F471769

General Info

Members Datasets Scaffolds Average Seq Length
641 383 620 166

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10031945|Ga0075368_100319454
Length 198
Sequence MSPQAVGAPGAWPSYGPCGGSGRALDPRSMPRTALFPGSFDPVTNGHLDLVRQAGRLADRLVLAIGTHPGKTPLFSVEERRDMIEETCSPVMRASGIDFACITFSDLVVAAAQREGATLLIRGLRSATDFDYEMEMAGMNGAMAPAVQTVFLPASPIIRPITATLVRQIASMGGDVSQFVPSSVAARLKAKFAGKAGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
18 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
19 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
20 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
21 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
22 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
23 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
249 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
368 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 9.83
Rhizosphere 81.9
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2896220 2162886007 Bacteria 1878
2 SwRhRL2b_contig_475676 2162886007 Bacteria 8397
3 JGI24746J21847_1032408 3300001977 Bacteria 721
4 JGI24737J22298_10108803 3300001990 Bacteria 821
5 JGI24743J22301_10071135 3300001991 Bacteria 726
6 JGI24748J21848_1014993 3300002074 Bacteria 921
7 JGI24738J21930_10015935 3300002075 Bacteria 1594
8 JGI24744J21845_10058966 3300002077 Bacteria 703
9 JGI25152J39213_1000476 3300002773 Bacteria 23167
10 JGI25150J39212_1000002 3300002774 Bacteria 537631
11 JGI25151J46595_10000003 3300003187 Bacteria 715330
12 JGI25153J46596_10000003 3300003215 Bacteria 553253
13 rootH1_10239678 3300003323 Bacteria 1852
14 Ga0055536_1000049 3300003781 Bacteria 113328
15 Ga0055530_10002714 3300003791 Bacteria 10996
16 Ga0065714_10002298 3300005288 Bacteria 48008
17 Ga0065714_10002621 3300005288 Bacteria 31326
18 Ga0065714_10014983 3300005288 Bacteria 2330
19 Ga0065714_10065634 3300005288 Bacteria 9088
20 Ga0065714_10071503 3300005288 Bacteria 3561
21 Ga0065714_10084878 3300005288 Bacteria 2175
22 Ga0065714_10300924 3300005288 Bacteria 690
23 Ga0065704_10000205 3300005289 Bacteria 128899
24 Ga0065704_10001103 3300005289 Bacteria 14777
25 Ga0065704_10350957 3300005289 Bacteria 810
26 Ga0070676_10021108 3300005328 Bacteria 3644
27 Ga0070683_100174484 3300005329 Bacteria 2041
28 Ga0070683_101252790 3300005329 Bacteria 713
29 Ga0070690_100465800 3300005330 Bacteria 940
30 Ga0070680_100160460 3300005336 Bacteria 1889
31 Ga0070680_100511318 3300005336 Bacteria 1028
32 Ga0070682_101047603 3300005337 Bacteria 680
33 Ga0070660_100130664 3300005339 Bacteria 2009
34 Ga0070689_100170832 3300005340 Bacteria 1761
35 Ga0070687_100137403 3300005343 Bacteria 1419
36 Ga0070661_100361993 3300005344 Bacteria 1140
37 Ga0070692_10031592 3300005345 Bacteria 2655
38 Ga0070675_100144519 3300005354 Bacteria 2035
39 Ga0070671_101154736 3300005355 Bacteria 681
40 Ga0070674_100742796 3300005356 Bacteria 842
41 Ga0070673_100174646 3300005364 Bacteria 1836
42 Ga0070688_100098941 3300005365 Bacteria 1920
43 Ga0070659_100171213 3300005366 Bacteria 1779
44 Ga0070659_100250940 3300005366 Bacteria 1466
45 Ga0070709_10010442 3300005434 Bacteria 5146
46 Ga0070709_11195096 3300005434 Bacteria 611
47 Ga0070714_100014088 3300005435 Bacteria 6417
48 Ga0070714_100169370 3300005435 Bacteria 1981
49 Ga0070713_100019862 3300005436 Bacteria 5143
50 Ga0070713_100146522 3300005436 Bacteria 2096
51 Ga0070713_101484081 3300005436 Bacteria 658
52 Ga0070710_10004638 3300005437 Bacteria 6500
53 Ga0070711_100103337 3300005439 Bacteria 2076
54 Ga0070711_100252837 3300005439 Bacteria 1383
55 Ga0070705_101002554 3300005440 Bacteria 678
56 Ga0070700_100063622 3300005441 Bacteria 2334
57 Ga0070708_100472124 3300005445 Bacteria 1183
58 Ga0070662_100573661 3300005457 Bacteria 947
59 Ga0068867_100373779 3300005459 Bacteria 1195
60 Ga0070707_100504733 3300005468 Bacteria 1171
61 Ga0070707_100532588 3300005468 Bacteria 1137
62 Ga0070707_101619042 3300005468 Bacteria 614
63 Ga0070707_101715756 3300005468 Bacteria 595
64 Ga0070698_100901080 3300005471 Bacteria 830
65 Ga0070698_101609910 3300005471 Bacteria 601
66 Ga0070699_100006185 3300005518 Bacteria 10461
67 Ga0070699_100245715 3300005518 Bacteria 1598
68 Ga0070699_100269752 3300005518 Bacteria 1523
69 Ga0070679_100297936 3300005530 Bacteria 1563
70 Ga0070684_100079215 3300005535 Bacteria 2904
71 Ga0070697_101130273 3300005536 Bacteria 697
72 Ga0068853_100902600 3300005539 Bacteria 849
73 Ga0070672_100086675 3300005543 Bacteria 2519
74 Ga0070695_100431358 3300005545 Bacteria 1006
75 Ga0070696_100552426 3300005546 Bacteria 923
76 Ga0070704_100911846 3300005549 Bacteria 791
77 Ga0068855_101035675 3300005563 Bacteria 861
78 Ga0068855_101290013 3300005563 Bacteria 756
79 Ga0070664_100162359 3300005564 Bacteria 1977
80 Ga0068857_100213576 3300005577 Bacteria 1761
81 Ga0068854_100160911 3300005578 Bacteria 1738
82 Ga0068856_100364760 3300005614 Bacteria 1463
83 Ga0070702_100134722 3300005615 Bacteria 1565
84 Ga0070702_100842093 3300005615 Bacteria 713
85 Ga0068852_100209977 3300005616 Bacteria 1846
86 Ga0068864_100061026 3300005618 Bacteria 3265
87 Ga0068864_100379031 3300005618 Bacteria 1340
88 Ga0068866_10194047 3300005718 Bacteria 1208
89 Ga0068861_100225431 3300005719 Bacteria 1586
90 Ga0068851_10086495 3300005834 Bacteria 1645
91 Ga0068870_10013225 3300005840 Bacteria 3874
92 Ga0068863_100189614 3300005841 Bacteria 1975
93 Ga0068860_100178848 3300005843 Bacteria 2050
94 Ga0068862_100007625 3300005844 Bacteria 8962
95 Ga0068862_100421900 3300005844 Bacteria 1252
96 Ga0081455_10001555 3300005937 Bacteria 28179
97 Ga0081455_10012680 3300005937 Bacteria 8389
98 Ga0081455_10025015 3300005937 Bacteria 5517
99 Ga0081455_10060912 3300005937 Bacteria 3179
100 Ga0081455_10061060 3300005937 Bacteria 3174
101 Ga0081455_10095813 3300005937 Bacteria 2395
102 Ga0081455_10202434 3300005937 Bacteria 1486
103 Ga0081538_10107822 3300005981 Bacteria 1378
104 Ga0081540_1016285 3300005983 Bacteria 4659
105 Ga0070717_10029383 3300006028 Bacteria 4409
106 Ga0070717_10269715 3300006028 Bacteria 1507
107 Ga0070717_10517777 3300006028 Bacteria 1079
108 Ga0070717_11137417 3300006028 Bacteria 711
109 Ga0075365_10033139 3300006038 Bacteria 3326
110 Ga0075365_10137905 3300006038 Bacteria 1692
111 Ga0075365_10304602 3300006038 Bacteria 1122
112 Ga0075368_10031945 3300006042 Bacteria 2043
113 Ga0075363_100637202 3300006048 Bacteria 641
114 Ga0075432_10209363 3300006058 Bacteria 775
115 Ga0070715_10298585 3300006163 Bacteria 861
116 Ga0070716_100016175 3300006173 Bacteria 3845
117 Ga0070712_100013815 3300006175 Bacteria 5167
118 Ga0070712_100326830 3300006175 Bacteria 1248
119 Ga0070712_100452068 3300006175 Bacteria 1070
120 Ga0075362_10302297 3300006177 Bacteria 794
121 Ga0075367_10035549 3300006178 Bacteria 2884
122 Ga0075428_100017448 3300006844 Bacteria 7933
123 Ga0075428_100143569 3300006844 Bacteria 2595
124 Ga0075428_100196014 3300006844 Bacteria 2184
125 Ga0075428_100401471 3300006844 Bacteria 1469
126 Ga0075428_101042930 3300006844 Bacteria 865
127 Ga0075428_101063293 3300006844 Bacteria 855
128 Ga0075430_100000184 3300006846 Bacteria 41914
129 Ga0075430_100923747 3300006846 Bacteria 719
130 Ga0075431_100103927 3300006847 Bacteria 2932
131 Ga0075431_100187319 3300006847 Bacteria 2122
132 Ga0075431_101210136 3300006847 Bacteria 718
133 Ga0075433_10050636 3300006852 Bacteria 3616
134 Ga0075433_10055747 3300006852 Bacteria 3451
135 Ga0075434_100020000 3300006871 Bacteria 6484
136 Ga0075434_100132361 3300006871 Bacteria 2513
137 Ga0075434_100176021 3300006871 Bacteria 2159
138 Ga0075429_100034844 3300006880 Bacteria 4375
139 Ga0075429_100993055 3300006880 Bacteria 734
140 Ga0075435_100083356 3300007076 Bacteria 2629
141 Ga0099794_10013261 3300007265 Bacteria 3583
142 Ga0099795_10086914 3300007788 Bacteria 1206
143 Ga0105251_10204700 3300009011 Bacteria 889
144 Ga0105244_10051568 3300009036 Bacteria 2096
145 Ga0111539_10078004 3300009094 Bacteria 3898
146 Ga0105245_10338237 3300009098 Bacteria 1488
147 Ga0105247_10025486 3300009101 Bacteria 3568
148 Ga0105247_10145370 3300009101 Bacteria 1558
149 Ga0105247_10512028 3300009101 Bacteria 876
150 Ga0114129_10004024 3300009147 Bacteria 20739
151 Ga0114129_10023533 3300009147 Bacteria 8731
152 Ga0114129_10041836 3300009147 Bacteria 6452
153 Ga0114129_10072366 3300009147 Bacteria 4806
154 Ga0114129_10161736 3300009147 Bacteria 3058
155 Ga0114129_10362630 3300009147 Bacteria 1917
156 Ga0114129_10377185 3300009147 Bacteria 1874
157 Ga0114129_10653912 3300009147 Bacteria 1356
158 Ga0114129_10658940 3300009147 Bacteria 1350
159 Ga0114129_11039890 3300009147 Bacteria 1029
160 Ga0105243_10472442 3300009148 Bacteria 1182
161 Ga0105242_10461666 3300009176 Bacteria 1199
162 Ga0105248_10065217 3300009177 Bacteria 4089
163 Ga0105237_10004270 3300009545 Bacteria 16609
164 Ga0105237_10163664 3300009545 Bacteria 2223
165 Ga0105249_10108519 3300009553 Bacteria 2620
166 Ga0099796_10001225 3300010159 Bacteria 5014
