976 | Ga0466967_0490440 | Ga0466967_0490440_79_1047 | 295 |
| 73 | 3300037466 | Ga0395898_0015141 | Ga0395898_0015141_6963_7856 | 296 |
| 74 | 3300047317 | Ga0495604_0268337 | Ga0495604_0268337_26_994 | 296 |
| 75 | 3300005438 | Ga0070701_10085078 | Ga0070701_100850782 | 297 |
| 76 | 3300005564 | Ga0070664_100180954 | Ga0070664_1001809542 | 297 |
| 77 | 3300044712 | Ga0453684_0428899 | Ga0453684_0428899_397_1422 | 297 |
| 78 | 3300005844 | Ga0068862_100113991 | Ga0068862_1001139913 | 299 |
| 79 | 3300006051 | Ga0075364_10080287 | Ga0075364_100802872 | 299 |
| 80 | 3300007265 | Ga0099794_10002963 | Ga0099794_100029633 | 299 |
| 81 | 3300025942 | Ga0207689_10114270 | Ga0207689_101142703 | 299 |
| 82 | 3300027671 | Ga0209588_1003800 | Ga0209588_10038003 | 299 |
| 83 | 3300031901 | Ga0307406_10146871 | Ga0307406_101468711 | 299 |
| 84 | 3300031995 | Ga0307409_100003227 | Ga0307409_1000032278 | 299 |
| 85 | 3300032126 | Ga0307415_100013417 | Ga0307415_1000134173 | 299 |
| 86 | 3300050491 | nmdc:mga00v17_10750_c1 | nmdc:mga00v17_10750_c1_3456_4454 | 299 |
| 87 | 3300006177 | Ga0075362_10024666 | Ga0075362_100246662 | 300 |
| 88 | 3300025901 | Ga0207688_10062569 | Ga0207688_100625693 | 300 |
| 89 | 3300025914 | Ga0207671_10057337 | Ga0207671_100573373 | 300 |
| 90 | 3300025933 | Ga0207706_10021166 | Ga0207706_100211667 | 300 |
| 91 | 3300025933 | Ga0207706_10038451 | Ga0207706_100384512 | 300 |
| 92 | 3300026142 | Ga0207698_10154570 | Ga0207698_101545702 | 300 |
| 93 | 3300037068 | Ga0373925_0002589 | Ga0373925_0002589_11359_12468 | 300 |
| 94 | 3300005338 | Ga0068868_100004726 | Ga0068868_1000047268 | 301 |
| 95 | 3300005338 | Ga0068868_100038261 | Ga0068868_1000382613 | 301 |
| 96 | 3300005339 | Ga0070660_100155198 | Ga0070660_1001551981 | 301 |
| 97 | 3300005340 | Ga0070689_100031651 | Ga0070689_1000316515 | 301 |
| 98 | 3300005344 | Ga0070661_100177986 | Ga0070661_1001779861 | 301 |
| 99 | 3300005347 | Ga0070668_100027181 | Ga0070668_1000271813 | 301 |
| 100 | 3300005353 | Ga0070669_100001968 | Ga0070669_1000019684 | 301 |
| 101 | 3300005354 | Ga0070675_100005625 | Ga0070675_1000056253 | 301 |
| 102 | 3300005356 | Ga0070674_100350084 | Ga0070674_1003500841 | 301 |
| 103 | 3300005365 | Ga0070688_100122829 | Ga0070688_1001228292 | 301 |
| 104 | 3300005366 | Ga0070659_100008351 | Ga0070659_1000083516 | 301 |
| 105 | 3300005367 | Ga0070667_100004472 | Ga0070667_1000044727 | 301 |
| 106 | 3300005457 | Ga0070662_100001468 | Ga0070662_10000146813 | 301 |
| 107 | 3300005459 | Ga0068867_100018725 | Ga0068867_1000187253 | 301 |
| 108 | 3300005459 | Ga0068867_100132776 | Ga0068867_1001327761 | 301 |
| 109 | 3300005466 | Ga0070685_10005883 | Ga0070685_100058837 | 301 |
| 110 | 3300005535 | Ga0070684_100098116 | Ga0070684_1000981162 | 301 |
| 111 | 3300005543 | Ga0070672_100011945 | Ga0070672_1000119454 | 301 |
| 112 | 3300005543 | Ga0070672_100096113 | Ga0070672_1000961133 | 301 |
| 113 | 3300005544 | Ga0070686_100025147 | Ga0070686_1000251473 | 301 |
| 114 | 3300005564 | Ga0070664_100121416 | Ga0070664_1001214162 | 301 |
| 115 | 3300005616 | Ga0068852_100017057 | Ga0068852_1000170573 | 301 |
| 116 | 3300005616 | Ga0068852_100026411 | Ga0068852_1000264113 | 301 |
| 117 | 3300005616 | Ga0068852_100036243 | Ga0068852_1000362434 | 301 |
| 118 | 3300005617 | Ga0068859_100072262 | Ga0068859_1000722624 | 301 |
| 119 | 3300005617 | Ga0068859_100100370 | Ga0068859_1001003702 | 301 |
| 120 | 3300005617 | Ga0068859_100108378 | Ga0068859_1001083784 | 301 |
| 121 | 3300005718 | Ga0068866_10056518 | Ga0068866_100565183 | 301 |
| 122 | 3300005719 | Ga0068861_100004400 | Ga0068861_1000044002 | 301 |
| 123 | 3300005719 | Ga0068861_100021163 | Ga0068861_1000211633 | 301 |
| 124 | 3300005834 | Ga0068851_10038084 | Ga0068851_100380842 | 301 |
| 125 | 3300005841 | Ga0068863_100006090 | Ga0068863_1000060907 | 301 |
| 126 | 3300005842 | Ga0068858_100001935 | Ga0068858_1000019354 | 301 |
| 127 | 3300005842 | Ga0068858_100031848 | Ga0068858_1000318483 | 301 |
| 128 | 3300005843 | Ga0068860_100000605 | Ga0068860_10000060514 | 301 |
| 129 | 3300005843 | Ga0068860_100001949 | Ga0068860_10000194916 | 301 |
| 130 | 3300005844 | Ga0068862_100047762 | Ga0068862_1000477624 | 301 |
| 131 | 3300006237 | Ga0097621_100119759 | Ga0097621_1001197593 | 301 |
| 132 | 3300006237 | Ga0097621_100341436 | Ga0097621_1003414362 | 301 |
| 133 | 3300006881 | Ga0068865_100342528 | Ga0068865_1003425282 | 301 |
| 134 | 3300006931 | Ga0097620_100072264 | Ga0097620_1000722644 | 301 |
| 135 | 3300006931 | Ga0097620_100100368 | Ga0097620_1001003683 | 301 |
| 136 | 3300006931 | Ga0097620_100108379 | Ga0097620_1001083791 | 301 |
| 137 | 3300009093 | Ga0105240_10507864 | Ga0105240_105078642 | 301 |
| 138 | 3300009098 | Ga0105245_10365519 | Ga0105245_103655191 | 301 |
| 139 | 3300009148 | Ga0105243_10017179 | Ga0105243_100171793 | 301 |
| 140 | 3300009148 | Ga0105243_10096542 | Ga0105243_100965422 | 301 |
| 141 | 3300009174 | Ga0105241_10044466 | Ga0105241_100444663 | 301 |
| 142 | 3300009176 | Ga0105242_10010661 | Ga0105242_100106613 | 301 |
| 143 | 3300009176 | Ga0105242_10023954 | Ga0105242_100239544 | 301 |
| 144 | 3300009551 | Ga0105238_10160530 | Ga0105238_101605303 | 301 |
| 145 | 3300009551 | Ga0105238_10540303 | Ga0105238_105403031 | 301 |
| 146 | 3300009553 | Ga0105249_10038932 | Ga0105249_100389323 | 301 |
| 147 | 3300013100 | Ga0157373_10050849 | Ga0157373_100508493 | 301 |
| 148 | 3300013102 | Ga0157371_10148154 | Ga0157371_101481542 | 301 |
| 149 | 3300013306 | Ga0163162_10007037 | Ga0163162_100070373 | 301 |
| 150 | 3300013306 | Ga0163162_10028873 | Ga0163162_100288734 | 301 |
| 151 | 3300013306 | Ga0163162_10033703 | Ga0163162_100337033 | 301 |
| 152 | 3300013306 | Ga0163162_10229351 | Ga0163162_102293513 | 301 |
| 153 | 3300013307 | Ga0157372_10104054 | Ga0157372_101040543 | 301 |
| 154 | 3300013308 | Ga0157375_10003084 | Ga0157375_1000308414 | 301 |
| 155 | 3300013308 | Ga0157375_10082795 | Ga0157375_100827954 | 301 |
| 156 | 3300013308 | Ga0157375_10106295 | Ga0157375_101062953 | 301 |
| 157 | 3300013308 | Ga0157375_10224419 | Ga0157375_102244192 | 301 |
| 158 | 3300014326 | Ga0157380_10027756 | Ga0157380_100277564 | 301 |
| 159 | 3300014326 | Ga0157380_10089863 | Ga0157380_100898632 | 301 |
| 160 | 3300014326 | Ga0157380_10509252 | Ga0157380_105092521 | 301 |
| 161 | 3300014968 | Ga0157379_10036974 | Ga0157379_100369743 | 301 |
| 162 | 3300025321 | Ga0207656_10027818 | Ga0207656_100278183 | 301 |
| 163 | 3300025893 | Ga0207682_10019175 | Ga0207682_100191752 | 301 |
| 164 | 3300025899 | Ga0207642_10007733 | Ga0207642_100077333 | 301 |
| 165 | 3300025901 | Ga0207688_10078859 | Ga0207688_100788592 | 301 |
| 166 | 3300025903 | Ga0207680_10034428 | Ga0207680_100344283 | 301 |
| 167 | 3300025907 | Ga0207645_10064111 | Ga0207645_100641113 | 301 |
| 168 | 3300025909 | Ga0207705_10150517 | Ga0207705_101505171 | 301 |
| 169 | 3300025913 | Ga0207695_10444384 | Ga0207695_104443841 | 301 |
| 170 | 3300025918 | Ga0207662_10016139 | Ga0207662_100161393 | 301 |
| 171 | 3300025923 | Ga0207681_10000893 | Ga0207681_100008934 | 301 |
| 172 | 3300025924 | Ga0207694_10233034 | Ga0207694_102330342 | 301 |
| 173 | 3300025924 | Ga0207694_10353159 | Ga0207694_103531591 | 301 |
| 174 | 3300025926 | Ga0207659_10023895 | Ga0207659_100238955 | 301 |
| 175 | 3300025926 | Ga0207659_10047702 | Ga0207659_100477022 | 301 |
| 176 | 3300025926 | Ga0207659_10428809 | Ga0207659_104288091 | 301 |
| 177 | 3300025932 | Ga0207690_10022184 | Ga0207690_100221842 | 301 |
| 178 | 3300025932 | Ga0207690_10317396 | Ga0207690_103173962 | 301 |
| 179 | 3300025934 | Ga0207686_10010321 | Ga0207686_100103212 | 301 |
| 180 | 3300025935 | Ga0207709_10014157 | Ga0207709_100141573 | 301 |
| 181 | 3300025938 | Ga0207704_10050264 | Ga0207704_100502641 | 301 |
| 182 | 3300025940 | Ga0207691_10029152 | Ga0207691_100291522 | 301 |
| 183 | 3300025940 | Ga0207691_10122572 | Ga0207691_101225722 | 301 |
| 184 | 3300025941 | Ga0207711_10148439 | Ga0207711_101484393 | 301 |
| 185 | 3300025942 | Ga0207689_10024677 | Ga0207689_100246774 | 301 |
| 186 | 3300025942 | Ga0207689_10036423 | Ga0207689_100364233 | 301 |
| 187 | 3300025942 | Ga0207689_10146849 | Ga0207689_101468492 | 301 |
| 188 | 3300025944 | Ga0207661_10082073 | Ga0207661_100820733 | 301 |
| 189 | 3300025945 | Ga0207679_10009947 | Ga0207679_100099475 | 301 |
| 190 | 3300025960 | Ga0207651_10101788 | Ga0207651_101017882 | 301 |
| 191 | 3300025972 | Ga0207668_10030011 | Ga0207668_100300114 | 301 |
| 192 | 3300025981 | Ga0207640_10117148 | Ga0207640_101171482 | 301 |
| 193 | 3300025986 | Ga0207658_10005885 | Ga0207658_100058854 | 301 |
| 194 | 3300026023 | Ga0207677_10029828 | Ga0207677_100298282 | 301 |
| 195 | 3300026023 | Ga0207677_10052530 | Ga0207677_100525302 | 301 |
| 196 | 3300026023 | Ga0207677_10057076 | Ga0207677_100570763 | 301 |
| 197 | 3300026035 | Ga0207703_10014214 | Ga0207703_100142143 | 301 |
| 198 | 3300026035 | Ga0207703_10062874 | Ga0207703_100628743 | 301 |
| 199 | 3300026041 | Ga0207639_10031455 | Ga0207639_100314553 | 301 |
| 200 | 3300026067 | Ga0207678_10035031 | Ga0207678_100350313 | 301 |
| 201 | 3300026067 | Ga0207678_10155496 | Ga0207678_101554962 | 301 |
| 202 | 3300026075 | Ga0207708_10006045 | Ga0207708_100060454 | 301 |
| 203 | 3300026075 | Ga0207708_10006674 | Ga0207708_100066744 | 301 |
| 204 | 3300026075 | Ga0207708_10105796 | Ga0207708_101057962 | 301 |
| 205 | 3300026078 | Ga0207702_10085468 | Ga0207702_100854681 | 301 |
| 206 | 3300026088 | Ga0207641_10031857 | Ga0207641_100318574 | 301 |
| 207 | 3300026089 | Ga0207648_10008565 | Ga0207648_100085654 | 301 |
| 208 | 3300026089 | Ga0207648_10012331 | Ga0207648_100123314 | 301 |
| 209 | 3300026089 | Ga0207648_10069390 | Ga0207648_100693902 | 301 |
| 210 | 3300026095 | Ga0207676_10002235 | Ga0207676_100022353 | 301 |
| 211 | 3300026095 | Ga0207676_10059604 | Ga0207676_100596044 | 301 |
| 212 | 3300026095 | Ga0207676_10472657 | Ga0207676_104726571 | 301 |
| 213 | 3300026116 | Ga0207674_10066233 | Ga0207674_100662332 | 301 |
| 214 | 3300026116 | Ga0207674_10069225 | Ga0207674_100692253 | 301 |
| 215 | 3300026118 | Ga0207675_100019410 | Ga0207675_1000194104 | 301 |
| 216 | 3300026118 | Ga0207675_100022443 | Ga0207675_1000224433 | 301 |
| 217 | 3300026118 | Ga0207675_100044234 | Ga0207675_1000442342 | 301 |
| 218 | 3300026121 | Ga0207683_10252589 | Ga0207683_102525892 | 301 |
| 219 | 3300026142 | Ga0207698_10009254 | Ga0207698_100092543 | 301 |
| 220 | 3300026142 | Ga0207698_10012799 | Ga0207698_100127993 | 301 |
| 221 | 3300026142 | Ga0207698_10085949 | Ga0207698_100859493 | 301 |