167 Ga0099796_10123492 3300010159 Bacteria 997
168 Ga0105239_11778771 3300010375 Bacteria 714
169 Ga0105246_10402342 3300011119 Bacteria 1137
170 Ga0157373_10000974 3300013100 Bacteria 22189
171 Ga0157373_10006199 3300013100 Bacteria 8934
172 Ga0157373_10087836 3300013100 Bacteria 2190
173 Ga0157371_10000119 3300013102 Bacteria 120350
174 Ga0157371_10010487 3300013102 Bacteria 7211
175 Ga0157370_10004633 3300013104 Bacteria 15727
176 Ga0157370_10014232 3300013104 Bacteria 8150
177 Ga0157370_10051173 3300013104 Bacteria 3946
178 Ga0157370_10056450 3300013104 Bacteria 3738
179 Ga0157370_10086094 3300013104 Bacteria 2952
180 Ga0157370_10091869 3300013104 Bacteria 2849
181 Ga0157370_10164106 3300013104 Bacteria 2067
182 Ga0157370_10260512 3300013104 Bacteria 1603
183 Ga0157370_10802574 3300013104 Bacteria 856
184 Ga0157369_10000015 3300013105 Bacteria 262917
185 Ga0157374_10012482 3300013296 Bacteria 7394
186 Ga0157378_10642804 3300013297 Bacteria 1076
187 Ga0163162_10000520 3300013306 Bacteria 35697
188 Ga0163162_10172620 3300013306 Bacteria 2287
189 Ga0163162_10299233 3300013306 Bacteria 1741
190 Ga0157372_10074067 3300013307 Bacteria 3839
191 Ga0157372_10443615 3300013307 Bacteria 1513
192 Ga0157375_10436731 3300013308 Bacteria 1475
193 Ga0163163_10015050 3300014325 Bacteria 7135
194 Ga0163163_11938078 3300014325 Bacteria 649
195 Ga0157380_10130964 3300014326 Bacteria 2140
196 Ga0182008_10000069 3300014497 Bacteria 82281
197 Ga0182008_10000247 3300014497 Bacteria 41952
198 Ga0182008_10001023 3300014497 Bacteria 19412
199 Ga0182008_10011758 3300014497 Bacteria 4645
200 Ga0182008_10017588 3300014497 Bacteria 3708
201 Ga0182008_10043944 3300014497 Bacteria 2223
202 Ga0182008_10121860 3300014497 Unclassified 1296
203 Ga0182008_10332552 3300014497 Bacteria 802
204 Ga0157377_10102849 3300014745 Bacteria 1705
205 Ga0157379_10574214 3300014968 Bacteria 1051
206 Ga0157376_10528137 3300014969 Bacteria 1164
207 Ga0157376_10917396 3300014969 Bacteria 895
208 Ga0157376_11165800 3300014969 Bacteria 798
209 Ga0182006_1000091 3300015261 Bacteria 109227
210 Ga0182006_1000210 3300015261 Bacteria 57485
211 Ga0182006_1000352 3300015261 Bacteria 38650
212 Ga0182006_1009379 3300015261 Bacteria 4387
213 Ga0182007_10000010 3300015262 Bacteria 286070
214 Ga0182007_10013273 3300015262 Bacteria 3147
215 Ga0182007_10045068 3300015262 Bacteria 1462
216 Ga0183373_1005 3300015682 Bacteria 351562
217 Ga0163161_10000046 3300017792 Bacteria 127211
218 Ga0163161_10001264 3300017792 Bacteria 18909
219 Ga0163161_10003880 3300017792 Bacteria 10485
220 Ga0163161_10019645 3300017792 Bacteria 4739
221 Ga0163161_11411151 3300017792 Bacteria 608
222 Ga0213872_10302829 3300021361 Bacteria 663
223 Ga0213871_10125562 3300021441 Bacteria 767
224 Ga0207425_1000004 3300025245 Bacteria 1092421
225 Ga0209129_1000005 3300025258 Bacteria 777812
226 Ga0209676_1000001 3300025292 Bacteria 1852142
227 Ga0209025_1000009 3300025294 Bacteria 1092561
228 Ga0209758_1000010 3300025297 Bacteria 1092782
229 Ga0209050_1000258 3300025298 Bacteria 113741
230 Ga0207692_10074367 3300025898 Bacteria 1800
231 Ga0207710_10072226 3300025900 Bacteria 1584
232 Ga0207710_10156515 3300025900 Bacteria 1108
233 Ga0207688_10001906 3300025901 Bacteria 11175
234 Ga0207680_10347213 3300025903 Bacteria 1042
235 Ga0207647_10199996 3300025904 Bacteria 1156
236 Ga0207685_10227796 3300025905 Bacteria 890
237 Ga0207685_10237167 3300025905 Bacteria 876
238 Ga0207699_10003624 3300025906 Bacteria 7382
239 Ga0207699_10299183 3300025906 Bacteria 1123
240 Ga0207645_10029712 3300025907 Bacteria 3522
241 Ga0207643_10002034 3300025908 Bacteria 11165
242 Ga0207705_10110720 3300025909 Bacteria 2028
243 Ga0207705_10297948 3300025909 Bacteria 1236
244 Ga0207684_10108001 3300025910 Bacteria 2381
245 Ga0207684_11192284 3300025910 Bacteria 631
246 Ga0207707_10087991 3300025912 Bacteria 2713
247 Ga0207707_11205253 3300025912 Bacteria 612
248 Ga0207671_10145482 3300025914 Bacteria 1828
249 Ga0207693_10013984 3300025915 Bacteria 6463
250 Ga0207693_10021233 3300025915 Bacteria 5161
251 Ga0207693_10066064 3300025915 Bacteria 2832
252 Ga0207663_10047518 3300025916 Bacteria 2650
253 Ga0207663_10072514 3300025916 Bacteria 2226
254 Ga0207663_10140946 3300025916 Bacteria 1679
255 Ga0207660_10399160 3300025917 Bacteria 1107
256 Ga0207662_10061769 3300025918 Bacteria 2250
257 Ga0207657_10092785 3300025919 Bacteria 2516
258 Ga0207649_10110308 3300025920 Bacteria 1837
259 Ga0207649_10444832 3300025920 Bacteria 977
260 Ga0207649_10521698 3300025920 Bacteria 906
261 Ga0207652_10633181 3300025921 Bacteria 957
262 Ga0207646_10449344 3300025922 Bacteria 1163
263 Ga0207659_10116163 3300025926 Bacteria 2042
264 Ga0207700_10045730 3300025928 Bacteria 3232
265 Ga0207700_10301304 3300025928 Bacteria 1384
266 Ga0207664_10201131 3300025929 Bacteria 1719
267 Ga0207664_11629177 3300025929 Bacteria 567
268 Ga0207644_10710694 3300025931 Bacteria 838
269 Ga0207644_11219885 3300025931 Bacteria 632
270 Ga0207706_10001779 3300025933 Bacteria 21159
271 Ga0207706_10585015 3300025933 Bacteria 960
272 Ga0207709_11214219 3300025935 Bacteria 622
273 Ga0207670_10188449 3300025936 Bacteria 1559
274 Ga0207704_10052470 3300025938 Bacteria 2472
275 Ga0207665_10003101 3300025939 Bacteria 11152
276 Ga0207665_10032249 3300025939 Bacteria 3469
277 Ga0207691_10014229 3300025940 Bacteria 7589
278 Ga0207689_10024325 3300025942 Bacteria 5083
279 Ga0207689_10571077 3300025942 Bacteria 950
280 Ga0207661_10745007 3300025944 Bacteria 902
281 Ga0207667_10290196 3300025949 Bacteria 1671
282 Ga0207667_10848154 3300025949 Bacteria 908
283 Ga0207651_10089023 3300025960 Bacteria 2252
284 Ga0207712_10028233 3300025961 Bacteria 3751
285 Ga0207668_10334791 3300025972 Bacteria 1260
286 Ga0207668_10519713 3300025972 Bacteria 1027
287 Ga0207640_10115254 3300025981 Bacteria 1913
288 Ga0207658_10534794 3300025986 Bacteria 1047
289 Ga0207677_10159831 3300026023 Bacteria 1749
290 Ga0207677_10682519 3300026023 Bacteria 910
291 Ga0207703_10092926 3300026035 Bacteria 2540
292 Ga0207639_11055527 3300026041 Bacteria 761
293 Ga0207678_10004671 3300026067 Bacteria 12299
294 Ga0207678_10207359 3300026067 Bacteria 1677
295 Ga0207708_10001428 3300026075 Bacteria 17910
296 Ga0207702_11196580 3300026078 Bacteria 754
297 Ga0207641_10161728 3300026088 Bacteria 2036
298 Ga0207648_10023316 3300026089 Bacteria 5547
299 Ga0207676_10229124 3300026095 Unclassified 1660
300 Ga0207676_10556798 3300026095 Bacteria 1096
301 Ga0207674_10118625 3300026116 Bacteria 2616
302 Ga0207675_100001777 3300026118 Bacteria 21552
303 Ga0207683_10016920 3300026121 Bacteria 6206
304 Ga0207428_10688353 3300027907 Bacteria 732
305 Ga0268266_10174676 3300028379 Bacteria 1952
306 Ga0268265_10404171 3300028380 Bacteria 1263
307 Ga0268265_10980893 3300028380 Bacteria 834
308 Ga0268264_11387256 3300028381 Bacteria 713
309 Ga0265328_10007157 3300031239 Bacteria 4670
310 Ga0316575_10328023 3300031665 Bacteria 650
311 Ga0265342_10016851 3300031712 Bacteria 4763
312 Ga0316576_10008140 3300031727 Bacteria 6658
313 Ga0316576_10416010 3300031727 Bacteria 995
314 Ga0307405_10000124 3300031731 Bacteria 30625
315 Ga0307407_10000024 3300031903 Bacteria 113716
316 Ga0307412_10000004 3300031911 Bacteria 544053
317 Ga0307416_100000037 3300032002 Bacteria 137513
318 Ga0307414_10000477 3300032004 Bacteria 20980
319 Ga0307414_10007084 3300032004 Bacteria 6289
320 Ga0307414_10023212 3300032004 Bacteria 3930
321 Ga0307414_10062991 3300032004 Bacteria 2634
322 Ga0307414_10663755 3300032004 Bacteria 941
323 Ga0307414_10709093 3300032004 Bacteria 911
324 Ga0307415_100420644 3300032126 Bacteria 1147
325 Ga0373926_0017741 3300035083 Bacteria 2445
326 Ga0373926_0195730 3300035083 Bacteria 777
327 Ga0373944_0263074 3300035089 Bacteria 639
328 Ga0373936_0008396 3300035113 Bacteria 3888
329 Ga0373939_0034395 3300035114 Bacteria 1487
330 Ga0373945_0013269 3300035116 Bacteria 2747
331 Ga0373954_0268092 3300035118 Bacteria 841
332 Ga0373954_0455726 3300035118 Bacteria 633
333 Ga0373943_0002541 3300035170 Bacteria 8295
334 Ga0373943_0244126 3300035170 Bacteria 1007
335 Ga0373946_0001624 3300035171 Bacteria 7833
336 Ga0373946_0276453 3300035171 Bacteria 825
337 Ga0373955_0015035 3300035172 Bacteria 3779
338 Ga0373955_0363482 3300035172 Bacteria 877
339 Ga0373961_0162029 3300035241 Bacteria 769
340 Ga0373962_0108799 3300035242 Bacteria 872
341 Ga0316574_0000617 3300035398 Bacteria 14851
342 Ga0316574_0002473 3300035398 Bacteria 9282
343 Ga0316574_0183952 3300035398 Bacteria 1344
344 Ga0316574_0704480 3300035398 Bacteria 619
345 Ga0373924_0067417 3300035410 Bacteria 1505
346 Ga0373924_0214357 3300035410 Bacteria 850
347 Ga0373935_0036974 3300035692 Bacteria 3054
348 Ga0373927_0036244 3300035695 Bacteria 3208
349 Ga0373927_0132986 3300035695 Bacteria 1625
350 Ga0373933_0170112 3300035724 Bacteria 1386
351 Ga0373947_0007075 3300035725 Bacteria 6502
352 Ga0373947_0057470 3300035725 Bacteria 2354