| 222 | 3300028380 | Ga0268265_10018678 | Ga0268265_100186782 | 301 |
| 223 | 3300028380 | Ga0268265_10051971 | Ga0268265_100519713 | 301 |
| 224 | 3300028381 | Ga0268264_10010213 | Ga0268264_100102134 | 301 |
| 225 | 3300028381 | Ga0268264_10034120 | Ga0268264_100341203 | 301 |
| 226 | 3300035695 | Ga0373927_0240151 | Ga0373927_0240151_148_1119 | 301 |
| 227 | 3300048907 | Ga0496104_0055651 | Ga0496104_0055651_2323_3294 | 301 |
| 228 | 3300048910 | Ga0496107_0201136 | Ga0496107_0201136_47_1096 | 301 |
| 229 | 3300048911 | Ga0496108_0058761 | Ga0496108_0058761_177_1226 | 301 |
| 230 | 3300048912 | Ga0496109_0026669 | Ga0496109_0026669_1540_2589 | 301 |
| 231 | 3300048913 | Ga0496110_0014667 | Ga0496110_0014667_1927_2898 | 301 |
| 232 | 3300048914 | Ga0496111_0218216 | Ga0496111_0218216_18_989 | 301 |
| 233 | 3300048915 | Ga0496112_0270675 | Ga0496112_0270675_524_1573 | 301 |
| 234 | 3300005354 | Ga0070675_100038647 | Ga0070675_1000386472 | 302 |
| 235 | 3300005355 | Ga0070671_100152527 | Ga0070671_1001525272 | 302 |
| 236 | 3300005367 | Ga0070667_100037047 | Ga0070667_1000370473 | 302 |
| 237 | 3300005539 | Ga0068853_100172161 | Ga0068853_1001721612 | 302 |
| 238 | 3300005543 | Ga0070672_100011563 | Ga0070672_1000115633 | 302 |
| 239 | 3300005614 | Ga0068856_100043926 | Ga0068856_1000439262 | 302 |
| 240 | 3300005617 | Ga0068859_100161085 | Ga0068859_1001610853 | 302 |
| 241 | 3300005719 | Ga0068861_100062590 | Ga0068861_1000625903 | 302 |
| 242 | 3300005841 | Ga0068863_100023505 | Ga0068863_1000235054 | 302 |
| 243 | 3300005841 | Ga0068863_100045005 | Ga0068863_1000450054 | 302 |
| 244 | 3300005842 | Ga0068858_100108964 | Ga0068858_1001089642 | 302 |
| 245 | 3300005843 | Ga0068860_100018751 | Ga0068860_1000187513 | 302 |
| 246 | 3300006237 | Ga0097621_100115403 | Ga0097621_1001154032 | 302 |
| 247 | 3300006931 | Ga0097620_100161093 | Ga0097620_1001610933 | 302 |
| 248 | 3300009177 | Ga0105248_10154638 | Ga0105248_101546382 | 302 |
| 249 | 3300009177 | Ga0105248_10228499 | Ga0105248_102284991 | 302 |
| 250 | 3300013105 | Ga0157369_10033694 | Ga0157369_100336943 | 302 |
| 251 | 3300013306 | Ga0163162_10013137 | Ga0163162_100131373 | 302 |
| 252 | 3300013306 | Ga0163162_10263873 | Ga0163162_102638733 | 302 |
| 253 | 3300013308 | Ga0157375_10113993 | Ga0157375_101139933 | 302 |
| 254 | 3300025919 | Ga0207657_10157087 | Ga0207657_101570872 | 302 |
| 255 | 3300025920 | Ga0207649_10039911 | Ga0207649_100399113 | 302 |
| 256 | 3300025926 | Ga0207659_10021252 | Ga0207659_100212522 | 302 |
| 257 | 3300025940 | Ga0207691_10014086 | Ga0207691_100140863 | 302 |
| 258 | 3300025986 | Ga0207658_10028137 | Ga0207658_100281373 | 302 |
| 259 | 3300026035 | Ga0207703_10054103 | Ga0207703_100541033 | 302 |
| 260 | 3300026088 | Ga0207641_10052397 | Ga0207641_100523971 | 302 |
| 261 | 3300026118 | Ga0207675_100061012 | Ga0207675_1000610123 | 302 |
| 262 | 3300026142 | Ga0207698_10105396 | Ga0207698_101053962 | 302 |
| 263 | 3300028381 | Ga0268264_10036216 | Ga0268264_100362165 | 302 |
| 264 | 3300031456 | Ga0307513_10290646 | Ga0307513_102906462 | 302 |
| 265 | iso_pu_bacteria | 2643221672 | 2644396628 | 303 |
| 266 | 3300005530 | Ga0070679_100105012 | Ga0070679_1001050124 | 304 |
| 267 | 3300025921 | Ga0207652_10060606 | Ga0207652_100606061 | 304 |
| 268 | 3300026121 | Ga0207683_10121829 | Ga0207683_101218292 | 304 |
| 269 | 3300031824 | Ga0307413_10359672 | Ga0307413_103596721 | 304 |
| 270 | 3300031852 | Ga0307410_10228370 | Ga0307410_102283702 | 304 |
| 271 | 3300041458 | Ga0451798_0411187 | Ga0451798_0411187_18_968 | 304 |
| 272 | 3300003791 | Ga0055530_10010170 | Ga0055530_100101704 | 305 |
| 273 | 3300003792 | Ga0055540_1004422 | Ga0055540_10044225 | 305 |
| 274 | 3300003794 | Ga0055531_10006773 | Ga0055531_100067735 | 305 |
| 275 | 3300005288 | Ga0065714_10148141 | Ga0065714_101481411 | 305 |
| 276 | 3300005335 | Ga0070666_10078188 | Ga0070666_100781882 | 305 |
| 277 | 3300005844 | Ga0068862_100161432 | Ga0068862_1001614323 | 305 |
| 278 | 3300013104 | Ga0157370_10297900 | Ga0157370_102979001 | 305 |
| 279 | 3300013306 | Ga0163162_10056547 | Ga0163162_100565474 | 305 |
| 280 | 3300013308 | Ga0157375_10249409 | Ga0157375_102494092 | 305 |
| 281 | 3300014497 | Ga0182008_10001113 | Ga0182008_1000111321 | 305 |
| 282 | 3300015262 | Ga0182007_10003841 | Ga0182007_100038415 | 305 |
| 283 | 3300025292 | Ga0209676_1002070 | Ga0209676_100207012 | 305 |
| 284 | 3300025298 | Ga0209050_1001209 | Ga0209050_100120926 | 305 |
| 285 | 3300025303 | Ga0209051_1000145 | Ga0209051_1000145129 | 305 |
| 286 | 3300025304 | Ga0209257_1000495 | Ga0209257_100049552 | 305 |
| 287 | 3300025893 | Ga0207682_10023065 | Ga0207682_100230654 | 305 |
| 288 | 3300025903 | Ga0207680_10147539 | Ga0207680_101475392 | 305 |
| 289 | 3300025924 | Ga0207694_10266674 | Ga0207694_102666742 | 305 |
| 290 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001452 | 305 |
| 291 | 3300031241 | Ga0265325_10004203 | Ga0265325_100042032 | 305 |
| 292 | 3300031247 | Ga0265340_10067251 | Ga0265340_100672512 | 305 |
| 293 | 3300031251 | Ga0265327_10001296 | Ga0265327_100012966 | 305 |
| 294 | 3300031251 | Ga0265327_10009017 | Ga0265327_100090176 | 305 |
| 295 | 3300031711 | Ga0265314_10000013 | Ga0265314_10000013367 | 305 |
| 296 | 3300031901 | Ga0307406_10006613 | Ga0307406_100066135 | 305 |