353 Ga0373937_0007210 3300036401 Bacteria 9620
354 Ga0316582_0051307 3300036647 Bacteria 2617
355 Ga0316584_0108949 3300036712 Bacteria 2073
356 Ga0316584_0187266 3300036712 Bacteria 1531
357 Ga0373925_0112019 3300037068 Bacteria 2109
358 Ga0373925_0212679 3300037068 Bacteria 1540
359 Ga0395899_0024753 3300037312 Bacteria 4537
360 Ga0395900_0020334 3300037418 Bacteria 6776
361 Ga0395900_0160661 3300037418 Bacteria 2292
362 Ga0395898_0074320 3300037466 Bacteria 3283
363 Ga0395898_0145263 3300037466 Bacteria 2270
364 Ga0395905_0100025 3300037471 Bacteria 2723
365 Ga0436364_1481812 3300037853 Bacteria 2075
366 Ga0395901_0015210 3300038443 Bacteria 7828
367 Ga0395901_0304646 3300038443 Bacteria 1651
368 Ga0436365_0282095 3300039437 Bacteria 578
369 Ga0436360_0765232 3300039438 Bacteria 2932
370 Ga0436361_0123121 3300039447 Bacteria 769
371 Ga0436361_0615857 3300039447 Bacteria 5651
372 Ga0451847_0973357 3300041503 Bacteria 1108
373 Ga0451849_1045727 3300041505 Bacteria 943
374 Ga0451853_2315819 3300041512 Bacteria 1136
375 Ga0439456_130778 3300042013 Bacteria 579
376 Ga0466966_0097617 3300044684 Bacteria 1819
377 Ga0453684_2036152 3300044712 Bacteria 577
378 Ga0451576_0011502 3300045051 Bacteria 10048
379 Ga0495627_129887 3300046453 Bacteria 709
380 Ga0495603_0042192 3300046455 Bacteria 2727
381 Ga0495603_0091294 3300046455 Bacteria 1780
382 Ga0495590_0085057 3300046457 Bacteria 1116
383 Ga0495590_0137170 3300046457 Bacteria 882
384 Ga0495638_0122956 3300046460 Bacteria 1532
385 Ga0495653_0206391 3300046463 Bacteria 1330
386 Ga0495653_0389697 3300046463 Bacteria 888
387 Ga0495580_0147595 3300046472 Bacteria 1630
388 Ga0495582_0014215 3300046473 Bacteria 4378
389 Ga0495582_0089285 3300046473 Bacteria 1717
390 Ga0495582_0246377 3300046473 Bacteria 1024
391 Ga0495639_0124220 3300046475 Bacteria 1232
392 Ga0495662_0046426 3300046476 Bacteria 2098
393 Ga0495584_0002062 3300046491 Bacteria 11532
394 Ga0495584_0015685 3300046491 Bacteria 3864
395 Ga0495584_0032865 3300046491 Bacteria 2625
396 Ga0495584_0285596 3300046491 Bacteria 838
397 Ga0495585_0233178 3300046492 Bacteria 924
398 Ga0495594_0076500 3300046499 Bacteria 1866
399 Ga0495607_0202009 3300046501 Bacteria 983
400 Ga0495607_0266714 3300046501 Bacteria 818
401 Ga0495608_0497921 3300046511 Bacteria 738
402 Ga0495610_0000045 3300046512 Bacteria 155304
403 Ga0495610_0000329 3300046512 Bacteria 50268
404 Ga0495618_0093956 3300046514 Bacteria 1918
405 Ga0495620_0050725 3300046515 Bacteria 1769
406 Ga0495628_0512412 3300046516 Bacteria 865
407 Ga0495630_0348054 3300046517 Bacteria 1134
408 Ga0495632_0163131 3300046519 Bacteria 1026
409 Ga0495637_0047045 3300046520 Bacteria 1823
410 Ga0495637_0095504 3300046520 Bacteria 1167
411 Ga0495643_0139047 3300046522 Bacteria 1213
412 Ga0495644_0031597 3300046523 Bacteria 2001
413 Ga0495663_0076147 3300046525 Bacteria 1075
414 Ga0495666_0033689 3300046526 Bacteria 2501
415 Ga0495666_0165317 3300046526 Bacteria 1025
416 Ga0495642_0148524 3300046528 Bacteria 1013
417 Ga0495654_0285459 3300046530 Bacteria 678
418 Ga0495665_0223413 3300046531 Bacteria 973
419 Ga0495640_0128079 3300046533 Bacteria 1645
420 Ga0495640_0198126 3300046533 Bacteria 1274
421 Ga0495587_0523851 3300046536 Bacteria 655
422 Ga0495598_0001481 3300046537 Bacteria 4674
423 Ga0495609_0174608 3300046538 Bacteria 906
424 Ga0495667_0133817 3300046559 Bacteria 1599
425 Ga0495656_0021206 3300046615 Bacteria 2528
426 Ga0495656_0222424 3300046615 Bacteria 944
427 Ga0495668_0073818 3300046616 Bacteria 1873
428 Ga0495668_0140565 3300046616 Bacteria 1321
429 Ga0495634_0196991 3300046642 Bacteria 1253
430 Ga0495611_0117487 3300046648 Bacteria 1240
431 Ga0495611_0258636 3300046648 Bacteria 806
432 Ga0495625_0349079 3300046660 Bacteria 936
433 Ga0495625_0821340 3300046660 Bacteria 539
434 Ga0495635_0172509 3300046663 Bacteria 1471
435 Ga0495659_0008153 3300046664 Bacteria 3330
436 Ga0495659_0094573 3300046664 Bacteria 1151
437 Ga0495661_0112410 3300046665 Bacteria 1516
438 Ga0495661_0421804 3300046665 Bacteria 646
439 Ga0495588_0068735 3300046674 Bacteria 1840
440 Ga0495599_0654510 3300046678 Bacteria 608
441 Ga0495647_0012713 3300046681 Bacteria 2904
442 Ga0495647_0373535 3300046681 Bacteria 652
443 Ga0495658_0062204 3300046683 Bacteria 2145
444 Ga0495658_0176686 3300046683 Bacteria 1323
445 Ga0495669_0196503 3300046684 Bacteria 963
446 Ga0495669_0359349 3300046684 Bacteria 704
447 Ga0495613_0133902 3300046689 Bacteria 1774
448 Ga0495624_0166688 3300046690 Bacteria 1344
449 Ga0495624_0675924 3300046690 Bacteria 613
450 Ga0495670_0076056 3300046691 Bacteria 1705
451 Ga0495670_0663428 3300046691 Bacteria 568
452 Ga0495589_0052863 3300046794 Bacteria 2006
453 Ga0495589_0378976 3300046794 Bacteria 650
454 Ga0495660_0234121 3300046810 Bacteria 859
455 Ga0495581_0508633 3300047315 Bacteria 700
456 Ga0495672_0169930 3300047320 Bacteria 1113
457 Ga0495676_0016979 3300047321 Bacteria 6445
458 Ga0495676_0129890 3300047321 Bacteria 1820
459 Ga0495683_0090783 3300047323 Bacteria 1480
460 Ga0495679_039302 3300047446 Bacteria 1476
461 Ga0495686_0337277 3300047472 Bacteria 823
462 Ga0495593_0024050 3300047673 Bacteria 3380
463 Ga0495602_0670899 3300048088 Bacteria 706
464 Ga0496100_0046625 3300048903 Bacteria 2788
465 Ga0496100_0164529 3300048903 Bacteria 1592
466 Ga0496101_0062581 3300048904 Bacteria 2706
467 Ga0496101_0110523 3300048904 Bacteria 2068
468 Ga0496101_0315289 3300048904 Bacteria 1226
469 Ga0496101_0520066 3300048904 Bacteria 940
470 Ga0496102_0057096 3300048905 Bacteria 3562
471 Ga0496102_0083544 3300048905 Bacteria 2947
472 Ga0496102_0105955 3300048905 Bacteria 2616
473 Ga0496102_0382815 3300048905 Bacteria 1324
474 Ga0496102_0505164 3300048905 Bacteria 1131
475 Ga0496103_0007060 3300048906 Bacteria 6705
476 Ga0496103_0039098 3300048906 Bacteria 2914
477 Ga0496103_0391251 3300048906 Bacteria 893
478 Ga0496104_0001526 3300048907 Bacteria 19967
479 Ga0496104_0002719 3300048907 Bacteria 15219
480 Ga0496104_0004554 3300048907 Bacteria 12081
481 Ga0496104_0055837 3300048907 Bacteria 3734
482 Ga0496104_0819044 3300048907 Bacteria 837
483 Ga0496105_0002373 3300048908 Bacteria 13644
484 Ga0496105_0014281 3300048908 Bacteria 6320
485 Ga0496105_0022845 3300048908 Bacteria 5069
486 Ga0496105_0109297 3300048908 Bacteria 2283
487 Ga0496106_0150503 3300048909 Bacteria 1835
488 Ga0496106_0178550 3300048909 Bacteria 1685
489 Ga0496107_0065105 3300048910 Bacteria 2642
490 Ga0496107_0132177 3300048910 Bacteria 1843
491 Ga0496107_0165321 3300048910 Bacteria 1640
492 Ga0496107_0196651 3300048910 Bacteria 1498
493 Ga0496107_0242398 3300048910 Bacteria 1341
494 Ga0496108_0016959 3300048911 Bacteria 5952
495 Ga0496108_0068969 3300048911 Bacteria 2984
496 Ga0496108_0164591 3300048911 Bacteria 1917
497 Ga0496108_0185262 3300048911 Bacteria 1803
498 Ga0496109_0002911 3300048912 Bacteria 14299
499 Ga0496109_0037918 3300048912 Bacteria 4356
500 Ga0496109_0074081 3300048912 Bacteria 3129
501 Ga0496109_0669253 3300048912 Bacteria 975
502 Ga0496109_1560568 3300048912 Bacteria 595
503 Ga0496110_0012106 3300048913 Bacteria 7086
504 Ga0496110_0024954 3300048913 Bacteria 5102
505 Ga0496110_0287294 3300048913 Bacteria 1498
506 Ga0496110_1283811 3300048913 Bacteria 641
507 Ga0496111_0011310 3300048914 Bacteria 6007
508 Ga0496111_0098104 3300048914 Bacteria 2151
509 Ga0496111_0576818 3300048914 Bacteria 824
510 Ga0496112_0019868 3300048915 Bacteria 6356
511 Ga0496112_0025277 3300048915 Bacteria 5701
512 Ga0496112_0402896 3300048915 Bacteria 1308
513 Ga0496112_1032652 3300048915 Bacteria 741
514 Ga0496113_0000438 3300048916 Bacteria 20214
515 Ga0496113_0202073 3300048916 Bacteria 1579
516 Ga0496113_0293813 3300048916 Bacteria 1300
517 Ga0496113_0904046 3300048916 Bacteria 698
518 Ga0496114_0013133 3300048917 Bacteria 6637
519 Ga0496114_0073769 3300048917 Bacteria 2872
520 Ga0496114_0094034 3300048917 Bacteria 2549
521 Ga0496115_0055603 3300048918 Bacteria 3179
522 Ga0496115_0074877 3300048918 Bacteria 2749
523 Ga0496115_0108138 3300048918 Bacteria 2283
524 Ga0496115_0198868 3300048918 Bacteria 1656
525 Ga0496115_0306727 3300048918 Bacteria 1300
526 Ga0496115_0481436 3300048918 Bacteria 999
527 Ga0496121_0003431 3300048924 Bacteria 22656
528 Ga0496122_0001629 3300048925 Bacteria 35029
529 Ga0496123_0000906 3300048926 Bacteria 46669
530 Ga0496124_0690235 3300048927 Bacteria 649
531 Ga0496125_0206798 3300048928 Bacteria 1279
532 Ga0496126_0016480 3300048929 Bacteria 7386
533 Ga0496126_0190763 3300048929 Bacteria 1736
534 Ga0501031_0003015 3300049568 Bacteria 10775
535 Ga0501032_0247253 3300049569 Bacteria 1158
536 Ga0501033_0083990 3300049570 Bacteria 2333
537 Ga0501034_0037064 3300049571 Bacteria 4938
538 Ga0501034_0156136 3300049571 Bacteria 2255
539 Ga0501034_0322581 3300049571 Bacteria 1477
540 Ga0501036_0130895 3300049572 Bacteria 2118
541 Ga0501038_0291082 3300049574 Bacteria 1283
542 Ga0501040_0742395 3300049576 Bacteria 710