| 297 | 3300041512 | Ga0451853_0471898 | Ga0451853_0471898_57_1025 | 305 |
| 298 | 3300044712 | Ga0453684_0001928 | Ga0453684_0001928_7691_8653 | 305 |
| 299 | 3300048903 | Ga0496100_0001162 | Ga0496100_0001162_2728_3696 | 305 |
| 300 | 3300048904 | Ga0496101_0020120 | Ga0496101_0020120_1500_2468 | 305 |
| 301 | 3300048905 | Ga0496102_0029174 | Ga0496102_0029174_2562_3530 | 305 |
| 302 | 3300048906 | Ga0496103_0005038 | Ga0496103_0005038_2189_3157 | 305 |
| 303 | 3300048907 | Ga0496104_0003675 | Ga0496104_0003675_4204_5172 | 305 |
| 304 | 3300048908 | Ga0496105_0002647 | Ga0496105_0002647_7981_8949 | 305 |
| 305 | 3300048909 | Ga0496106_0032767 | Ga0496106_0032767_2810_3778 | 305 |
| 306 | 3300048913 | Ga0496110_0052513 | Ga0496110_0052513_2072_3040 | 305 |
| 307 | 3300048914 | Ga0496111_0057811 | Ga0496111_0057811_226_1194 | 305 |
| 308 | 3300049579 | Ga0501043_0000243 | Ga0501043_0000243_27107_28075 | 305 |
| 309 | 3300049580 | Ga0501046_0000137 | Ga0501046_0000137_32403_33371 | 305 |
| 310 | 3300049581 | Ga0501047_0000050 | Ga0501047_0000050_133786_134754 | 305 |
| 311 | 3300049582 | Ga0501048_0000518 | Ga0501048_0000518_22721_23689 | 305 |
| 312 | 3300049824 | Ga0501045_0006004 | Ga0501045_0006004_6504_7472 | 305 |
| 313 | iso_pu_bacteria | 2842747753 | 2842749265 | 305 |
| 314 | iso_pu_bacteria | 2891633521 | 2891634391 | 306 |
| 315 | 3300005327 | Ga0070658_10001451 | Ga0070658_1000145110 | 307 |
| 316 | 3300005336 | Ga0070680_100343857 | Ga0070680_1003438572 | 307 |
| 317 | 3300025909 | Ga0207705_10042174 | Ga0207705_100421741 | 307 |
| 318 | 3300031344 | Ga0265316_10040119 | Ga0265316_100401193 | 307 |
| 319 | 3300035171 | Ga0373946_0118093 | Ga0373946_0118093_194_1165 | 307 |
| 320 | 3300035692 | Ga0373935_0050688 | Ga0373935_0050688_924_1895 | 307 |
| 321 | 3300035725 | Ga0373947_0011021 | Ga0373947_0011021_1643_2614 | 307 |
| 322 | 3300037312 | Ga0395899_0003396 | Ga0395899_0003396_1787_2770 | 307 |
| 323 | 3300037418 | Ga0395900_0576401 | Ga0395900_0576401_26_1009 | 307 |
| 324 | 3300037471 | Ga0395905_0034539 | Ga0395905_0034539_352_1335 | 307 |
| 325 | 3300038443 | Ga0395901_0145388 | Ga0395901_0145388_442_1425 | 307 |
| 326 | 3300042876 | Ga0451577_0052512 | Ga0451577_0052512_1781_2749 | 307 |
| 327 | 3300042876 | Ga0451577_0115280 | Ga0451577_0115280_46_1017 | 307 |
| 328 | 3300044673 | Ga0453683_0021466 | Ga0453683_0021466_1405_2373 | 307 |
| 329 | 3300045051 | Ga0451576_0000057 | Ga0451576_0000057_224777_225745 | 307 |
| 330 | iso_pu_bacteria | 2585428062 | 2587754453 | 307 |
| 331 | 3300005548 | Ga0070665_100175402 | Ga0070665_1001754022 | 308 |
| 332 | 3300006048 | Ga0075363_100038545 | Ga0075363_1000385452 | 308 |
| 333 | 3300028794 | Ga0307515_10000103 | Ga0307515_10000103123 | 308 |
| 334 | 3300050490 | nmdc:mga03n38_24185_c1 | nmdc:mga03n38_24185_c1_1385_2350 | 308 |
| 335 | iso_pu_bacteria | 2585428057 | 2587730117 | 308 |
| 336 | iso_pu_bacteria | 2585428058 | 2587734852 | 308 |
| 337 | iso_pu_bacteria | 2588253510 | 2588293190 | 308 |
| 338 | iso_pu_bacteria | 2643221592 | 2643968424 | 308 |
| 339 | iso_pu_bacteria | 2643221625 | 2644141784 | 308 |
| 340 | iso_pu_bacteria | 2643221648 | 2644272546 | 308 |
| 341 | iso_pu_bacteria | 2643221654 | 2644302705 | 308 |
| 342 | 3300005328 | Ga0070676_10016860 | Ga0070676_100168604 | 309 |
| 343 | 3300005331 | Ga0070670_100000316 | Ga0070670_10000031628 | 309 |
| 344 | 3300005333 | Ga0070677_10000457 | Ga0070677_100004575 | 309 |
| 345 | 3300005354 | Ga0070675_100000480 | Ga0070675_1000004809 | 309 |
| 346 | 3300005355 | Ga0070671_100000734 | Ga0070671_1000007349 | 309 |
| 347 | 3300005364 | Ga0070673_100001230 | Ga0070673_1000012302 | 309 |
| 348 | 3300005456 | Ga0070678_100013895 | Ga0070678_1000138954 | 309 |
| 349 | 3300005459 | Ga0068867_100000712 | Ga0068867_10000071218 | 309 |
| 350 | 3300005543 | Ga0070672_100000206 | Ga0070672_1000002064 | 309 |
| 351 | 3300005618 | Ga0068864_100010783 | Ga0068864_1000107834 | 309 |
| 352 | 3300005841 | Ga0068863_100238613 | Ga0068863_1002386131 | 309 |
| 353 | 3300005937 | Ga0081455_10074649 | Ga0081455_100746493 | 309 |
| 354 | 3300006237 | Ga0097621_100091348 | Ga0097621_1000913482 | 309 |
| 355 | 3300006353 | Ga0075370_10010143 | Ga0075370_100101434 | 309 |
| 356 | 3300006358 | Ga0068871_100057060 | Ga0068871_1000570602 | 309 |
| 357 | 3300009148 | Ga0105243_10079624 | Ga0105243_100796242 | 309 |
| 358 | 3300013308 | Ga0157375_10295803 | Ga0157375_102958032 | 309 |
| 359 | 3300017792 | Ga0163161_10014680 | Ga0163161_100146804 | 309 |
| 360 | 3300025315 | Ga0207697_10013102 | Ga0207697_100131023 | 309 |
| 361 | 3300025893 | Ga0207682_10000269 | Ga0207682_100002696 | 309 |
| 362 | 3300025907 | Ga0207645_10007282 | Ga0207645_100072823 | 309 |
| 363 | 3300025914 | Ga0207671_10131192 | Ga0207671_101311921 | 309 |
| 364 | 3300025925 | Ga0207650_10000172 | Ga0207650_1000017246 | 309 |
| 365 | 3300025926 | Ga0207659_10000066 | Ga0207659_1000006637 | 309 |
| 366 | 3300025931 | Ga0207644_10001237 | Ga0207644_1000123715 | 309 |
| 367 | 3300025940 | Ga0207691_10000265 | Ga0207691_1000026537 | 309 |
| 368 | 3300025960 | Ga0207651_10000267 | Ga0207651_100002678 | 309 |
| 369 | 3300025972 | Ga0207668_10070133 | Ga0207668_100701332 | 309 |
| 370 | 3300026121 | Ga0207683_10014997 | Ga0207683_100149974 | 309 |
| 371 | 3300028381 | Ga0268264_10084070 | Ga0268264_100840703 | 309 |
| 372 | 3300031456 | Ga0307513_10034306 | Ga0307513_100343062 | 309 |
| 373 | 3300031730 | Ga0307516_10020929 | Ga0307516_100209294 | 309 |
| 374 | 3300031731 | Ga0307405_10254188 | Ga0307405_102541882 | 309 |
| 375 | 3300031911 | Ga0307412_10053852 | Ga0307412_100538522 | 309 |
| 376 | 3300032002 | Ga0307416_100250242 | Ga0307416_1002502422 | 309 |
| 377 | 3300036401 | Ga0373937_0041722 | Ga0373937_0041722_3141_4106 | 309 |
| 378 | 3300046471 | Ga0495650_0048024 | Ga0495650_0048024_779_1756 | 309 |
| 379 | 3300046660 | Ga0495625_0031472 | Ga0495625_0031472_1593_2573 | 309 |
| 380 | 3300049515 | Ga0501292_000357 | Ga0501292_000357_4780_5754 | 309 |
| 381 | 3300049524 | Ga0501301_004255 | Ga0501301_004255_27_1001 | 309 |
| 382 | 3300049653 | Ga0501206_005704 | Ga0501206_005704_51_1025 | 309 |
| 383 | 3300049762 | Ga0501265_001586 | Ga0501265_001586_384_1358 | 309 |
| 384 | 3300050493 | nmdc:mga0k408_40930_c1 | nmdc:mga0k408_40930_c1_1299_2279 | 309 |
| 385 | 3300050496 | nmdc:mga07m45_32625_c1 | nmdc:mga07m45_32625_c1_394_1374 | 309 |
| 386 | 3300050496 | nmdc:mga07m45_84521_c1 | nmdc:mga07m45_84521_c1_610_1590 | 309 |
| 387 | 3300050516 | nmdc:mga0sz30_92501_c1 | nmdc:mga0sz30_92501_c1_69_1049 | 309 |
| 388 | 3300003794 | Ga0055531_10001135 | Ga0055531_100011359 | 310 |
| 389 | 3300005614 | Ga0068856_100064064 | Ga0068856_1000640643 | 310 |
| 390 | 3300005614 | Ga0068856_100213561 | Ga0068856_1002135613 | 310 |
| 391 | 3300005841 | Ga0068863_100396826 | Ga0068863_1003968261 | 310 |
| 392 | 3300006178 | Ga0075367_10122591 | Ga0075367_101225912 | 310 |
| 393 | 3300009098 | Ga0105245_10149085 | Ga0105245_101490852 | 310 |
| 394 | 3300009147 | Ga0114129_10030937 | Ga0114129_100309373 | 310 |
| 395 | 3300009551 | Ga0105238_10331849 | Ga0105238_103318492 | 310 |
| 396 | 3300025273 | Ga0209673_1006691 | Ga0209673_10066914 | 310 |
| 397 | 3300025303 | Ga0209051_1000136 | Ga0209051_1000136112 | 310 |
| 398 | 3300025304 | Ga0209257_1000055 | Ga0209257_1000055295 | 310 |
| 399 | 3300025927 | Ga0207687_10120120 | Ga0207687_101201203 | 310 |
| 400 | 3300025942 | Ga0207689_10085747 | Ga0207689_100857472 | 310 |
| 401 | 3300026078 | Ga0207702_10052022 | Ga0207702_100520223 | 310 |
| 402 | 3300026116 | Ga0207674_10081993 | Ga0207674_100819932 | 310 |
| 403 | 3300028786 | Ga0307517_10000499 | Ga0307517_1000049951 | 310 |
| 404 | 3300028794 | Ga0307515_10000066 | Ga0307515_1000006612 | 310 |
| 405 | 3300028794 | Ga0307515_10004991 | Ga0307515_100049913 | 310 |
| 406 | 3300031456 | Ga0307513_10097091 | Ga0307513_100970913 | 310 |
| 407 | 3300031649 | Ga0307514_10000858 | Ga0307514_100008582 | 310 |
| 408 | 3300031649 | Ga0307514_10101368 | Ga0307514_101013682 | 310 |
| 409 | 3300032004 | Ga0307414_10365614 | Ga0307414_103656141 | 310 |
| 410 | 3300033180 | Ga0307510_10003542 | Ga0307510_100035423 | 310 |
| 411 | 3300037466 | Ga0395898_0322622 | Ga0395898_0322622_107_1075 | 310 |
| 412 | 3300037471 | Ga0395905_0189175 | Ga0395905_0189175_160_1128 | 310 |
| 413 | 3300038443 | Ga0395901_0162681 | Ga0395901_0162681_375_1343 | 310 |
| 414 | 3300044673 | Ga0453683_0058416 | Ga0453683_0058416_591_1559 | 310 |
| 415 | 3300044712 | Ga0453684_0377689 | Ga0453684_0377689_401_1369 | 310 |
| 416 | 3300045051 | Ga0451576_0022955 | Ga0451576_0022955_2637_3605 | 310 |
| 417 | 3300045051 | Ga0451576_0151313 | Ga0451576_0151313_898_1869 | 310 |
| 418 | 3300045051 | Ga0451576_0501894 | Ga0451576_0501894_158_1129 | 310 |
| 419 | 3300046512 | Ga0495610_0033947 | Ga0495610_0033947_169_1137 | 310 |
| 420 | 3300047472 | Ga0495686_0094368 | Ga0495686_0094368_228_1196 | 310 |
| 421 | 3300050493 | nmdc:mga0k408_65527_c1 | nmdc:mga0k408_65527_c1_189_1169 | 310 |
| 422 | 3300050507 | nmdc:mga05p37_44213_c1 | nmdc:mga05p37_44213_c1_3239_4210 | 310 |
| 423 | 3300053088 | Ga0500644_0001746 | Ga0500644_0001746_843_1811 | 310 |
| 424 | 3300053118 | Ga0500594_0001437 | Ga0500594_0001437_2378_3346 | 310 |
| 425 | 3300053136 | Ga0500559_0000602 | Ga0500559_0000602_5612_6580 | 310 |
| 426 | 3300053156 | Ga0500622_0017664 | Ga0500622_0017664_479_1447 | 310 |
| 427 | 3300053739 | Ga0500587_008828 | Ga0500587_008828_275_1243 | 310 |
| 428 | 3300005331 | Ga0070670_100139485 | Ga0070670_1001394852 | 311 |
| 429 | 3300005355 | Ga0070671_100014699 | Ga0070671_1000146994 | 311 |
| 430 | 3300005364 | Ga0070673_100016138 | Ga0070673_1000161383 | 311 |
| 431 | 3300005455 | Ga0070663_100027741 | Ga0070663_1000277414 | 311 |
| 432 | 3300005456 | Ga0070678_100047655 | Ga0070678_1000476553 | 311 |
| 433 | 3300005456 | Ga0070678_100140328 | Ga0070678_1001403282 | 311 |
| 434 | 3300005616 | Ga0068852_100056346 | Ga0068852_1000563462 | 311 |
| 435 | 3300006237 | Ga0097621_100131452 | Ga0097621_1001314522 | 311 |
| 436 | 3300009148 | Ga0105243_10073714 | Ga0105243_100737143 | 311 |
| 437 | 3300009177 | Ga0105248_10031634 | Ga0105248_100316344 | 311 |
| 438 | 3300009177 | Ga0105248_10125609 | Ga0105248_101256093 | 311 |
| 439 | 3300013297 | Ga0157378_10272705 | Ga0157378_102727052 | 311 |
| 440 | 3300014969 | Ga0157376_10470971 | Ga0157376_104709712 | 311 |
| 441 | 3300025925 | Ga0207650_10072294 | Ga0207650_100722942 | 311 |
| 442 | 3300025931 | Ga0207644_10000306 | Ga0207644_100003064 | 311 |
| 443 | 3300025931 | Ga0207644_10090539 | Ga0207644_100905392 | 311 |