543 Ga0501041_0279235 3300049577 Bacteria 1051
544 Ga0501041_0356381 3300049577 Bacteria 925
545 Ga0501043_0512928 3300049579 Bacteria 894
546 Ga0501043_1018177 3300049579 Bacteria 589
547 Ga0501047_0210018 3300049581 Bacteria 1805
548 Ga0501048_0654025 3300049582 Bacteria 755
549 Ga0501068_0090545 3300049584 Bacteria 1887
550 Ga0501069_0275280 3300049585 Bacteria 984
551 Ga0501070_0086786 3300049586 Bacteria 2590
552 Ga0501070_0449854 3300049586 Bacteria 1038
553 Ga0501070_0863275 3300049586 Bacteria 707
554 Ga0501072_0211276 3300049588 Bacteria 1546
555 Ga0501074_0353724 3300049590 Bacteria 1042
556 Ga0501074_0741965 3300049590 Bacteria 692
557 Ga0501074_0805200 3300049590 Bacteria 662
558 Ga0501075_0134980 3300049591 Bacteria 1880
559 Ga0501075_0198855 3300049591 Bacteria 1529
560 Ga0501076_0200435 3300049592 Bacteria 1630
561 Ga0501076_0315405 3300049592 Bacteria 1283
562 Ga0501076_0422270 3300049592 Bacteria 1097
563 Ga0501077_0027098 3300049593 Bacteria 3639
564 Ga0501252_016884 3300049682 Bacteria 923
565 Ga0501079_0086393 3300049741 Bacteria 2428
566 Ga0501079_0812376 3300049741 Bacteria 736
567 Ga0501080_0102658 3300049742 Bacteria 2652
568 Ga0501080_0605314 3300049742 Bacteria 972
569 Ga0501080_1403791 3300049742 Bacteria 596
570 Ga0501081_0183731 3300049743 Bacteria 1513
571 Ga0501081_0517738 3300049743 Bacteria 890
572 Ga0501241_003227 3300049758 Bacteria 3095
573 Ga0501035_0225766 3300049822 Bacteria 1597
574 Ga0501044_0261350 3300049823 Bacteria 1669
575 Ga0501045_0109882 3300049824 Bacteria 2044
576 nmdc:mga0yw44_276465_c1 3300050492 Bacteria 1122
577 nmdc:mga0yw44_312690_c1 3300050492 Bacteria 1054
578 nmdc:mga0yw44_34166_c1 3300050492 Bacteria 2978
579 nmdc:mga0yw44_626643_c1 3300050492 Bacteria 731
580 nmdc:mga0yw44_87583_c1 3300050492 Bacteria 1963
581 nmdc:mga04h51_291439_c1 3300050495 Bacteria 663
582 nmdc:mga05p37_108351_c1 3300050507 Bacteria 3417
583 nmdc:mga05p37_199748_c1 3300050507 Bacteria 2423
584 nmdc:mga05p37_34403_c1 3300050507 Bacteria 6207
585 nmdc:mga05p37_367150_c1 3300050507 Bacteria 1690
586 nmdc:mga05p37_4993_c1 3300050507 Bacteria 8817
587 nmdc:mga09592_44194_c1 3300050508 Bacteria 3749
588 nmdc:mga09592_52542_c1 3300050508 Bacteria 3440
589 nmdc:mga0qj67_212097_c1 3300050509 Bacteria 1573
590 nmdc:mga0qj67_83_c1 3300050509 Bacteria 63959
591 nmdc:mga06r32_1272653_c1 3300050510 Bacteria 680
592 nmdc:mga06r32_25066_c1 3300050510 Bacteria 5542
593 nmdc:mga06r32_259924_c1 3300050510 Bacteria 1724
594 nmdc:mga06r32_362432_c1 3300050510 Bacteria 1433
595 nmdc:mga08y16_1137082_c1 3300050511 Bacteria 754
596 nmdc:mga08y16_142421_c1 3300050511 Bacteria 2492
597 nmdc:mga0n895_141084_c1 3300050512 Bacteria 2438
598 nmdc:mga0n895_236465_c1 3300050512 Bacteria 1854
599 nmdc:mga0n895_623985_c1 3300050512 Bacteria 1079
600 nmdc:mga0n895_70025_c1 3300050512 Bacteria 3476
601 nmdc:mga0n895_76758_c1 3300050512 Bacteria 3322
602 nmdc:mga0rr50_182233_c1 3300050513 Bacteria 1717
603 nmdc:mga0rr50_231994_c1 3300050513 Bacteria 1527
604 nmdc:mga0a205_127324_c1 3300050515 Bacteria 2446
605 nmdc:mga0a205_59177_c1 3300050515 Bacteria 3701
606 Ga0495601_0091840 3300053077 Bacteria 1955
607 Ga0495601_0100294 3300053077 Bacteria 1870
608 Ga0495601_0216083 3300053077 Bacteria 1252
609 Ga0495612_0137262 3300053078 Bacteria 1059
610 Ga0495655_0004837 3300053083 Bacteria 2336
611 Ga0495595_0115426 3300053084 Bacteria 1305
612 Ga0495619_0670344 3300053085 Bacteria 706
613 Ga0500651_0000207 3300053093 Bacteria 36951
614 Ga0500641_0189197 3300053096 Bacteria 882
615 Ga0500616_0143260 3300053153 Bacteria 1114
616 Ga0501084_0174742 3300054114 Bacteria 1813
617 Ga0501084_0375844 3300054114 Bacteria 1201
618 Ga0501082_0057982 3300060353 Bacteria 3336
619 Ga0501082_0632172 3300060353 Bacteria 937
620 Ga0530510_0404773 3300061734 Bacteria 1029

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427687 2586210442 149
2 iso_pu_bacteria 2738541283 2738754289 149
3 iso_pu_bacteria 2738541284 2738762947 149
4 iso_pu_bacteria 2738541302 2738855767 149
5 iso_pu_bacteria 2738543023 2739301647 149
6 iso_pu_bacteria 2739367651 2739590180 149
7 iso_pu_bacteria 2739367656 2739615398 149
8 iso_pu_bacteria 2775506987 2776614555 149
9 iso_pu_bacteria 2818991437 2819548432 149
10 iso_pu_bacteria 2842722452 2842723004 149
11 iso_pu_bacteria 2842909656 2842913960 149
12 iso_pu_bacteria 2849281842 2849283701 149
13 iso_pu_bacteria 2852627209 2852627684 149
14 iso_pu_bacteria 2857627736 2857630173 149
15 iso_pu_bacteria 2902048731 2902053049 149
16 iso_pu_bacteria 2904445276 2904449545 149
17 iso_pu_bacteria 2919186247 2919187855 149
18 iso_pu_bacteria 2939664404 2939664878 149
19 iso_pu_bacteria 2945997725 2945999970 149
20 iso_pu_bacteria 2954016120 2954016577 149
21 iso_pu_bacteria 2739367663 2739644405 150
22 3300025944 Ga0207661_10745007 Ga0207661_107450071 152
23 3300048907 Ga0496104_0819044 Ga0496104_0819044_43_555 152
24 3300049571 Ga0501034_0037064 Ga0501034_0037064_3755_4243 152
25 2162886007 SwRhRL2b_contig_2896220 SwRhRL2b_0742.00000990 153
26 2162886007 SwRhRL2b_contig_475676 SwRhRL2b_0167.00008630 153
27 3300001977 JGI24746J21847_1032408 JGI24746J21847_10324081 153
28 3300001990 JGI24737J22298_10108803 JGI24737J22298_101088031 153
29 3300001991 JGI24743J22301_10071135 JGI24743J22301_100711351 153
30 3300002074 JGI24748J21848_1014993 JGI24748J21848_10149931 153
31 3300002075 JGI24738J21930_10015935 JGI24738J21930_100159351 153
32 3300002077 JGI24744J21845_10058966 JGI24744J21845_100589661 153
33 3300002773 JGI25152J39213_1000476 JGI25152J39213_100047620 153
34 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002241 153
35 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003417 153
36 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003249 153
37 3300003323 rootH1_10239678 rootH1_102396782 153
38 3300003781 Ga0055536_1000049 Ga0055536_100004965 153
39 3300003791 Ga0055530_10002714 Ga0055530_100027148 153
40 3300005288 Ga0065714_10002298 Ga0065714_1000229825 153
41 3300005288 Ga0065714_10002621 Ga0065714_1000262114 153
42 3300005288 Ga0065714_10014983 Ga0065714_100149833 153
43 3300005288 Ga0065714_10065634 Ga0065714_1006563410 153
44 3300005288 Ga0065714_10071503 Ga0065714_100715035 153
45 3300005288 Ga0065714_10084878 Ga0065714_100848782 153
46 3300005288 Ga0065714_10300924 Ga0065714_103009241 153
47 3300005289 Ga0065704_10000205 Ga0065704_1000020511 153
48 3300005289 Ga0065704_10001103 Ga0065704_100011036 153
49 3300005289 Ga0065704_10350957 Ga0065704_103509571 153
50 3300005328 Ga0070676_10021108 Ga0070676_100211086 153
51 3300005329 Ga0070683_100174484 Ga0070683_1001744843 153
52 3300005329 Ga0070683_101252790 Ga0070683_1012527901 153
53 3300005330 Ga0070690_100465800 Ga0070690_1004658002 153
54 3300005336 Ga0070680_100160460 Ga0070680_1001604602 153
55 3300005336 Ga0070680_100511318 Ga0070680_1005113182 153
56 3300005337 Ga0070682_101047603 Ga0070682_1010476032 153
57 3300005339 Ga0070660_100130664 Ga0070660_1001306642 153
58 3300005340 Ga0070689_100170832 Ga0070689_1001708322 153
59 3300005343 Ga0070687_100137403 Ga0070687_1001374032 153
60 3300005344 Ga0070661_100361993 Ga0070661_1003619932 153
61 3300005345 Ga0070692_10031592 Ga0070692_100315922 153
62 3300005354 Ga0070675_100144519 Ga0070675_1001445192 153
63 3300005355 Ga0070671_101154736 Ga0070671_1011547361 153
64 3300005356 Ga0070674_100742796 Ga0070674_1007427961 153
65 3300005364 Ga0070673_100174646 Ga0070673_1001746462 153
66 3300005365 Ga0070688_100098941 Ga0070688_1000989412 153
67 3300005366 Ga0070659_100171213 Ga0070659_1001712133 153
68 3300005366 Ga0070659_100250940 Ga0070659_1002509402 153
69 3300005434 Ga0070709_10010442 Ga0070709_100104426 153
70 3300005434 Ga0070709_11195096 Ga0070709_111950961 153
71 3300005435 Ga0070714_100014088 Ga0070714_1000140885 153
72 3300005435 Ga0070714_100169370 Ga0070714_1001693703 153
73 3300005436 Ga0070713_100019862 Ga0070713_1000198625 153
74 3300005436 Ga0070713_100146522 Ga0070713_1001465221 153
75 3300005436 Ga0070713_101484081 Ga0070713_1014840811 153
76 3300005437 Ga0070710_10004638 Ga0070710_100046385 153
77 3300005439 Ga0070711_100103337 Ga0070711_1001033374 153
78 3300005439 Ga0070711_100252837 Ga0070711_1002528372 153
79 3300005440 Ga0070705_101002554 Ga0070705_1010025541 153
80 3300005441 Ga0070700_100063622 Ga0070700_1000636221 153
81 3300005445 Ga0070708_100472124 Ga0070708_1004721242 153
82 3300005457 Ga0070662_100573661 Ga0070662_1005736612 153
83 3300005459 Ga0068867_100373779 Ga0068867_1003737792 153
84 3300005468 Ga0070707_100504733 Ga0070707_1005047331 153
85 3300005468 Ga0070707_100532588 Ga0070707_1005325882 153
86 3300005468 Ga0070707_101619042 Ga0070707_1016190421 153
87 3300005468 Ga0070707_101715756 Ga0070707_1017157561 153
88 3300005471 Ga0070698_100901080 Ga0070698_1009010802 153
89 3300005471 Ga0070698_101609910 Ga0070698_1016099101 153
90 3300005518 Ga0070699_100006185 Ga0070699_1000061859 153
91 3300005518 Ga0070699_100245715 Ga0070699_1002457152 153
92 3300005518 Ga0070699_100269752 Ga0070699_1002697522 153
93 3300005530 Ga0070679_100297936 Ga0070679_1002979362 153
94 3300005535 Ga0070684_100079215 Ga0070684_1000792154 153
95 3300005536 Ga0070697_101130273 Ga0070697_1011302731 153
96 3300005539 Ga0068853_100902600 Ga0068853_1009026001 153
97 3300005543 Ga0070672_100086675 Ga0070672_1000866755 153
98 3300005545 Ga0070695_100431358 Ga0070695_1004313582 153
99 3300005546 Ga0070696_100552426 Ga0070696_1005524261 153
100 3300005549 Ga0070704_100911846 Ga0070704_1009118461 153
101 3300005563 Ga0068855_101035675 Ga0068855_1010356752 153
102 3300005563 Ga0068855_101290013 Ga0068855_1012900131 153
103 3300005564 Ga0070664_100162359 Ga0070664_1001623593 153
104 3300005577 Ga0068857_100213576 Ga0068857_1002135763 153
105 3300005578 Ga0068854_100160911 Ga0068854_1001609111 153
106 3300005614 Ga0068856_100364760 Ga0068856_1003647602 153
107 3300005615 Ga0070702_100134722 Ga0070702_1001347223 153
108 3300005615 Ga0070702_100842093 Ga0070702_1008420931 153
109 3300005616 Ga0068852_100209977 Ga0068852_1002099772 153
110 3300005618 Ga0068864_100061026 Ga0068864_1000610263 153
111 3300005618 Ga0068864_100379031 Ga0068864_1003790312 153
112 3300005718 Ga0068866_10194047 Ga0068866_101940472 153
113 3300005719 Ga0068861_100225431 Ga0068861_1002254313 153
114 3300005834 Ga0068851_10086495 Ga0068851_100864952 153
115 3300005840 Ga0068870_10013225 Ga0068870_100132252 153
116 3300005841 Ga0068863_100189614 Ga0068863_1001896142 153
117 3300005843 Ga0068860_100178848 Ga0068860_1001788482 153
118 3300005844 Ga0068862_100007625 Ga0068862_10000762512 153
119 3300005844 Ga0068862_100421900 Ga0068862_1004219002 153
120 3300005937 Ga0081455_10001555 Ga0081455_1000155526 153
121 3300005937 Ga0081455_10012680 Ga0081455_100126802 153
122 3300005937 Ga0081455_10025015 Ga0081455_100250159 153
123 3300005937 Ga0081455_10060912 Ga0081455_100609122 153
124 3300005937 Ga0081455_10061060 Ga0081455_100610602 153
125 3300005937 Ga0081455_10095813 Ga0081455_100958131 153
126 3300005937 Ga0081455_10202434 Ga0081455_102024342 153
127 3300005981 Ga0081538_10107822 Ga0081538_101078222 153
128 3300005983 Ga0081540_1016285 Ga0081540_10162853 153
129 3300006028 Ga0070717_10029383 Ga0070717_100293835 153
130 3300006028 Ga0070717_10269715 Ga0070717_102697152 153
131 3300006028 Ga0070717_10517777 Ga0070717_105177772 153
132 3300006028 Ga0070717_11137417 Ga0070717_111374171 153
133 3300006038 Ga0075365_10033139 Ga0075365_100331392 153
134 3300006038 Ga0075365_10137905 Ga0075365_101379051 153
135 3300006038 Ga0075365_10304602 Ga0075365_103046022 153
136 3300006042 Ga0075368_10031945 Ga0075368_100319454 153
137 3300006048 Ga0075363_100637202 Ga0075363_1006372021 153
138 3300006058 Ga0075432_10209363 Ga0075432_102093631 153
139 3300006163 Ga0070715_10298585 Ga0070715_102985851 153
140 3300006173 Ga0070716_100016175 Ga0070716_1000161755 153
141 3300006175 Ga0070712_100013815 Ga0070712_1000138154 153
142 3300006175 Ga0070712_100326830 Ga0070712_1003268301 153
143 3300006175 Ga0070712_100452068 Ga0070712_1004520681 153
144 3300006177 Ga0075362_10302297 Ga0075362_103022972 153
145 3300006178 Ga0075367_10035549 Ga0075367_100355493 153
146 3300006844 Ga0075428_100017448 Ga0075428_1000174484 153
147 3300006844 Ga0075428_100143569 Ga0075428_1001435694 153
148 3300006844 Ga0075428_100196014 Ga0075428_1001960142 153
149 3300006844 Ga0075428_100401471 Ga0075428_1004014713 153
150 3300006844 Ga0075428_101042930 Ga0075428_1010429302 153
151 3300006844 Ga0075428_101063293 Ga0075428_1010632931 153
152 3300006846 Ga0075430_100000184 Ga0075430_10000018422 153
153 3300006846 Ga0075430_100923747 Ga0075430_1009237472 153
154 3300006847 Ga0075431_100103927 Ga0075431_1001039272 153
155 3300006847 Ga0075431_100187319 Ga0075431_1001873192 153
156 3300006847 Ga0075431_101210136 Ga0075431_1012101362 153
157 3300006852 Ga0075433_10050636 Ga0075433_100506364 153
158 3300006852 Ga0075433_10055747 Ga0075433_100557477 153
159 3300006871 Ga0075434_100020000 Ga0075434_1000200008 153
160 3300006871 Ga0075434_100132361 Ga0075434_1001323615 153
161 3300006871 Ga0075434_100176021 Ga0075434_1001760214 153
162 3300006880 Ga0075429_100034844 Ga0075429_1000348443 153
163 3300006880 Ga0075429_100993055 Ga0075429_1009930552 153
164 3300007076 Ga0075435_100083356 Ga0075435_1000833561 153
165 3300007265 Ga0099794_10013261 Ga0099794_100132613 153
166 3300007788 Ga0099795_10086914 Ga0099795_100869142 153
167 3300009011 Ga0105251_10204700 Ga0105251_102047001 153
168 3300009036 Ga0105244_10051568 Ga0105244_100515681 153
169 3300009094 Ga0111539_10078004 Ga0111539_100780043 153
170 3300009098 Ga0105245_10338237 Ga0105245_103382372 153
171 3300009101 Ga0105247_10025486 Ga0105247_100254863 153
172 3300009101 Ga0105247_10145370 Ga0105247_101453702 153
173 3300009101 Ga0105247_10512028 Ga0105247_105120282 153
174 3300009147 Ga0114129_10004024 Ga0114129_1000402414 153
175 3300009147 Ga0114129_10023533 Ga0114129_1002353310 153
176 3300009147 Ga0114129_10041836 Ga0114129_100418366 153
177 3300009147 Ga0114129_10072366 Ga0114129_100723664 153
178 3300009147 Ga0114129_10161736 Ga0114129_101617362 153
179 3300009147 Ga0114129_10362630 Ga0114129_103626303 153
180 3300009147 Ga0114129_10377185 Ga0114129_103771853 153
181 3300009147 Ga0114129_10653912 Ga0114129_106539122 153
182 3300009147 Ga0114129_10658940 Ga0114129_106589402 153
183 3300009147 Ga0114129_11039890 Ga0114129_110398902 153
184 3300009148 Ga0105243_10472442 Ga0105243_104724422 153
185 3300009176 Ga0105242_10461666 Ga0105242_104616662 153
186 3300009177 Ga0105248_10065217 Ga0105248_100652172 153
187 3300009545 Ga0105237_10004270 Ga0105237_100042706 153
188 3300009545 Ga0105237_10163664 Ga0105237_101636642 153
189 3300009553 Ga0105249_10108519 Ga0105249_101085194 153
190 3300010159 Ga0099796_10001225 Ga0099796_100012254 153
191 3300010159 Ga0099796_10123492 Ga0099796_101234922 153
192 3300010375 Ga0105239_11778771 Ga0105239_117787711 153
193 3300011119 Ga0105246_10402342 Ga0105246_104023422 153
194 3300013100 Ga0157373_10000974 Ga0157373_1000097420 153
195 3300013100 Ga0157373_10006199 Ga0157373_100061998 153
196 3300013100 Ga0157373_10087836 Ga0157373_100878363 153
197 3300013102 Ga0157371_10000119 Ga0157371_1000011939 153
198 3300013102 Ga0157371_10010487 Ga0157371_100104873 153
199 3300013104 Ga0157370_10004633 Ga0157370_100046339 153
200 3300013104 Ga0157370_10014232 Ga0157370_100142327 153
201 3300013104 Ga0157370_10051173 Ga0157370_100511735 153
202 3300013104 Ga0157370_10056450 Ga0157370_100564504 153
203 3300013104 Ga0157370_10086094 Ga0157370_100860944 153
204 3300013104 Ga0157370_10091869 Ga0157370_100918694 153
205 3300013104 Ga0157370_10164106 Ga0157370_101641062 153
206 3300013104 Ga0157370_10260512 Ga0157370_102605123 153
207 3300013104 Ga0157370_10802574 Ga0157370_108025742 153
208 3300013105 Ga0157369_10000015 Ga0157369_1000001576 153
209 3300013296 Ga0157374_10012482 Ga0157374_100124822 153
210 3300013297 Ga0157378_10642804 Ga0157378_106428042 153
211 3300013306 Ga0163162_10000520 Ga0163162_1000052036 153
212 3300013306 Ga0163162_10172620 Ga0163162_101726203 153
213 3300013306 Ga0163162_10299233 Ga0163162_102992332 153
214 3300013307 Ga0157372_10074067 Ga0157372_100740673 153
215 3300013307 Ga0157372_10443615 Ga0157372_104436153 153
216 3300013308 Ga0157375_10436731 Ga0157375_104367313 153
217 3300014325 Ga0163163_10015050 Ga0163163_100150503 153
218 3300014325 Ga0163163_11938078 Ga0163163_119380781 153
219 3300014326 Ga0157380_10130964 Ga0157380_101309644 153
220 3300014497 Ga0182008_10000069 Ga0182008_1000006958 153
221 3300014497 Ga0182008_10000247 Ga0182008_100002479 153
222 3300014497 Ga0182008_10001023 Ga0182008_100010235 153
223 3300014497 Ga0182008_10011758 Ga0182008_100117584 153
224 3300014497 Ga0182008_10017588 Ga0182008_100175882 153
225 3300014497 Ga0182008_10043944 Ga0182008_100439443 153
226 3300014497 Ga0182008_10121860 Ga0182008_101218602 153
227 3300014497 Ga0182008_10332552 Ga0182008_103325521 153
228 3300014745 Ga0157377_10102849 Ga0157377_101028492 153
229 3300014968 Ga0157379_10574214 Ga0157379_105742142 153
230 3300014969 Ga0157376_10528137 Ga0157376_105281371 153
231 3300014969 Ga0157376_10917396 Ga0157376_109173962 153
232 3300014969 Ga0157376_11165800 Ga0157376_111658001 153
233 3300015261 Ga0182006_1000091 Ga0182006_100009155 153
234 3300015261 Ga0182006_1000210 Ga0182006_100021043 153
235 3300015261 Ga0182006_1000352 Ga0182006_10003525 153
236 3300015261 Ga0182006_1009379 Ga0182006_10093794 153
237 3300015262 Ga0182007_10000010 Ga0182007_10000010138 153
238 3300015262 Ga0182007_10013273 Ga0182007_100132732 153
239 3300015262 Ga0182007_10045068 Ga0182007_100450682 153
240 3300015682 Ga0183373_1005 Ga0183373_1005278 153
241 3300017792 Ga0163161_10000046 Ga0163161_1000004696 153
242 3300017792 Ga0163161_10001264 Ga0163161_1000126415 153