| 444 | 3300025981 | Ga0207640_10113018 | Ga0207640_101130183 | 311 |
| 445 | 3300026067 | Ga0207678_10031930 | Ga0207678_100319303 | 311 |
| 446 | 3300026121 | Ga0207683_10051245 | Ga0207683_100512451 | 311 |
| 447 | 3300027876 | Ga0209974_10011524 | Ga0209974_100115243 | 311 |
| 448 | 3300028794 | Ga0307515_10000366 | Ga0307515_1000036640 | 311 |
| 449 | 3300028794 | Ga0307515_10001653 | Ga0307515_1000165315 | 311 |
| 450 | 3300028794 | Ga0307515_10037079 | Ga0307515_100370792 | 311 |
| 451 | 3300031507 | Ga0307509_10204162 | Ga0307509_102041622 | 311 |
| 452 | 3300031616 | Ga0307508_10000107 | Ga0307508_100001075 | 311 |
| 453 | 3300031649 | Ga0307514_10012482 | Ga0307514_100124822 | 311 |
| 454 | 3300031730 | Ga0307516_10014389 | Ga0307516_100143896 | 311 |
| 455 | 3300033179 | Ga0307507_10038131 | Ga0307507_100381313 | 311 |
| 456 | 3300037068 | Ga0373925_0289313 | Ga0373925_0289313_231_1223 | 311 |
| 457 | 3300041491 | Ga0451833_0104380 | Ga0451833_0104380_232_1200 | 311 |
| 458 | 3300046512 | Ga0495610_0055012 | Ga0495610_0055012_874_1842 | 311 |
| 459 | 3300046660 | Ga0495625_0002839 | Ga0495625_0002839_13979_14947 | 311 |
| 460 | 3300046683 | Ga0495658_0032504 | Ga0495658_0032504_419_1414 | 311 |
| 461 | 3300046691 | Ga0495670_0156607 | Ga0495670_0156607_114_1097 | 311 |
| 462 | 3300048907 | Ga0496104_0035846 | Ga0496104_0035846_1254_2291 | 311 |
| 463 | 3300048908 | Ga0496105_0089552 | Ga0496105_0089552_855_1892 | 311 |
| 464 | 3300048917 | Ga0496114_0157070 | Ga0496114_0157070_225_1262 | 311 |
| 465 | 3300050493 | nmdc:mga0k408_87409_c1 | nmdc:mga0k408_87409_c1_39_1007 | 311 |
| 466 | 3300050496 | nmdc:mga07m45_113000_c1 | nmdc:mga07m45_113000_c1_72_1043 | 311 |
| 467 | 3300050496 | nmdc:mga07m45_4349_c1 | nmdc:mga07m45_4349_c1_693_1688 | 311 |
| 468 | 3300050496 | nmdc:mga07m45_93090_c1 | nmdc:mga07m45_93090_c1_713_1681 | 311 |
| 469 | 3300053739 | Ga0500587_006521 | Ga0500587_006521_43_1011 | 311 |
| 470 | 3300002773 | JGI25152J39213_1001748 | JGI25152J39213_10017485 | 312 |
| 471 | 3300003215 | JGI25153J46596_10002270 | JGI25153J46596_100022709 | 312 |
| 472 | 3300003215 | JGI25153J46596_10006214 | JGI25153J46596_100062146 | 312 |
| 473 | 3300003771 | Ga0055526_1002150 | Ga0055526_100215010 | 312 |
| 474 | 3300003791 | Ga0055530_10018936 | Ga0055530_100189362 | 312 |
| 475 | 3300005327 | Ga0070658_10159367 | Ga0070658_101593672 | 312 |
| 476 | 3300005327 | Ga0070658_10278833 | Ga0070658_102788332 | 312 |
| 477 | 3300005328 | Ga0070676_10009731 | Ga0070676_100097314 | 312 |
| 478 | 3300005330 | Ga0070690_100141676 | Ga0070690_1001416762 | 312 |
| 479 | 3300005331 | Ga0070670_100001487 | Ga0070670_10000148718 | 312 |
| 480 | 3300005331 | Ga0070670_100055083 | Ga0070670_1000550833 | 312 |
| 481 | 3300005331 | Ga0070670_100125593 | Ga0070670_1001255932 | 312 |
| 482 | 3300005331 | Ga0070670_100127016 | Ga0070670_1001270163 | 312 |
| 483 | 3300005333 | Ga0070677_10022459 | Ga0070677_100224592 | 312 |
| 484 | 3300005334 | Ga0068869_100039693 | Ga0068869_1000396934 | 312 |
| 485 | 3300005335 | Ga0070666_10022199 | Ga0070666_100221993 | 312 |
| 486 | 3300005338 | Ga0068868_100053419 | Ga0068868_1000534193 | 312 |
| 487 | 3300005354 | Ga0070675_100010343 | Ga0070675_1000103436 | 312 |
| 488 | 3300005354 | Ga0070675_100145213 | Ga0070675_1001452133 | 312 |
| 489 | 3300005364 | Ga0070673_100003065 | Ga0070673_1000030658 | 312 |
| 490 | 3300005364 | Ga0070673_100062900 | Ga0070673_1000629002 | 312 |
| 491 | 3300005364 | Ga0070673_100267796 | Ga0070673_1002677961 | 312 |
| 492 | 3300005366 | Ga0070659_100171312 | Ga0070659_1001713122 | 312 |
| 493 | 3300005456 | Ga0070678_100009028 | Ga0070678_1000090285 | 312 |
| 494 | 3300005456 | Ga0070678_100079341 | Ga0070678_1000793412 | 312 |
| 495 | 3300005457 | Ga0070662_100008876 | Ga0070662_1000088764 | 312 |
| 496 | 3300005459 | Ga0068867_100037382 | Ga0068867_1000373825 | 312 |
| 497 | 3300005467 | Ga0070706_100007432 | Ga0070706_1000074325 | 312 |
| 498 | 3300005467 | Ga0070706_100579706 | Ga0070706_1005797061 | 312 |
| 499 | 3300005518 | Ga0070699_100149258 | Ga0070699_1001492583 | 312 |
| 500 | 3300005535 | Ga0070684_100130410 | Ga0070684_1001304103 | 312 |
| 501 | 3300005539 | Ga0068853_100278229 | Ga0068853_1002782292 | 312 |
| 502 | 3300005543 | Ga0070672_100011240 | Ga0070672_1000112404 | 312 |
| 503 | 3300005543 | Ga0070672_100018687 | Ga0070672_1000186873 | 312 |
| 504 | 3300005543 | Ga0070672_100027935 | Ga0070672_1000279353 | 312 |
| 505 | 3300005564 | Ga0070664_100112710 | Ga0070664_1001127102 | 312 |
| 506 | 3300005578 | Ga0068854_100031831 | Ga0068854_1000318312 | 312 |
| 507 | 3300005616 | Ga0068852_100464942 | Ga0068852_1004649421 | 312 |
| 508 | 3300005617 | Ga0068859_100023164 | Ga0068859_1000231644 | 312 |
| 509 | 3300005617 | Ga0068859_100522698 | Ga0068859_1005226981 | 312 |
| 510 | 3300005618 | Ga0068864_100009333 | Ga0068864_1000093334 | 312 |
| 511 | 3300005618 | Ga0068864_100150190 | Ga0068864_1001501903 | 312 |
| 512 | 3300005719 | Ga0068861_100182325 | Ga0068861_1001823252 | 312 |
| 513 | 3300005842 | Ga0068858_100002260 | Ga0068858_1000022604 | 312 |
| 514 | 3300006195 | Ga0075366_10007566 | Ga0075366_100075665 | 312 |
| 515 | 3300006195 | Ga0075366_10009253 | Ga0075366_100092534 | 312 |
| 516 | 3300006195 | Ga0075366_10041050 | Ga0075366_100410503 | 312 |