243 3300017792 Ga0163161_10003880 Ga0163161_100038802 153
244 3300017792 Ga0163161_10019645 Ga0163161_100196453 153
245 3300017792 Ga0163161_11411151 Ga0163161_114111511 153
246 3300021361 Ga0213872_10302829 Ga0213872_103028292 153
247 3300021441 Ga0213871_10125562 Ga0213871_101255621 153
248 3300025245 Ga0207425_1000004 Ga0207425_1000004704 153
249 3300025258 Ga0209129_1000005 Ga0209129_1000005238 153
250 3300025292 Ga0209676_1000001 Ga0209676_100000133 153
251 3300025294 Ga0209025_1000009 Ga0209025_1000009704 153
252 3300025297 Ga0209758_1000010 Ga0209758_1000010705 153
253 3300025298 Ga0209050_1000258 Ga0209050_100025866 153
254 3300025898 Ga0207692_10074367 Ga0207692_100743671 153
255 3300025900 Ga0207710_10072226 Ga0207710_100722263 153
256 3300025900 Ga0207710_10156515 Ga0207710_101565152 153
257 3300025901 Ga0207688_10001906 Ga0207688_100019062 153
258 3300025903 Ga0207680_10347213 Ga0207680_103472131 153
259 3300025904 Ga0207647_10199996 Ga0207647_101999962 153
260 3300025905 Ga0207685_10227796 Ga0207685_102277961 153
261 3300025905 Ga0207685_10237167 Ga0207685_102371671 153
262 3300025906 Ga0207699_10003624 Ga0207699_1000362410 153
263 3300025906 Ga0207699_10299183 Ga0207699_102991831 153
264 3300025907 Ga0207645_10029712 Ga0207645_100297122 153
265 3300025908 Ga0207643_10002034 Ga0207643_100020342 153
266 3300025909 Ga0207705_10110720 Ga0207705_101107202 153
267 3300025909 Ga0207705_10297948 Ga0207705_102979482 153
268 3300025910 Ga0207684_10108001 Ga0207684_101080012 153
269 3300025910 Ga0207684_11192284 Ga0207684_111922841 153
270 3300025912 Ga0207707_10087991 Ga0207707_100879915 153
271 3300025912 Ga0207707_11205253 Ga0207707_112052531 153
272 3300025914 Ga0207671_10145482 Ga0207671_101454822 153
273 3300025915 Ga0207693_10013984 Ga0207693_100139848 153
274 3300025915 Ga0207693_10021233 Ga0207693_100212334 153
275 3300025915 Ga0207693_10066064 Ga0207693_100660641 153
276 3300025916 Ga0207663_10047518 Ga0207663_100475182 153
277 3300025916 Ga0207663_10072514 Ga0207663_100725144 153
278 3300025916 Ga0207663_10140946 Ga0207663_101409463 153
279 3300025917 Ga0207660_10399160 Ga0207660_103991602 153
280 3300025918 Ga0207662_10061769 Ga0207662_100617694 153
281 3300025919 Ga0207657_10092785 Ga0207657_100927852 153
282 3300025920 Ga0207649_10110308 Ga0207649_101103082 153
283 3300025920 Ga0207649_10444832 Ga0207649_104448321 153
284 3300025920 Ga0207649_10521698 Ga0207649_105216981 153
285 3300025921 Ga0207652_10633181 Ga0207652_106331811 153
286 3300025922 Ga0207646_10449344 Ga0207646_104493442 153
287 3300025926 Ga0207659_10116163 Ga0207659_101161633 153
288 3300025928 Ga0207700_10045730 Ga0207700_100457302 153
289 3300025928 Ga0207700_10301304 Ga0207700_103013041 153
290 3300025929 Ga0207664_10201131 Ga0207664_102011313 153
291 3300025929 Ga0207664_11629177 Ga0207664_116291771 153
292 3300025931 Ga0207644_10710694 Ga0207644_107106941 153
293 3300025931 Ga0207644_11219885 Ga0207644_112198851 153
294 3300025933 Ga0207706_10001779 Ga0207706_1000177921 153
295 3300025933 Ga0207706_10585015 Ga0207706_105850151 153
296 3300025935 Ga0207709_11214219 Ga0207709_112142191 153
297 3300025936 Ga0207670_10188449 Ga0207670_101884491 153
298 3300025938 Ga0207704_10052470 Ga0207704_100524702 153
299 3300025939 Ga0207665_10003101 Ga0207665_100031018 153
300 3300025939 Ga0207665_10032249 Ga0207665_100322497 153
301 3300025940 Ga0207691_10014229 Ga0207691_1001422911 153
302 3300025942 Ga0207689_10024325 Ga0207689_100243254 153
303 3300025942 Ga0207689_10571077 Ga0207689_105710771 153
304 3300025949 Ga0207667_10290196 Ga0207667_102901961 153
305 3300025949 Ga0207667_10848154 Ga0207667_108481542 153
306 3300025960 Ga0207651_10089023 Ga0207651_100890234 153
307 3300025961 Ga0207712_10028233 Ga0207712_100282338 153
308 3300025972 Ga0207668_10334791 Ga0207668_103347911 153
309 3300025972 Ga0207668_10519713 Ga0207668_105197132 153
310 3300025981 Ga0207640_10115254 Ga0207640_101152542 153
311 3300025986 Ga0207658_10534794 Ga0207658_105347941 153
312 3300026023 Ga0207677_10159831 Ga0207677_101598312 153
313 3300026023 Ga0207677_10682519 Ga0207677_106825191 153
314 3300026035 Ga0207703_10092926 Ga0207703_100929263 153
315 3300026041 Ga0207639_11055527 Ga0207639_110555271 153
316 3300026067 Ga0207678_10004671 Ga0207678_1000467114 153
317 3300026067 Ga0207678_10207359 Ga0207678_102073592 153
318 3300026075 Ga0207708_10001428 Ga0207708_100014282 153
319 3300026078 Ga0207702_11196580 Ga0207702_111965801 153
320 3300026088 Ga0207641_10161728 Ga0207641_101617282 153
321 3300026089 Ga0207648_10023316 Ga0207648_100233163 153
322 3300026095 Ga0207676_10229124 Ga0207676_102291242 153
323 3300026095 Ga0207676_10556798 Ga0207676_105567982 153
324 3300026116 Ga0207674_10118625 Ga0207674_101186255 153
325 3300026118 Ga0207675_100001777 Ga0207675_10000177710 153
326 3300026121 Ga0207683_10016920 Ga0207683_100169208 153
327 3300027907 Ga0207428_10688353 Ga0207428_106883532 153
328 3300028379 Ga0268266_10174676 Ga0268266_101746762 153
329 3300028380 Ga0268265_10404171 Ga0268265_104041712 153
330 3300028380 Ga0268265_10980893 Ga0268265_109808932 153
331 3300028381 Ga0268264_11387256 Ga0268264_113872561 153
332 3300031239 Ga0265328_10007157 Ga0265328_100071572 153
333 3300031665 Ga0316575_10328023 Ga0316575_103280232 153
334 3300031712 Ga0265342_10016851 Ga0265342_100168515 153
335 3300031727 Ga0316576_10008140 Ga0316576_100081407 153
336 3300031727 Ga0316576_10416010 Ga0316576_104160102 153
337 3300031731 Ga0307405_10000124 Ga0307405_1000012413 153
338 3300031903 Ga0307407_10000024 Ga0307407_100000245 153
339 3300031911 Ga0307412_10000004 Ga0307412_10000004367 153
340 3300032002 Ga0307416_100000037 Ga0307416_10000003726 153
341 3300032004 Ga0307414_10000477 Ga0307414_1000047710 153
342 3300032004 Ga0307414_10007084 Ga0307414_100070844 153
343 3300032004 Ga0307414_10023212 Ga0307414_100232125 153
344 3300032004 Ga0307414_10062991 Ga0307414_100629912 153
345 3300032004 Ga0307414_10663755 Ga0307414_106637551 153
346 3300032004 Ga0307414_10709093 Ga0307414_107090931 153
347 3300032126 Ga0307415_100420644 Ga0307415_1004206442 153
348 3300035083 Ga0373926_0017741 Ga0373926_0017741_1817_2326 153
349 3300035083 Ga0373926_0195730 Ga0373926_0195730_73_582 153
350 3300035089 Ga0373944_0263074 Ga0373944_0263074_76_585 153
351 3300035113 Ga0373936_0008396 Ga0373936_0008396_2274_2783 153
352 3300035114 Ga0373939_0034395 Ga0373939_0034395_138_647 153
353 3300035116 Ga0373945_0013269 Ga0373945_0013269_2086_2595 153
354 3300035118 Ga0373954_0268092 Ga0373954_0268092_193_690 153
355 3300035118 Ga0373954_0455726 Ga0373954_0455726_110_619 153
356 3300035170 Ga0373943_0002541 Ga0373943_0002541_6492_7001 153
357 3300035170 Ga0373943_0244126 Ga0373943_0244126_402_911 153
358 3300035171 Ga0373946_0001624 Ga0373946_0001624_5999_6508 153
359 3300035171 Ga0373946_0276453 Ga0373946_0276453_258_767 153
360 3300035172 Ga0373955_0015035 Ga0373955_0015035_1442_1936 153
361 3300035172 Ga0373955_0363482 Ga0373955_0363482_66_575 153
362 3300035241 Ga0373961_0162029 Ga0373961_0162029_152_661 153
363 3300035242 Ga0373962_0108799 Ga0373962_0108799_240_746 153
364 3300035398 Ga0316574_0000617 Ga0316574_0000617_14183_14674 153
365 3300035398 Ga0316574_0002473 Ga0316574_0002473_1039_1533 153
366 3300035398 Ga0316574_0183952 Ga0316574_0183952_345_839 153
367 3300035398 Ga0316574_0704480 Ga0316574_0704480_99_590 153
368 3300035410 Ga0373924_0067417 Ga0373924_0067417_792_1286 153
369 3300035410 Ga0373924_0214357 Ga0373924_0214357_236_745 153
370 3300035692 Ga0373935_0036974 Ga0373935_0036974_1243_1752 153
371 3300035695 Ga0373927_0036244 Ga0373927_0036244_929_1438 153
372 3300035695 Ga0373927_0132986 Ga0373927_0132986_508_1017 153
373 3300035724 Ga0373933_0170112 Ga0373933_0170112_635_1129 153
374 3300035725 Ga0373947_0007075 Ga0373947_0007075_4647_5156 153
375 3300035725 Ga0373947_0057470 Ga0373947_0057470_608_1117 153
376 3300036401 Ga0373937_0007210 Ga0373937_0007210_882_1376 153
377 3300036647 Ga0316582_0051307 Ga0316582_0051307_12_506 153
378 3300036712 Ga0316584_0108949 Ga0316584_0108949_534_1019 153
379 3300036712 Ga0316584_0187266 Ga0316584_0187266_370_861 153
380 3300037068 Ga0373925_0112019 Ga0373925_0112019_418_927 153
381 3300037068 Ga0373925_0212679 Ga0373925_0212679_508_1017 153
382 3300037312 Ga0395899_0024753 Ga0395899_0024753_1574_2071 153
383 3300037418 Ga0395900_0020334 Ga0395900_0020334_5980_6477 153
384 3300037418 Ga0395900_0160661 Ga0395900_0160661_1757_2266 153
385 3300037466 Ga0395898_0074320 Ga0395898_0074320_551_1048 153
386 3300037466 Ga0395898_0145263 Ga0395898_0145263_116_625 153
387 3300037471 Ga0395905_0100025 Ga0395905_0100025_1040_1549 153
388 3300037853 Ga0436364_1481812 Ga0436364_1481812_498_1007 153
389 3300038443 Ga0395901_0015210 Ga0395901_0015210_4119_4616 153
390 3300038443 Ga0395901_0304646 Ga0395901_0304646_510_1019 153
391 3300039437 Ga0436365_0282095 Ga0436365_0282095_36_548 153
392 3300039438 Ga0436360_0765232 Ga0436360_0765232_1688_2197 153
393 3300039447 Ga0436361_0123121 Ga0436361_0123121_103_612 153
394 3300039447 Ga0436361_0615857 Ga0436361_0615857_2453_2962 153
395 3300041503 Ga0451847_0973357 Ga0451847_0973357_297_806 153
396 3300041505 Ga0451849_1045727 Ga0451849_1045727_404_913 153
397 3300041512 Ga0451853_2315819 Ga0451853_2315819_262_771 153
398 3300042013 Ga0439456_130778 Ga0439456_130778_24_536 153
399 3300044684 Ga0466966_0097617 Ga0466966_0097617_1219_1716 153
400 3300044712 Ga0453684_2036152 Ga0453684_2036152_41_559 153
401 3300045051 Ga0451576_0011502 Ga0451576_0011502_9451_9948 153
402 3300046453 Ga0495627_129887 Ga0495627_129887_151_612 153
403 3300046455 Ga0495603_0042192 Ga0495603_0042192_1802_2311 153
404 3300046455 Ga0495603_0091294 Ga0495603_0091294_634_1143 153
405 3300046457 Ga0495590_0085057 Ga0495590_0085057_266_778 153
406 3300046457 Ga0495590_0137170 Ga0495590_0137170_80_589 153
407 3300046460 Ga0495638_0122956 Ga0495638_0122956_600_1112 153
408 3300046463 Ga0495653_0206391 Ga0495653_0206391_796_1305 153
409 3300046463 Ga0495653_0389697 Ga0495653_0389697_195_704 153
410 3300046472 Ga0495580_0147595 Ga0495580_0147595_106_615 153
411 3300046473 Ga0495582_0014215 Ga0495582_0014215_3468_3977 153
412 3300046473 Ga0495582_0089285 Ga0495582_0089285_655_1164 153
413 3300046473 Ga0495582_0246377 Ga0495582_0246377_88_597 153
414 3300046475 Ga0495639_0124220 Ga0495639_0124220_288_797 153
415 3300046476 Ga0495662_0046426 Ga0495662_0046426_732_1241 153
416 3300046491 Ga0495584_0002062 Ga0495584_0002062_9760_10272 153
417 3300046491 Ga0495584_0015685 Ga0495584_0015685_2712_3221 153
418 3300046491 Ga0495584_0032865 Ga0495584_0032865_208_717 153
419 3300046491 Ga0495584_0285596 Ga0495584_0285596_184_693 153
420 3300046492 Ga0495585_0233178 Ga0495585_0233178_327_836 153
421 3300046499 Ga0495594_0076500 Ga0495594_0076500_609_1118 153
422 3300046501 Ga0495607_0202009 Ga0495607_0202009_23_532 153
423 3300046501 Ga0495607_0266714 Ga0495607_0266714_187_696 153
424 3300046511 Ga0495608_0497921 Ga0495608_0497921_12_521 153
425 3300046512 Ga0495610_0000045 Ga0495610_0000045_42455_42916 153
426 3300046512 Ga0495610_0000329 Ga0495610_0000329_32418_32879 153
427 3300046514 Ga0495618_0093956 Ga0495618_0093956_1343_1852 153
428 3300046515 Ga0495620_0050725 Ga0495620_0050725_158_667 153
429 3300046516 Ga0495628_0512412 Ga0495628_0512412_311_805 153
430 3300046517 Ga0495630_0348054 Ga0495630_0348054_439_948 153
431 3300046519 Ga0495632_0163131 Ga0495632_0163131_327_836 153
432 3300046520 Ga0495637_0047045 Ga0495637_0047045_370_879 153
433 3300046520 Ga0495637_0095504 Ga0495637_0095504_692_1153 153
434 3300046522 Ga0495643_0139047 Ga0495643_0139047_339_848 153
435 3300046523 Ga0495644_0031597 Ga0495644_0031597_507_1016 153
436 3300046525 Ga0495663_0076147 Ga0495663_0076147_410_919 153
437 3300046526 Ga0495666_0033689 Ga0495666_0033689_1083_1592 153
438 3300046526 Ga0495666_0165317 Ga0495666_0165317_136_645 153
439 3300046528 Ga0495642_0148524 Ga0495642_0148524_194_703 153
440 3300046530 Ga0495654_0285459 Ga0495654_0285459_128_637 153
441 3300046531 Ga0495665_0223413 Ga0495665_0223413_288_797 153
442 3300046533 Ga0495640_0128079 Ga0495640_0128079_837_1346 153
443 3300046533 Ga0495640_0198126 Ga0495640_0198126_118_627 153
444 3300046536 Ga0495587_0523851 Ga0495587_0523851_128_625 153
445 3300046537 Ga0495598_0001481 Ga0495598_0001481_3420_3929 153
446 3300046538 Ga0495609_0174608 Ga0495609_0174608_274_783 153
447 3300046559 Ga0495667_0133817 Ga0495667_0133817_862_1371 153
448 3300046615 Ga0495656_0021206 Ga0495656_0021206_903_1412 153
449 3300046615 Ga0495656_0222424 Ga0495656_0222424_362_871 153
450 3300046616 Ga0495668_0073818 Ga0495668_0073818_912_1421 153
451 3300046616 Ga0495668_0140565 Ga0495668_0140565_724_1233 153
452 3300046642 Ga0495634_0196991 Ga0495634_0196991_368_877 153
453 3300046648 Ga0495611_0117487 Ga0495611_0117487_631_1140 153
454 3300046648 Ga0495611_0258636 Ga0495611_0258636_237_749 153
455 3300046660 Ga0495625_0349079 Ga0495625_0349079_393_902 153
456 3300046660 Ga0495625_0821340 Ga0495625_0821340_62_523 153
457 3300046663 Ga0495635_0172509 Ga0495635_0172509_534_1043 153
458 3300046664 Ga0495659_0008153 Ga0495659_0008153_350_859 153
459 3300046664 Ga0495659_0094573 Ga0495659_0094573_107_616 153
460 3300046665 Ga0495661_0112410 Ga0495661_0112410_525_1034 153
461 3300046665 Ga0495661_0421804 Ga0495661_0421804_67_576 153
462 3300046674 Ga0495588_0068735 Ga0495588_0068735_935_1444 153
463 3300046678 Ga0495599_0654510 Ga0495599_0654510_86_580 153
464 3300046681 Ga0495647_0012713 Ga0495647_0012713_1926_2435 153
465 3300046681 Ga0495647_0373535 Ga0495647_0373535_19_528 153
466 3300046683 Ga0495658_0062204 Ga0495658_0062204_222_731 153
467 3300046683 Ga0495658_0176686 Ga0495658_0176686_45_554 153
468 3300046684 Ga0495669_0196503 Ga0495669_0196503_432_941 153
469 3300046684 Ga0495669_0359349 Ga0495669_0359349_117_626 153
470 3300046689 Ga0495613_0133902 Ga0495613_0133902_51_560 153
471 3300046690 Ga0495624_0166688 Ga0495624_0166688_802_1311 153
472 3300046690 Ga0495624_0675924 Ga0495624_0675924_70_579 153
473 3300046691 Ga0495670_0076056 Ga0495670_0076056_389_898 153
474 3300046691 Ga0495670_0663428 Ga0495670_0663428_44_553 153
475 3300046794 Ga0495589_0052863 Ga0495589_0052863_579_1088 153
476 3300046794 Ga0495589_0378976 Ga0495589_0378976_82_591 153
477 3300046810 Ga0495660_0234121 Ga0495660_0234121_224_733 153
478 3300047315 Ga0495581_0508633 Ga0495581_0508633_169_678 153
479 3300047320 Ga0495672_0169930 Ga0495672_0169930_458_967 153
480 3300047321 Ga0495676_0016979 Ga0495676_0016979_2574_3083 153
481 3300047321 Ga0495676_0129890 Ga0495676_0129890_1202_1711 153
482 3300047323 Ga0495683_0090783 Ga0495683_0090783_742_1251 153
483 3300047446 Ga0495679_039302 Ga0495679_039302_404_913 153
484 3300047472 Ga0495686_0337277 Ga0495686_0337277_27_524 153
485 3300047673 Ga0495593_0024050 Ga0495593_0024050_2053_2562 153
486 3300048088 Ga0495602_0670899 Ga0495602_0670899_86_583 153
487 3300048903 Ga0496100_0046625 Ga0496100_0046625_581_1090 153
488 3300048903 Ga0496100_0164529 Ga0496100_0164529_964_1473 153
489 3300048904 Ga0496101_0062581 Ga0496101_0062581_2065_2574 153
490 3300048904 Ga0496101_0110523 Ga0496101_0110523_1128_1637 153
491 3300048904 Ga0496101_0315289 Ga0496101_0315289_200_709 153
492 3300048904 Ga0496101_0520066 Ga0496101_0520066_30_539 153
493 3300048905 Ga0496102_0057096 Ga0496102_0057096_1602_2111 153
494 3300048905 Ga0496102_0083544 Ga0496102_0083544_559_1068 153
495 3300048905 Ga0496102_0105955 Ga0496102_0105955_1488_1997 153
496 3300048905 Ga0496102_0382815 Ga0496102_0382815_55_564 153
497 3300048905 Ga0496102_0505164 Ga0496102_0505164_110_619 153
498 3300048906 Ga0496103_0007060 Ga0496103_0007060_1351_1860 153
499 3300048906 Ga0496103_0039098 Ga0496103_0039098_1442_1951 153
500 3300048906 Ga0496103_0391251 Ga0496103_0391251_11_517 153
501 3300048907 Ga0496104_0001526 Ga0496104_0001526_17247_17756 153
502 3300048907 Ga0496104_0002719 Ga0496104_0002719_4962_5471 153
503 3300048907 Ga0496104_0004554 Ga0496104_0004554_4273_4782 153
504 3300048907 Ga0496104_0055837 Ga0496104_0055837_2474_2983 153
505 3300048908 Ga0496105_0002373 Ga0496105_0002373_13034_13543 153
506 3300048908 Ga0496105_0014281 Ga0496105_0014281_3738_4247 153
507 3300048908 Ga0496105_0022845 Ga0496105_0022845_1073_1582 153
508 3300048908 Ga0496105_0109297 Ga0496105_0109297_440_949 153
509 3300048909 Ga0496106_0150503 Ga0496106_0150503_110_619 153
510 3300048909 Ga0496106_0178550 Ga0496106_0178550_873_1382 153
511 3300048910 Ga0496107_0065105 Ga0496107_0065105_698_1207 153
512 3300048910 Ga0496107_0132177 Ga0496107_0132177_489_998 153
513 3300048910 Ga0496107_0165321 Ga0496107_0165321_609_1118 153
514 3300048910 Ga0496107_0196651 Ga0496107_0196651_746_1255 153
515 3300048910 Ga0496107_0242398 Ga0496107_0242398_638_1135 153
516 3300048911 Ga0496108_0016959 Ga0496108_0016959_1441_1950 153
517 3300048911 Ga0496108_0068969 Ga0496108_0068969_1143_1652 153
518 3300048911 Ga0496108_0164591 Ga0496108_0164591_455_964 153
519 3300048911 Ga0496108_0185262 Ga0496108_0185262_508_1017 153
520 3300048912 Ga0496109_0002911 Ga0496109_0002911_11055_11564 153
521 3300048912 Ga0496109_0037918 Ga0496109_0037918_2315_2824 153
522 3300048912 Ga0496109_0074081 Ga0496109_0074081_1221_1730 153
523 3300048912 Ga0496109_0669253 Ga0496109_0669253_333_842 153
524 3300048912 Ga0496109_1560568 Ga0496109_1560568_41_550 153
525 3300048913 Ga0496110_0012106 Ga0496110_0012106_1896_2405 153
526 3300048913 Ga0496110_0024954 Ga0496110_0024954_489_998 153
527 3300048913 Ga0496110_0287294 Ga0496110_0287294_887_1396 153
528 3300048913 Ga0496110_1283811 Ga0496110_1283811_58_567 153
529 3300048914 Ga0496111_0011310 Ga0496111_0011310_4984_5493 153
530 3300048914 Ga0496111_0098104 Ga0496111_0098104_605_1114 153
531 3300048914 Ga0496111_0576818 Ga0496111_0576818_138_647 153
532 3300048915 Ga0496112_0019868 Ga0496112_0019868_3559_4068 153
533 3300048915 Ga0496112_0025277 Ga0496112_0025277_1896_2405 153
534 3300048915 Ga0496112_0402896 Ga0496112_0402896_413_922 153
535 3300048915 Ga0496112_1032652 Ga0496112_1032652_97_606 153
536 3300048916 Ga0496113_0000438 Ga0496113_0000438_14514_15023 153
537 3300048916 Ga0496113_0202073 Ga0496113_0202073_150_659 153
538 3300048916 Ga0496113_0293813 Ga0496113_0293813_109_618 153
539 3300048916 Ga0496113_0904046 Ga0496113_0904046_28_537 153
540 3300048917 Ga0496114_0013133 Ga0496114_0013133_1956_2465 153
541 3300048917 Ga0496114_0073769 Ga0496114_0073769_988_1497 153
542 3300048917 Ga0496114_0094034 Ga0496114_0094034_1105_1614 153
543 3300048918 Ga0496115_0055603 Ga0496115_0055603_2356_2865 153
544 3300048918 Ga0496115_0074877 Ga0496115_0074877_1955_2464 153
545 3300048918 Ga0496115_0108138 Ga0496115_0108138_719_1228 153
546 3300048918 Ga0496115_0198868 Ga0496115_0198868_1097_1606 153
547 3300048918 Ga0496115_0306727 Ga0496115_0306727_735_1244 153
548 3300048918 Ga0496115_0481436 Ga0496115_0481436_466_963 153
549 3300048924 Ga0496121_0003431 Ga0496121_0003431_10800_11297 153
550 3300048925 Ga0496122_0001629 Ga0496122_0001629_1738_2199 153
551 3300048926 Ga0496123_0000906 Ga0496123_0000906_44087_44548 153
552 3300048927 Ga0496124_0690235 Ga0496124_0690235_54_548 153
553 3300048928 Ga0496125_0206798 Ga0496125_0206798_801_1262 153
554 3300048929 Ga0496126_0016480 Ga0496126_0016480_1661_2158 153
555 3300048929 Ga0496126_0190763 Ga0496126_0190763_332_829 153
556 3300049568 Ga0501031_0003015 Ga0501031_0003015_805_1326 153
557 3300049569 Ga0501032_0247253 Ga0501032_0247253_356_877 153
558 3300049570 Ga0501033_0083990 Ga0501033_0083990_1534_2055 153
559 3300049571 Ga0501034_0156136 Ga0501034_0156136_834_1355 153
560 3300049571 Ga0501034_0322581 Ga0501034_0322581_363_872 153
561 3300049572 Ga0501036_0130895 Ga0501036_0130895_885_1406 153
562 3300049574 Ga0501038_0291082 Ga0501038_0291082_262_783 153
563 3300049576 Ga0501040_0742395 Ga0501040_0742395_172_681 153
564 3300049577 Ga0501041_0279235 Ga0501041_0279235_131_640 153
565 3300049577 Ga0501041_0356381 Ga0501041_0356381_391_876 153
566 3300049579 Ga0501043_0512928 Ga0501043_0512928_286_807 153
567 3300049579 Ga0501043_1018177 Ga0501043_1018177_52_561 153
568 3300049581 Ga0501047_0210018 Ga0501047_0210018_822_1325 153
569 3300049582 Ga0501048_0654025 Ga0501048_0654025_92_601 153
570 3300049584 Ga0501068_0090545 Ga0501068_0090545_1310_1819 153
571 3300049585 Ga0501069_0275280 Ga0501069_0275280_200_709 153
572 3300049586 Ga0501070_0086786 Ga0501070_0086786_1847_2356 153
573 3300049586 Ga0501070_0449854 Ga0501070_0449854_333_854 153
574 3300049586 Ga0501070_0863275 Ga0501070_0863275_22_531 153
575 3300049588 Ga0501072_0211276 Ga0501072_0211276_967_1476 153
576 3300049590 Ga0501074_0353724 Ga0501074_0353724_329_838 153
577 3300049590 Ga0501074_0741965 Ga0501074_0741965_118_627 153
578 3300049590 Ga0501074_0805200 Ga0501074_0805200_16_525 153
579 3300049591 Ga0501075_0134980 Ga0501075_0134980_1229_1738 153
580 3300049591 Ga0501075_0198855 Ga0501075_0198855_354_839 153
581 3300049592 Ga0501076_0200435 Ga0501076_0200435_41_550 153
582 3300049592 Ga0501076_0315405 Ga0501076_0315405_146_631 153
583 3300049592 Ga0501076_0422270 Ga0501076_0422270_483_992 153
584 3300049593 Ga0501077_0027098 Ga0501077_0027098_2887_3396 153
585 3300049682 Ga0501252_016884 Ga0501252_016884_46_549 153
586 3300049741 Ga0501079_0086393 Ga0501079_0086393_1895_2404 153
587 3300049741 Ga0501079_0812376 Ga0501079_0812376_143_652 153
588 3300049742 Ga0501080_0102658 Ga0501080_0102658_1829_2338 153
589 3300049742 Ga0501080_0605314 Ga0501080_0605314_220_729 153
590 3300049742 Ga0501080_1403791 Ga0501080_1403791_69_578 153
591 3300049743 Ga0501081_0183731 Ga0501081_0183731_945_1454 153
592 3300049743 Ga0501081_0517738 Ga0501081_0517738_236_745 153
593 3300049758 Ga0501241_003227 Ga0501241_003227_1607_2068 153
594 3300049822 Ga0501035_0225766 Ga0501035_0225766_452_973 153
595 3300049823 Ga0501044_0261350 Ga0501044_0261350_268_771 153
596 3300049824 Ga0501045_0109882 Ga0501045_0109882_1180_1689 153
597 3300050492 nmdc:mga0yw44_276465_c1 nmdc:mga0yw44_276465_c1_443_952 153
598 3300050492 nmdc:mga0yw44_312690_c1 nmdc:mga0yw44_312690_c1_326_835 153
599 3300050492 nmdc:mga0yw44_34166_c1 nmdc:mga0yw44_34166_c1_2375_2884 153
600 3300050492 nmdc:mga0yw44_626643_c1 nmdc:mga0yw44_626643_c1_16_525 153
601 3300050492 nmdc:mga0yw44_87583_c1 nmdc:mga0yw44_87583_c1_95_604 153
602 3300050495 nmdc:mga04h51_291439_c1 nmdc:mga04h51_291439_c1_73_582 153
603 3300050507 nmdc:mga05p37_108351_c1 nmdc:mga05p37_108351_c1_2637_3143 153
604 3300050507 nmdc:mga05p37_199748_c1 nmdc:mga05p37_199748_c1_660_1169 153
605 3300050507 nmdc:mga05p37_34403_c1 nmdc:mga05p37_34403_c1_3371_3880 153
606 3300050507 nmdc:mga05p37_367150_c1 nmdc:mga05p37_367150_c1_915_1424 153
607 3300050507 nmdc:mga05p37_4993_c1 nmdc:mga05p37_4993_c1_3927_4436 153
608 3300050508 nmdc:mga09592_44194_c1 nmdc:mga09592_44194_c1_2741_3247 153
609 3300050508 nmdc:mga09592_52542_c1 nmdc:mga09592_52542_c1_1301_1810 153
610 3300050509 nmdc:mga0qj67_212097_c1 nmdc:mga0qj67_212097_c1_1001_1510 153
611 3300050509 nmdc:mga0qj67_83_c1 nmdc:mga0qj67_83_c1_20960_21466 153
612 3300050510 nmdc:mga06r32_1272653_c1 nmdc:mga06r32_1272653_c1_137_643 153
613 3300050510 nmdc:mga06r32_25066_c1 nmdc:mga06r32_25066_c1_953_1462 153
614 3300050510 nmdc:mga06r32_259924_c1 nmdc:mga06r32_259924_c1_661_1170 153
615 3300050510 nmdc:mga06r32_362432_c1 nmdc:mga06r32_362432_c1_261_758 153
616 3300050511 nmdc:mga08y16_1137082_c1 nmdc:mga08y16_1137082_c1_116_625 153
617 3300050511 nmdc:mga08y16_142421_c1 nmdc:mga08y16_142421_c1_193_702 153
618 3300050512 nmdc:mga0n895_141084_c1 nmdc:mga0n895_141084_c1_349_858 153
619 3300050512 nmdc:mga0n895_236465_c1 nmdc:mga0n895_236465_c1_1204_1713 153
620 3300050512 nmdc:mga0n895_623985_c1 nmdc:mga0n895_623985_c1_37_546 153
621 3300050512 nmdc:mga0n895_70025_c1 nmdc:mga0n895_70025_c1_2807_3316 153
622 3300050512 nmdc:mga0n895_76758_c1 nmdc:mga0n895_76758_c1_2487_2996 153
623 3300050513 nmdc:mga0rr50_182233_c1 nmdc:mga0rr50_182233_c1_1151_1660 153
624 3300050513 nmdc:mga0rr50_231994_c1 nmdc:mga0rr50_231994_c1_271_780 153
625 3300050515 nmdc:mga0a205_127324_c1 nmdc:mga0a205_127324_c1_1152_1661 153
626 3300050515 nmdc:mga0a205_59177_c1 nmdc:mga0a205_59177_c1_1113_1622 153
627 3300053077 Ga0495601_0091840 Ga0495601_0091840_859_1368 153
628 3300053077 Ga0495601_0100294 Ga0495601_0100294_903_1397 153
629 3300053077 Ga0495601_0216083 Ga0495601_0216083_250_759 153
630 3300053078 Ga0495612_0137262 Ga0495612_0137262_230_739 153
631 3300053083 Ga0495655_0004837 Ga0495655_0004837_796_1305 153
632 3300053084 Ga0495595_0115426 Ga0495595_0115426_337_846 153
633 3300053085 Ga0495619_0670344 Ga0495619_0670344_20_529 153
634 3300053093 Ga0500651_0000207 Ga0500651_0000207_6047_6508 153
635 3300053096 Ga0500641_0189197 Ga0500641_0189197_140_649 153
636 3300053153 Ga0500616_0143260 Ga0500616_0143260_372_872 153
637 3300054114 Ga0501084_0174742 Ga0501084_0174742_1063_1563 153
638 3300054114 Ga0501084_0375844 Ga0501084_0375844_122_631 153
639 3300060353 Ga0501082_0057982 Ga0501082_0057982_2784_3293 153
640 3300060353 Ga0501082_0632172 Ga0501082_0632172_64_573 153
641 3300061734 Ga0530510_0404773 Ga0530510_0404773_302_811 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

35

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9676 2 146
1qjc-assembly1.cif.gz_B phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine 0.9636 2 147
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9636 2 146
4f3r-assembly3.cif.gz_C structure of phosphopantetheine adenylyltransferase (cbu_0288) from coxiella burnetii 0.9609 1 152
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9609 2 146
ID Description Score Start End Superfamily
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9688 1 152 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9518 2 153 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9492 1 152 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.946 1 148 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9384 1 149 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A520CJY5-F1-model_v4 Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) 0.991 1 136 GO:0004595
GO:0005737
GO:0015937
AF-A0A4R3KTT7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9896 2 151 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2A5FK01-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9882 1 153 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7C1DZP1-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9878 2 146 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7C7FMZ9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.987 2 148 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
94.28 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map