| 517 | 3300006353 | Ga0075370_10015546 | Ga0075370_100155463 | 312 |
| 518 | 3300006358 | Ga0068871_100050917 | Ga0068871_1000509174 | 312 |
| 519 | 3300006931 | Ga0097620_100023164 | Ga0097620_1000231644 | 312 |
| 520 | 3300006931 | Ga0097620_100522709 | Ga0097620_1005227091 | 312 |
| 521 | 3300009098 | Ga0105245_10096754 | Ga0105245_100967542 | 312 |
| 522 | 3300009177 | Ga0105248_10018996 | Ga0105248_100189963 | 312 |
| 523 | 3300009545 | Ga0105237_10257489 | Ga0105237_102574892 | 312 |
| 524 | 3300009553 | Ga0105249_10039217 | Ga0105249_100392173 | 312 |
| 525 | 3300011119 | Ga0105246_10085345 | Ga0105246_100853453 | 312 |
| 526 | 3300013102 | Ga0157371_10091085 | Ga0157371_100910853 | 312 |
| 527 | 3300013308 | Ga0157375_10124563 | Ga0157375_101245632 | 312 |
| 528 | 3300013308 | Ga0157375_10137673 | Ga0157375_101376733 | 312 |
| 529 | 3300013308 | Ga0157375_10154740 | Ga0157375_101547404 | 312 |
| 530 | 3300014325 | Ga0163163_10003856 | Ga0163163_100038565 | 312 |
| 531 | 3300014969 | Ga0157376_10018710 | Ga0157376_100187104 | 312 |
| 532 | 3300025245 | Ga0207425_1000565 | Ga0207425_100056513 | 312 |
| 533 | 3300025258 | Ga0209129_1000075 | Ga0209129_1000075135 | 312 |
| 534 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046299 | 312 |
| 535 | 3300025297 | Ga0209758_1000045 | Ga0209758_1000045300 | 312 |
| 536 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052164 | 312 |
| 537 | 3300025298 | Ga0209050_1000257 | Ga0209050_100025761 | 312 |
| 538 | 3300025304 | Ga0209257_1034024 | Ga0209257_10340242 | 312 |
| 539 | 3300025321 | Ga0207656_10013182 | Ga0207656_100131821 | 312 |
| 540 | 3300025893 | Ga0207682_10030129 | Ga0207682_100301291 | 312 |
| 541 | 3300025893 | Ga0207682_10042678 | Ga0207682_100426782 | 312 |
| 542 | 3300025907 | Ga0207645_10001304 | Ga0207645_1000130411 | 312 |
| 543 | 3300025907 | Ga0207645_10017830 | Ga0207645_100178304 | 312 |
| 544 | 3300025909 | Ga0207705_10106755 | Ga0207705_101067552 | 312 |
| 545 | 3300025910 | Ga0207684_10009803 | Ga0207684_100098033 | 312 |
| 546 | 3300025925 | Ga0207650_10101014 | Ga0207650_101010142 | 312 |
| 547 | 3300025925 | Ga0207650_10115048 | Ga0207650_101150483 | 312 |
| 548 | 3300025925 | Ga0207650_10157624 | Ga0207650_101576243 | 312 |
| 549 | 3300025926 | Ga0207659_10010811 | Ga0207659_100108114 | 312 |
| 550 | 3300025926 | Ga0207659_10011107 | Ga0207659_100111071 | 312 |
| 551 | 3300025926 | Ga0207659_10030025 | Ga0207659_100300253 | 312 |
| 552 | 3300025926 | Ga0207659_10040044 | Ga0207659_100400444 | 312 |
| 553 | 3300025927 | Ga0207687_10193728 | Ga0207687_101937282 | 312 |
| 554 | 3300025931 | Ga0207644_10020223 | Ga0207644_100202234 | 312 |
| 555 | 3300025932 | Ga0207690_10153767 | Ga0207690_101537672 | 312 |
| 556 | 3300025933 | Ga0207706_10016770 | Ga0207706_100167704 | 312 |
| 557 | 3300025933 | Ga0207706_10035763 | Ga0207706_100357632 | 312 |
| 558 | 3300025936 | Ga0207670_10042168 | Ga0207670_100421683 | 312 |
| 559 | 3300025938 | Ga0207704_10227465 | Ga0207704_102274651 | 312 |
| 560 | 3300025940 | Ga0207691_10009574 | Ga0207691_100095744 | 312 |
| 561 | 3300025940 | Ga0207691_10033726 | Ga0207691_100337263 | 312 |
| 562 | 3300025941 | Ga0207711_10005620 | Ga0207711_100056204 | 312 |
| 563 | 3300025941 | Ga0207711_10013090 | Ga0207711_100130904 | 312 |
| 564 | 3300025942 | Ga0207689_10052134 | Ga0207689_100521342 | 312 |
| 565 | 3300025942 | Ga0207689_10054545 | Ga0207689_100545452 | 312 |
| 566 | 3300025972 | Ga0207668_10014376 | Ga0207668_100143764 | 312 |
| 567 | 3300025981 | Ga0207640_10020071 | Ga0207640_100200713 | 312 |
| 568 | 3300026023 | Ga0207677_10002328 | Ga0207677_100023287 | 312 |
| 569 | 3300026023 | Ga0207677_10015488 | Ga0207677_100154885 | 312 |
| 570 | 3300026023 | Ga0207677_10069101 | Ga0207677_100691013 | 312 |
| 571 | 3300026035 | Ga0207703_10010895 | Ga0207703_100108954 | 312 |
| 572 | 3300026041 | Ga0207639_10148442 | Ga0207639_101484422 | 312 |
| 573 | 3300026088 | Ga0207641_10015994 | Ga0207641_100159944 | 312 |
| 574 | 3300026088 | Ga0207641_10042940 | Ga0207641_100429402 | 312 |
| 575 | 3300026089 | Ga0207648_10002312 | Ga0207648_1000231211 | 312 |
| 576 | 3300026089 | Ga0207648_10073241 | Ga0207648_100732413 | 312 |
| 577 | 3300026095 | Ga0207676_10020243 | Ga0207676_100202434 | 312 |
| 578 | 3300026095 | Ga0207676_10027374 | Ga0207676_100273741 | 312 |
| 579 | 3300026118 | Ga0207675_100121237 | Ga0207675_1001212371 | 312 |
| 580 | 3300026118 | Ga0207675_100237285 | Ga0207675_1002372852 | 312 |
| 581 | 3300026121 | Ga0207683_10026644 | Ga0207683_100266444 | 312 |
| 582 | 3300026121 | Ga0207683_10071175 | Ga0207683_100711753 | 312 |
| 583 | 3300026142 | Ga0207698_10424174 | Ga0207698_104241742 | 312 |
| 584 | 3300028794 | Ga0307515_10035753 | Ga0307515_100357536 | 312 |
| 585 | 3300028794 | Ga0307515_10040755 | Ga0307515_100407554 | 312 |
| 586 | 3300028794 | Ga0307515_10074011 | Ga0307515_100740114 | 312 |
| 587 | 3300030522 | Ga0307512_10047332 | Ga0307512_100473324 | 312 |
| 588 | 3300031456 | Ga0307513_10036111 | Ga0307513_100361113 | 312 |
| 589 | 3300031507 | Ga0307509_10040010 | Ga0307509_100400102 | 312 |
| 590 | 3300031507 | Ga0307509_10048217 | Ga0307509_100482173 | 312 |
| 591 | 3300031616 | Ga0307508_10001847 | Ga0307508_1000184714 | 312 |
| 592 | 3300031616 | Ga0307508_10006981 | Ga0307508_1000698111 | 312 |
| 593 | 3300031730 | Ga0307516_10019586 | Ga0307516_100195866 | 312 |
| 594 | 3300031731 | Ga0307405_10014627 | Ga0307405_100146273 | 312 |
| 595 | 3300031824 | Ga0307413_10028093 | Ga0307413_100280932 | 312 |
| 596 | 3300031838 | Ga0307518_10152051 | Ga0307518_101520511 | 312 |
| 597 | 3300031852 | Ga0307410_10040149 | Ga0307410_100401492 | 312 |
| 598 | 3300031901 | Ga0307406_10017377 | Ga0307406_100173774 | 312 |
| 599 | 3300031911 | Ga0307412_10036449 | Ga0307412_100364493 | 312 |
| 600 | 3300031995 | Ga0307409_100039276 | Ga0307409_1000392763 | 312 |
| 601 | 3300032002 | Ga0307416_100021496 | Ga0307416_1000214962 | 312 |
| 602 | 3300032004 | Ga0307414_10047523 | Ga0307414_100475232 | 312 |
| 603 | 3300032005 | Ga0307411_10045891 | Ga0307411_100458913 | 312 |
| 604 | 3300032005 | Ga0307411_10143744 | Ga0307411_101437442 | 312 |
| 605 | 3300033180 | Ga0307510_10079638 | Ga0307510_100796384 | 312 |
| 606 | 3300033180 | Ga0307510_10249954 | Ga0307510_102499541 | 312 |
| 607 | 3300035170 | Ga0373943_0068861 | Ga0373943_0068861_673_1647 | 312 |
| 608 | 3300035692 | Ga0373935_0203829 | Ga0373935_0203829_332_1324 | 312 |
| 609 | 3300036401 | Ga0373937_0012463 | Ga0373937_0012463_5352_6344 | 312 |
| 610 | 3300036401 | Ga0373937_0056460 | Ga0373937_0056460_1620_2615 | 312 |
| 611 | 3300037068 | Ga0373925_0260885 | Ga0373925_0260885_351_1325 | 312 |
| 612 | 3300041452 | Ga0451793_0508741 | Ga0451793_0508741_409_1383 | 312 |
| 613 | 3300041456 | Ga0451795_0519482 | Ga0451795_0519482_409_1383 | 312 |
| 614 | 3300041459 | Ga0451800_0879857 | Ga0451800_0879857_330_1304 | 312 |
| 615 | 3300041463 | Ga0451804_1035411 | Ga0451804_1035411_349_1323 | 312 |
| 616 | 3300044658 | Ga0466972_0000285 | Ga0466972_0000285_16156_17190 | 312 |
| 617 | 3300046454 | Ga0495592_0000237 | Ga0495592_0000237_4051_5040 | 312 |
| 618 | 3300046477 | Ga0495664_0117245 | Ga0495664_0117245_59_1054 | 312 |
| 619 | 3300046515 | Ga0495620_0072242 | Ga0495620_0072242_52_1038 | 312 |
| 620 | 3300046516 | Ga0495628_0142321 | Ga0495628_0142321_539_1531 | 312 |
| 621 | 3300046517 | Ga0495630_0360372 | Ga0495630_0360372_111_1103 | 312 |
| 622 | 3300046519 | Ga0495632_0004239 | Ga0495632_0004239_7807_8781 | 312 |
| 623 | 3300046524 | Ga0495648_0098074 | Ga0495648_0098074_533_1519 | 312 |
| 624 | 3300046537 | Ga0495598_0022132 | Ga0495598_0022132_11_1006 | 312 |
| 625 | 3300046542 | Ga0495597_0007887 | Ga0495597_0007887_2537_3520 | 312 |
| 626 | 3300046543 | Ga0495645_0040954 | Ga0495645_0040954_671_1663 | 312 |
| 627 | 3300046543 | Ga0495645_0179794 | Ga0495645_0179794_49_1044 | 312 |
| 628 | 3300046663 | Ga0495635_0110054 | Ga0495635_0110054_44_1039 | 312 |
| 629 | 3300046683 | Ga0495658_0031936 | Ga0495658_0031936_1391_2386 | 312 |
| 630 | 3300046683 | Ga0495658_0034335 | Ga0495658_0034335_1462_2454 | 312 |
| 631 | 3300047443 | Ga0495687_002606 | Ga0495687_002606_7845_8828 | 312 |
| 632 | 3300047471 | Ga0495684_0084397 | Ga0495684_0084397_699_1736 | 312 |
| 633 | 3300048912 | Ga0496109_0126638 | Ga0496109_0126638_532_1527 | 312 |
| 634 | 3300050493 | nmdc:mga0k408_1828_c1 | nmdc:mga0k408_1828_c1_796_1845 | 312 |
| 635 | 3300053086 | Ga0500578_0000437 | Ga0500578_0000437_36189_37163 | 312 |
| 636 | 3300053093 | Ga0500651_0097581 | Ga0500651_0097581_399_1388 | 312 |
| 637 | 3300053129 | Ga0500628_004814 | Ga0500628_004814_861_1835 | 312 |
| 638 | 3300053130 | Ga0500642_0004133 | Ga0500642_0004133_3029_4003 | 312 |
| 639 | 3300053131 | Ga0500652_000312 | Ga0500652_000312_14752_15726 | 312 |
| 640 | 3300053139 | Ga0500568_0018889 | Ga0500568_0018889_1320_2294 | 312 |
| 641 | 3300053156 | Ga0500622_0000164 | Ga0500622_0000164_36169_37143 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pfz-assembly1.cif.gz_A | crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9951 | 13 | 311 |
| 2pfy-assembly4.cif.gz_D | crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9913 | 13 | 312 |
| 2pfz-assembly1.cif.gz_A | crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9853 | 13 | 311 |
| 2pfy-assembly4.cif.gz_D | crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9847 | 13 | 312 |
| 6wgm-assembly1.cif.gz_A | crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate | 0.9832 | 12 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pfzA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9951 | 13 | 311 | 3.40.190.170 |
| 2pfyD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9893 | 13 | 312 | 3.40.190.170 |
| 2pfzA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9853 | 13 | 311 | 3.40.190.170 |
| 2pfyD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9827 | 13 | 312 | 3.40.190.170 |
| 4nhbB00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9357 | 13 | 312 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328W474-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9917 | 18 | 311 |
GO:0055085
|
| AF-A0A350AIN9-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9894 | 1 | 312 |
GO:0042597
GO:0055085 |
| AF-A0A3D0JK86-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9881 | 91 | 311 |
GO:0055085
|
| AF-A0A350AIN9-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9863 | 1 | 312 |
GO:0042597
GO:0055085 |
| AF-A0A5S3VPV7-F1-model_v4 | deleted | 0.9812 | 8 | 311 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar