F471769
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 641 | 383 | 620 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300006042|Ga0075368_10031945|Ga0075368_100319454 |
| Length | 198 |
| Sequence | MSPQAVGAPGAWPSYGPCGGSGRALDPRSMPRTALFPGSFDPVTNGHLDLVRQAGRLADRLVLAIGTHPGKTPLFSVEERRDMIEETCSPVMRASGIDFACITFSDLVVAAAQREGATLLIRGLRSATDFDYEMEMAGMNGAMAPAVQTVFLPASPIIRPITATLVRQIASMGGDVSQFVPSSVAARLKAKFAGKAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 6 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 7 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 8 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 9 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 13 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 14 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 15 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 16 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 17 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 18 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 19 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 20 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 21 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 22 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 23 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 24 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 25 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 219 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 249 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 365 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 379 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.72 |
| Metatranscriptomes | 0 |
| Isolates | 3.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.37 |
| Nodule | 0 |
| Rhizoplane | 9.83 |
| Rhizosphere | 81.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2896220 | 2162886007 | Bacteria | 1878 |
| 2 | SwRhRL2b_contig_475676 | 2162886007 | Bacteria | 8397 |
| 3 | JGI24746J21847_1032408 | 3300001977 | Bacteria | 721 |
| 4 | JGI24737J22298_10108803 | 3300001990 | Bacteria | 821 |
| 5 | JGI24743J22301_10071135 | 3300001991 | Bacteria | 726 |
| 6 | JGI24748J21848_1014993 | 3300002074 | Bacteria | 921 |
| 7 | JGI24738J21930_10015935 | 3300002075 | Bacteria | 1594 |
| 8 | JGI24744J21845_10058966 | 3300002077 | Bacteria | 703 |
| 9 | JGI25152J39213_1000476 | 3300002773 | Bacteria | 23167 |
| 10 | JGI25150J39212_1000002 | 3300002774 | Bacteria | 537631 |
| 11 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 12 | JGI25153J46596_10000003 | 3300003215 | Bacteria | 553253 |
| 13 | rootH1_10239678 | 3300003323 | Bacteria | 1852 |
| 14 | Ga0055536_1000049 | 3300003781 | Bacteria | 113328 |
| 15 | Ga0055530_10002714 | 3300003791 | Bacteria | 10996 |
| 16 | Ga0065714_10002298 | 3300005288 | Bacteria | 48008 |
| 17 | Ga0065714_10002621 | 3300005288 | Bacteria | 31326 |
| 18 | Ga0065714_10014983 | 3300005288 | Bacteria | 2330 |
| 19 | Ga0065714_10065634 | 3300005288 | Bacteria | 9088 |
| 20 | Ga0065714_10071503 | 3300005288 | Bacteria | 3561 |
| 21 | Ga0065714_10084878 | 3300005288 | Bacteria | 2175 |
| 22 | Ga0065714_10300924 | 3300005288 | Bacteria | 690 |
| 23 | Ga0065704_10000205 | 3300005289 | Bacteria | 128899 |
| 24 | Ga0065704_10001103 | 3300005289 | Bacteria | 14777 |
| 25 | Ga0065704_10350957 | 3300005289 | Bacteria | 810 |
| 26 | Ga0070676_10021108 | 3300005328 | Bacteria | 3644 |
| 27 | Ga0070683_100174484 | 3300005329 | Bacteria | 2041 |
| 28 | Ga0070683_101252790 | 3300005329 | Bacteria | 713 |
| 29 | Ga0070690_100465800 | 3300005330 | Bacteria | 940 |
| 30 | Ga0070680_100160460 | 3300005336 | Bacteria | 1889 |
| 31 | Ga0070680_100511318 | 3300005336 | Bacteria | 1028 |
| 32 | Ga0070682_101047603 | 3300005337 | Bacteria | 680 |
| 33 | Ga0070660_100130664 | 3300005339 | Bacteria | 2009 |
| 34 | Ga0070689_100170832 | 3300005340 | Bacteria | 1761 |
| 35 | Ga0070687_100137403 | 3300005343 | Bacteria | 1419 |
| 36 | Ga0070661_100361993 | 3300005344 | Bacteria | 1140 |
| 37 | Ga0070692_10031592 | 3300005345 | Bacteria | 2655 |
| 38 | Ga0070675_100144519 | 3300005354 | Bacteria | 2035 |
| 39 | Ga0070671_101154736 | 3300005355 | Bacteria | 681 |
| 40 | Ga0070674_100742796 | 3300005356 | Bacteria | 842 |
| 41 | Ga0070673_100174646 | 3300005364 | Bacteria | 1836 |
| 42 | Ga0070688_100098941 | 3300005365 | Bacteria | 1920 |
| 43 | Ga0070659_100171213 | 3300005366 | Bacteria | 1779 |
| 44 | Ga0070659_100250940 | 3300005366 | Bacteria | 1466 |
| 45 | Ga0070709_10010442 | 3300005434 | Bacteria | 5146 |
| 46 | Ga0070709_11195096 | 3300005434 | Bacteria | 611 |
| 47 | Ga0070714_100014088 | 3300005435 | Bacteria | 6417 |
| 48 | Ga0070714_100169370 | 3300005435 | Bacteria | 1981 |
| 49 | Ga0070713_100019862 | 3300005436 | Bacteria | 5143 |
| 50 | Ga0070713_100146522 | 3300005436 | Bacteria | 2096 |
| 51 | Ga0070713_101484081 | 3300005436 | Bacteria | 658 |
| 52 | Ga0070710_10004638 | 3300005437 | Bacteria | 6500 |
| 53 | Ga0070711_100103337 | 3300005439 | Bacteria | 2076 |
| 54 | Ga0070711_100252837 | 3300005439 | Bacteria | 1383 |
| 55 | Ga0070705_101002554 | 3300005440 | Bacteria | 678 |
| 56 | Ga0070700_100063622 | 3300005441 | Bacteria | 2334 |
| 57 | Ga0070708_100472124 | 3300005445 | Bacteria | 1183 |
| 58 | Ga0070662_100573661 | 3300005457 | Bacteria | 947 |
| 59 | Ga0068867_100373779 | 3300005459 | Bacteria | 1195 |
| 60 | Ga0070707_100504733 | 3300005468 | Bacteria | 1171 |
| 61 | Ga0070707_100532588 | 3300005468 | Bacteria | 1137 |
| 62 | Ga0070707_101619042 | 3300005468 | Bacteria | 614 |
| 63 | Ga0070707_101715756 | 3300005468 | Bacteria | 595 |
| 64 | Ga0070698_100901080 | 3300005471 | Bacteria | 830 |
| 65 | Ga0070698_101609910 | 3300005471 | Bacteria | 601 |
| 66 | Ga0070699_100006185 | 3300005518 | Bacteria | 10461 |
| 67 | Ga0070699_100245715 | 3300005518 | Bacteria | 1598 |
| 68 | Ga0070699_100269752 | 3300005518 | Bacteria | 1523 |
| 69 | Ga0070679_100297936 | 3300005530 | Bacteria | 1563 |
| 70 | Ga0070684_100079215 | 3300005535 | Bacteria | 2904 |
| 71 | Ga0070697_101130273 | 3300005536 | Bacteria | 697 |
| 72 | Ga0068853_100902600 | 3300005539 | Bacteria | 849 |
| 73 | Ga0070672_100086675 | 3300005543 | Bacteria | 2519 |
| 74 | Ga0070695_100431358 | 3300005545 | Bacteria | 1006 |
| 75 | Ga0070696_100552426 | 3300005546 | Bacteria | 923 |
| 76 | Ga0070704_100911846 | 3300005549 | Bacteria | 791 |
| 77 | Ga0068855_101035675 | 3300005563 | Bacteria | 861 |
| 78 | Ga0068855_101290013 | 3300005563 | Bacteria | 756 |
| 79 | Ga0070664_100162359 | 3300005564 | Bacteria | 1977 |
| 80 | Ga0068857_100213576 | 3300005577 | Bacteria | 1761 |
| 81 | Ga0068854_100160911 | 3300005578 | Bacteria | 1738 |
| 82 | Ga0068856_100364760 | 3300005614 | Bacteria | 1463 |
| 83 | Ga0070702_100134722 | 3300005615 | Bacteria | 1565 |
| 84 | Ga0070702_100842093 | 3300005615 | Bacteria | 713 |
| 85 | Ga0068852_100209977 | 3300005616 | Bacteria | 1846 |
| 86 | Ga0068864_100061026 | 3300005618 | Bacteria | 3265 |
| 87 | Ga0068864_100379031 | 3300005618 | Bacteria | 1340 |
| 88 | Ga0068866_10194047 | 3300005718 | Bacteria | 1208 |
| 89 | Ga0068861_100225431 | 3300005719 | Bacteria | 1586 |
| 90 | Ga0068851_10086495 | 3300005834 | Bacteria | 1645 |
| 91 | Ga0068870_10013225 | 3300005840 | Bacteria | 3874 |
| 92 | Ga0068863_100189614 | 3300005841 | Bacteria | 1975 |
| 93 | Ga0068860_100178848 | 3300005843 | Bacteria | 2050 |
| 94 | Ga0068862_100007625 | 3300005844 | Bacteria | 8962 |
| 95 | Ga0068862_100421900 | 3300005844 | Bacteria | 1252 |
| 96 | Ga0081455_10001555 | 3300005937 | Bacteria | 28179 |
| 97 | Ga0081455_10012680 | 3300005937 | Bacteria | 8389 |
| 98 | Ga0081455_10025015 | 3300005937 | Bacteria | 5517 |
| 99 | Ga0081455_10060912 | 3300005937 | Bacteria | 3179 |
| 100 | Ga0081455_10061060 | 3300005937 | Bacteria | 3174 |
| 101 | Ga0081455_10095813 | 3300005937 | Bacteria | 2395 |
| 102 | Ga0081455_10202434 | 3300005937 | Bacteria | 1486 |
| 103 | Ga0081538_10107822 | 3300005981 | Bacteria | 1378 |
| 104 | Ga0081540_1016285 | 3300005983 | Bacteria | 4659 |
| 105 | Ga0070717_10029383 | 3300006028 | Bacteria | 4409 |
| 106 | Ga0070717_10269715 | 3300006028 | Bacteria | 1507 |
| 107 | Ga0070717_10517777 | 3300006028 | Bacteria | 1079 |
| 108 | Ga0070717_11137417 | 3300006028 | Bacteria | 711 |
| 109 | Ga0075365_10033139 | 3300006038 | Bacteria | 3326 |
| 110 | Ga0075365_10137905 | 3300006038 | Bacteria | 1692 |
| 111 | Ga0075365_10304602 | 3300006038 | Bacteria | 1122 |
| 112 | Ga0075368_10031945 | 3300006042 | Bacteria | 2043 |
| 113 | Ga0075363_100637202 | 3300006048 | Bacteria | 641 |
| 114 | Ga0075432_10209363 | 3300006058 | Bacteria | 775 |
| 115 | Ga0070715_10298585 | 3300006163 | Bacteria | 861 |
| 116 | Ga0070716_100016175 | 3300006173 | Bacteria | 3845 |
| 117 | Ga0070712_100013815 | 3300006175 | Bacteria | 5167 |
| 118 | Ga0070712_100326830 | 3300006175 | Bacteria | 1248 |
| 119 | Ga0070712_100452068 | 3300006175 | Bacteria | 1070 |
| 120 | Ga0075362_10302297 | 3300006177 | Bacteria | 794 |
| 121 | Ga0075367_10035549 | 3300006178 | Bacteria | 2884 |
| 122 | Ga0075428_100017448 | 3300006844 | Bacteria | 7933 |
| 123 | Ga0075428_100143569 | 3300006844 | Bacteria | 2595 |
| 124 | Ga0075428_100196014 | 3300006844 | Bacteria | 2184 |
| 125 | Ga0075428_100401471 | 3300006844 | Bacteria | 1469 |
| 126 | Ga0075428_101042930 | 3300006844 | Bacteria | 865 |
| 127 | Ga0075428_101063293 | 3300006844 | Bacteria | 855 |
| 128 | Ga0075430_100000184 | 3300006846 | Bacteria | 41914 |
| 129 | Ga0075430_100923747 | 3300006846 | Bacteria | 719 |
| 130 | Ga0075431_100103927 | 3300006847 | Bacteria | 2932 |
| 131 | Ga0075431_100187319 | 3300006847 | Bacteria | 2122 |
| 132 | Ga0075431_101210136 | 3300006847 | Bacteria | 718 |
| 133 | Ga0075433_10050636 | 3300006852 | Bacteria | 3616 |
| 134 | Ga0075433_10055747 | 3300006852 | Bacteria | 3451 |
| 135 | Ga0075434_100020000 | 3300006871 | Bacteria | 6484 |
| 136 | Ga0075434_100132361 | 3300006871 | Bacteria | 2513 |
| 137 | Ga0075434_100176021 | 3300006871 | Bacteria | 2159 |
| 138 | Ga0075429_100034844 | 3300006880 | Bacteria | 4375 |
| 139 | Ga0075429_100993055 | 3300006880 | Bacteria | 734 |
| 140 | Ga0075435_100083356 | 3300007076 | Bacteria | 2629 |
| 141 | Ga0099794_10013261 | 3300007265 | Bacteria | 3583 |
| 142 | Ga0099795_10086914 | 3300007788 | Bacteria | 1206 |
| 143 | Ga0105251_10204700 | 3300009011 | Bacteria | 889 |
| 144 | Ga0105244_10051568 | 3300009036 | Bacteria | 2096 |
| 145 | Ga0111539_10078004 | 3300009094 | Bacteria | 3898 |
| 146 | Ga0105245_10338237 | 3300009098 | Bacteria | 1488 |
| 147 | Ga0105247_10025486 | 3300009101 | Bacteria | 3568 |
| 148 | Ga0105247_10145370 | 3300009101 | Bacteria | 1558 |
| 149 | Ga0105247_10512028 | 3300009101 | Bacteria | 876 |
| 150 | Ga0114129_10004024 | 3300009147 | Bacteria | 20739 |
| 151 | Ga0114129_10023533 | 3300009147 | Bacteria | 8731 |
| 152 | Ga0114129_10041836 | 3300009147 | Bacteria | 6452 |
| 153 | Ga0114129_10072366 | 3300009147 | Bacteria | 4806 |
| 154 | Ga0114129_10161736 | 3300009147 | Bacteria | 3058 |
| 155 | Ga0114129_10362630 | 3300009147 | Bacteria | 1917 |
| 156 | Ga0114129_10377185 | 3300009147 | Bacteria | 1874 |
| 157 | Ga0114129_10653912 | 3300009147 | Bacteria | 1356 |
| 158 | Ga0114129_10658940 | 3300009147 | Bacteria | 1350 |
| 159 | Ga0114129_11039890 | 3300009147 | Bacteria | 1029 |
| 160 | Ga0105243_10472442 | 3300009148 | Bacteria | 1182 |
| 161 | Ga0105242_10461666 | 3300009176 | Bacteria | 1199 |
| 162 | Ga0105248_10065217 | 3300009177 | Bacteria | 4089 |
| 163 | Ga0105237_10004270 | 3300009545 | Bacteria | 16609 |
| 164 | Ga0105237_10163664 | 3300009545 | Bacteria | 2223 |
| 165 | Ga0105249_10108519 | 3300009553 | Bacteria | 2620 |
| 166 | Ga0099796_10001225 | 3300010159 | Bacteria | 5014 |
| 167 | Ga0099796_10123492 | 3300010159 | Bacteria | 997 |
| 168 | Ga0105239_11778771 | 3300010375 | Bacteria | 714 |
| 169 | Ga0105246_10402342 | 3300011119 | Bacteria | 1137 |
| 170 | Ga0157373_10000974 | 3300013100 | Bacteria | 22189 |
| 171 | Ga0157373_10006199 | 3300013100 | Bacteria | 8934 |
| 172 | Ga0157373_10087836 | 3300013100 | Bacteria | 2190 |
| 173 | Ga0157371_10000119 | 3300013102 | Bacteria | 120350 |
| 174 | Ga0157371_10010487 | 3300013102 | Bacteria | 7211 |
| 175 | Ga0157370_10004633 | 3300013104 | Bacteria | 15727 |
| 176 | Ga0157370_10014232 | 3300013104 | Bacteria | 8150 |
| 177 | Ga0157370_10051173 | 3300013104 | Bacteria | 3946 |
| 178 | Ga0157370_10056450 | 3300013104 | Bacteria | 3738 |
| 179 | Ga0157370_10086094 | 3300013104 | Bacteria | 2952 |
| 180 | Ga0157370_10091869 | 3300013104 | Bacteria | 2849 |
| 181 | Ga0157370_10164106 | 3300013104 | Bacteria | 2067 |
| 182 | Ga0157370_10260512 | 3300013104 | Bacteria | 1603 |
| 183 | Ga0157370_10802574 | 3300013104 | Bacteria | 856 |
| 184 | Ga0157369_10000015 | 3300013105 | Bacteria | 262917 |
| 185 | Ga0157374_10012482 | 3300013296 | Bacteria | 7394 |
| 186 | Ga0157378_10642804 | 3300013297 | Bacteria | 1076 |
| 187 | Ga0163162_10000520 | 3300013306 | Bacteria | 35697 |
| 188 | Ga0163162_10172620 | 3300013306 | Bacteria | 2287 |
| 189 | Ga0163162_10299233 | 3300013306 | Bacteria | 1741 |
| 190 | Ga0157372_10074067 | 3300013307 | Bacteria | 3839 |
| 191 | Ga0157372_10443615 | 3300013307 | Bacteria | 1513 |
| 192 | Ga0157375_10436731 | 3300013308 | Bacteria | 1475 |
| 193 | Ga0163163_10015050 | 3300014325 | Bacteria | 7135 |
| 194 | Ga0163163_11938078 | 3300014325 | Bacteria | 649 |
| 195 | Ga0157380_10130964 | 3300014326 | Bacteria | 2140 |
| 196 | Ga0182008_10000069 | 3300014497 | Bacteria | 82281 |
| 197 | Ga0182008_10000247 | 3300014497 | Bacteria | 41952 |
| 198 | Ga0182008_10001023 | 3300014497 | Bacteria | 19412 |
| 199 | Ga0182008_10011758 | 3300014497 | Bacteria | 4645 |
| 200 | Ga0182008_10017588 | 3300014497 | Bacteria | 3708 |
| 201 | Ga0182008_10043944 | 3300014497 | Bacteria | 2223 |
| 202 | Ga0182008_10121860 | 3300014497 | Unclassified | 1296 |
| 203 | Ga0182008_10332552 | 3300014497 | Bacteria | 802 |
| 204 | Ga0157377_10102849 | 3300014745 | Bacteria | 1705 |
| 205 | Ga0157379_10574214 | 3300014968 | Bacteria | 1051 |
| 206 | Ga0157376_10528137 | 3300014969 | Bacteria | 1164 |
| 207 | Ga0157376_10917396 | 3300014969 | Bacteria | 895 |
| 208 | Ga0157376_11165800 | 3300014969 | Bacteria | 798 |
| 209 | Ga0182006_1000091 | 3300015261 | Bacteria | 109227 |
| 210 | Ga0182006_1000210 | 3300015261 | Bacteria | 57485 |
| 211 | Ga0182006_1000352 | 3300015261 | Bacteria | 38650 |
| 212 | Ga0182006_1009379 | 3300015261 | Bacteria | 4387 |
| 213 | Ga0182007_10000010 | 3300015262 | Bacteria | 286070 |
| 214 | Ga0182007_10013273 | 3300015262 | Bacteria | 3147 |
| 215 | Ga0182007_10045068 | 3300015262 | Bacteria | 1462 |
| 216 | Ga0183373_1005 | 3300015682 | Bacteria | 351562 |
| 217 | Ga0163161_10000046 | 3300017792 | Bacteria | 127211 |
| 218 | Ga0163161_10001264 | 3300017792 | Bacteria | 18909 |
| 219 | Ga0163161_10003880 | 3300017792 | Bacteria | 10485 |
| 220 | Ga0163161_10019645 | 3300017792 | Bacteria | 4739 |
| 221 | Ga0163161_11411151 | 3300017792 | Bacteria | 608 |
| 222 | Ga0213872_10302829 | 3300021361 | Bacteria | 663 |
| 223 | Ga0213871_10125562 | 3300021441 | Bacteria | 767 |
| 224 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 225 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 226 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 227 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 228 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 229 | Ga0209050_1000258 | 3300025298 | Bacteria | 113741 |
| 230 | Ga0207692_10074367 | 3300025898 | Bacteria | 1800 |
| 231 | Ga0207710_10072226 | 3300025900 | Bacteria | 1584 |
| 232 | Ga0207710_10156515 | 3300025900 | Bacteria | 1108 |
| 233 | Ga0207688_10001906 | 3300025901 | Bacteria | 11175 |
| 234 | Ga0207680_10347213 | 3300025903 | Bacteria | 1042 |
| 235 | Ga0207647_10199996 | 3300025904 | Bacteria | 1156 |
| 236 | Ga0207685_10227796 | 3300025905 | Bacteria | 890 |
| 237 | Ga0207685_10237167 | 3300025905 | Bacteria | 876 |
| 238 | Ga0207699_10003624 | 3300025906 | Bacteria | 7382 |
| 239 | Ga0207699_10299183 | 3300025906 | Bacteria | 1123 |
| 240 | Ga0207645_10029712 | 3300025907 | Bacteria | 3522 |
| 241 | Ga0207643_10002034 | 3300025908 | Bacteria | 11165 |
| 242 | Ga0207705_10110720 | 3300025909 | Bacteria | 2028 |
| 243 | Ga0207705_10297948 | 3300025909 | Bacteria | 1236 |
| 244 | Ga0207684_10108001 | 3300025910 | Bacteria | 2381 |
| 245 | Ga0207684_11192284 | 3300025910 | Bacteria | 631 |
| 246 | Ga0207707_10087991 | 3300025912 | Bacteria | 2713 |
| 247 | Ga0207707_11205253 | 3300025912 | Bacteria | 612 |
| 248 | Ga0207671_10145482 | 3300025914 | Bacteria | 1828 |
| 249 | Ga0207693_10013984 | 3300025915 | Bacteria | 6463 |
| 250 | Ga0207693_10021233 | 3300025915 | Bacteria | 5161 |
| 251 | Ga0207693_10066064 | 3300025915 | Bacteria | 2832 |
| 252 | Ga0207663_10047518 | 3300025916 | Bacteria | 2650 |
| 253 | Ga0207663_10072514 | 3300025916 | Bacteria | 2226 |
| 254 | Ga0207663_10140946 | 3300025916 | Bacteria | 1679 |
| 255 | Ga0207660_10399160 | 3300025917 | Bacteria | 1107 |
| 256 | Ga0207662_10061769 | 3300025918 | Bacteria | 2250 |
| 257 | Ga0207657_10092785 | 3300025919 | Bacteria | 2516 |
| 258 | Ga0207649_10110308 | 3300025920 | Bacteria | 1837 |
| 259 | Ga0207649_10444832 | 3300025920 | Bacteria | 977 |
| 260 | Ga0207649_10521698 | 3300025920 | Bacteria | 906 |
| 261 | Ga0207652_10633181 | 3300025921 | Bacteria | 957 |
| 262 | Ga0207646_10449344 | 3300025922 | Bacteria | 1163 |
| 263 | Ga0207659_10116163 | 3300025926 | Bacteria | 2042 |
| 264 | Ga0207700_10045730 | 3300025928 | Bacteria | 3232 |
| 265 | Ga0207700_10301304 | 3300025928 | Bacteria | 1384 |
| 266 | Ga0207664_10201131 | 3300025929 | Bacteria | 1719 |
| 267 | Ga0207664_11629177 | 3300025929 | Bacteria | 567 |
| 268 | Ga0207644_10710694 | 3300025931 | Bacteria | 838 |
| 269 | Ga0207644_11219885 | 3300025931 | Bacteria | 632 |
| 270 | Ga0207706_10001779 | 3300025933 | Bacteria | 21159 |
| 271 | Ga0207706_10585015 | 3300025933 | Bacteria | 960 |
| 272 | Ga0207709_11214219 | 3300025935 | Bacteria | 622 |
| 273 | Ga0207670_10188449 | 3300025936 | Bacteria | 1559 |
| 274 | Ga0207704_10052470 | 3300025938 | Bacteria | 2472 |
| 275 | Ga0207665_10003101 | 3300025939 | Bacteria | 11152 |
| 276 | Ga0207665_10032249 | 3300025939 | Bacteria | 3469 |
| 277 | Ga0207691_10014229 | 3300025940 | Bacteria | 7589 |
| 278 | Ga0207689_10024325 | 3300025942 | Bacteria | 5083 |
| 279 | Ga0207689_10571077 | 3300025942 | Bacteria | 950 |
| 280 | Ga0207661_10745007 | 3300025944 | Bacteria | 902 |
| 281 | Ga0207667_10290196 | 3300025949 | Bacteria | 1671 |
| 282 | Ga0207667_10848154 | 3300025949 | Bacteria | 908 |
| 283 | Ga0207651_10089023 | 3300025960 | Bacteria | 2252 |
| 284 | Ga0207712_10028233 | 3300025961 | Bacteria | 3751 |
| 285 | Ga0207668_10334791 | 3300025972 | Bacteria | 1260 |
| 286 | Ga0207668_10519713 | 3300025972 | Bacteria | 1027 |
| 287 | Ga0207640_10115254 | 3300025981 | Bacteria | 1913 |
| 288 | Ga0207658_10534794 | 3300025986 | Bacteria | 1047 |
| 289 | Ga0207677_10159831 | 3300026023 | Bacteria | 1749 |
| 290 | Ga0207677_10682519 | 3300026023 | Bacteria | 910 |
| 291 | Ga0207703_10092926 | 3300026035 | Bacteria | 2540 |
| 292 | Ga0207639_11055527 | 3300026041 | Bacteria | 761 |
| 293 | Ga0207678_10004671 | 3300026067 | Bacteria | 12299 |
| 294 | Ga0207678_10207359 | 3300026067 | Bacteria | 1677 |
| 295 | Ga0207708_10001428 | 3300026075 | Bacteria | 17910 |
| 296 | Ga0207702_11196580 | 3300026078 | Bacteria | 754 |
| 297 | Ga0207641_10161728 | 3300026088 | Bacteria | 2036 |
| 298 | Ga0207648_10023316 | 3300026089 | Bacteria | 5547 |
| 299 | Ga0207676_10229124 | 3300026095 | Unclassified | 1660 |
| 300 | Ga0207676_10556798 | 3300026095 | Bacteria | 1096 |
| 301 | Ga0207674_10118625 | 3300026116 | Bacteria | 2616 |
| 302 | Ga0207675_100001777 | 3300026118 | Bacteria | 21552 |
| 303 | Ga0207683_10016920 | 3300026121 | Bacteria | 6206 |
| 304 | Ga0207428_10688353 | 3300027907 | Bacteria | 732 |
| 305 | Ga0268266_10174676 | 3300028379 | Bacteria | 1952 |
| 306 | Ga0268265_10404171 | 3300028380 | Bacteria | 1263 |
| 307 | Ga0268265_10980893 | 3300028380 | Bacteria | 834 |
| 308 | Ga0268264_11387256 | 3300028381 | Bacteria | 713 |
| 309 | Ga0265328_10007157 | 3300031239 | Bacteria | 4670 |
| 310 | Ga0316575_10328023 | 3300031665 | Bacteria | 650 |
| 311 | Ga0265342_10016851 | 3300031712 | Bacteria | 4763 |
| 312 | Ga0316576_10008140 | 3300031727 | Bacteria | 6658 |
| 313 | Ga0316576_10416010 | 3300031727 | Bacteria | 995 |
| 314 | Ga0307405_10000124 | 3300031731 | Bacteria | 30625 |
| 315 | Ga0307407_10000024 | 3300031903 | Bacteria | 113716 |
| 316 | Ga0307412_10000004 | 3300031911 | Bacteria | 544053 |
| 317 | Ga0307416_100000037 | 3300032002 | Bacteria | 137513 |
| 318 | Ga0307414_10000477 | 3300032004 | Bacteria | 20980 |
| 319 | Ga0307414_10007084 | 3300032004 | Bacteria | 6289 |
| 320 | Ga0307414_10023212 | 3300032004 | Bacteria | 3930 |
| 321 | Ga0307414_10062991 | 3300032004 | Bacteria | 2634 |
| 322 | Ga0307414_10663755 | 3300032004 | Bacteria | 941 |
| 323 | Ga0307414_10709093 | 3300032004 | Bacteria | 911 |
| 324 | Ga0307415_100420644 | 3300032126 | Bacteria | 1147 |
| 325 | Ga0373926_0017741 | 3300035083 | Bacteria | 2445 |
| 326 | Ga0373926_0195730 | 3300035083 | Bacteria | 777 |
| 327 | Ga0373944_0263074 | 3300035089 | Bacteria | 639 |
| 328 | Ga0373936_0008396 | 3300035113 | Bacteria | 3888 |
| 329 | Ga0373939_0034395 | 3300035114 | Bacteria | 1487 |
| 330 | Ga0373945_0013269 | 3300035116 | Bacteria | 2747 |
| 331 | Ga0373954_0268092 | 3300035118 | Bacteria | 841 |
| 332 | Ga0373954_0455726 | 3300035118 | Bacteria | 633 |
| 333 | Ga0373943_0002541 | 3300035170 | Bacteria | 8295 |
| 334 | Ga0373943_0244126 | 3300035170 | Bacteria | 1007 |
| 335 | Ga0373946_0001624 | 3300035171 | Bacteria | 7833 |
| 336 | Ga0373946_0276453 | 3300035171 | Bacteria | 825 |
| 337 | Ga0373955_0015035 | 3300035172 | Bacteria | 3779 |
| 338 | Ga0373955_0363482 | 3300035172 | Bacteria | 877 |
| 339 | Ga0373961_0162029 | 3300035241 | Bacteria | 769 |
| 340 | Ga0373962_0108799 | 3300035242 | Bacteria | 872 |
| 341 | Ga0316574_0000617 | 3300035398 | Bacteria | 14851 |
| 342 | Ga0316574_0002473 | 3300035398 | Bacteria | 9282 |
| 343 | Ga0316574_0183952 | 3300035398 | Bacteria | 1344 |
| 344 | Ga0316574_0704480 | 3300035398 | Bacteria | 619 |
| 345 | Ga0373924_0067417 | 3300035410 | Bacteria | 1505 |
| 346 | Ga0373924_0214357 | 3300035410 | Bacteria | 850 |
| 347 | Ga0373935_0036974 | 3300035692 | Bacteria | 3054 |
| 348 | Ga0373927_0036244 | 3300035695 | Bacteria | 3208 |
| 349 | Ga0373927_0132986 | 3300035695 | Bacteria | 1625 |
| 350 | Ga0373933_0170112 | 3300035724 | Bacteria | 1386 |
| 351 | Ga0373947_0007075 | 3300035725 | Bacteria | 6502 |
| 352 | Ga0373947_0057470 | 3300035725 | Bacteria | 2354 |
| 353 | Ga0373937_0007210 | 3300036401 | Bacteria | 9620 |
| 354 | Ga0316582_0051307 | 3300036647 | Bacteria | 2617 |
| 355 | Ga0316584_0108949 | 3300036712 | Bacteria | 2073 |
| 356 | Ga0316584_0187266 | 3300036712 | Bacteria | 1531 |
| 357 | Ga0373925_0112019 | 3300037068 | Bacteria | 2109 |
| 358 | Ga0373925_0212679 | 3300037068 | Bacteria | 1540 |
| 359 | Ga0395899_0024753 | 3300037312 | Bacteria | 4537 |
| 360 | Ga0395900_0020334 | 3300037418 | Bacteria | 6776 |
| 361 | Ga0395900_0160661 | 3300037418 | Bacteria | 2292 |
| 362 | Ga0395898_0074320 | 3300037466 | Bacteria | 3283 |
| 363 | Ga0395898_0145263 | 3300037466 | Bacteria | 2270 |
| 364 | Ga0395905_0100025 | 3300037471 | Bacteria | 2723 |
| 365 | Ga0436364_1481812 | 3300037853 | Bacteria | 2075 |
| 366 | Ga0395901_0015210 | 3300038443 | Bacteria | 7828 |
| 367 | Ga0395901_0304646 | 3300038443 | Bacteria | 1651 |
| 368 | Ga0436365_0282095 | 3300039437 | Bacteria | 578 |
| 369 | Ga0436360_0765232 | 3300039438 | Bacteria | 2932 |
| 370 | Ga0436361_0123121 | 3300039447 | Bacteria | 769 |
| 371 | Ga0436361_0615857 | 3300039447 | Bacteria | 5651 |
| 372 | Ga0451847_0973357 | 3300041503 | Bacteria | 1108 |
| 373 | Ga0451849_1045727 | 3300041505 | Bacteria | 943 |
| 374 | Ga0451853_2315819 | 3300041512 | Bacteria | 1136 |
| 375 | Ga0439456_130778 | 3300042013 | Bacteria | 579 |
| 376 | Ga0466966_0097617 | 3300044684 | Bacteria | 1819 |
| 377 | Ga0453684_2036152 | 3300044712 | Bacteria | 577 |
| 378 | Ga0451576_0011502 | 3300045051 | Bacteria | 10048 |
| 379 | Ga0495627_129887 | 3300046453 | Bacteria | 709 |
| 380 | Ga0495603_0042192 | 3300046455 | Bacteria | 2727 |
| 381 | Ga0495603_0091294 | 3300046455 | Bacteria | 1780 |
| 382 | Ga0495590_0085057 | 3300046457 | Bacteria | 1116 |
| 383 | Ga0495590_0137170 | 3300046457 | Bacteria | 882 |
| 384 | Ga0495638_0122956 | 3300046460 | Bacteria | 1532 |
| 385 | Ga0495653_0206391 | 3300046463 | Bacteria | 1330 |
| 386 | Ga0495653_0389697 | 3300046463 | Bacteria | 888 |
| 387 | Ga0495580_0147595 | 3300046472 | Bacteria | 1630 |
| 388 | Ga0495582_0014215 | 3300046473 | Bacteria | 4378 |
| 389 | Ga0495582_0089285 | 3300046473 | Bacteria | 1717 |
| 390 | Ga0495582_0246377 | 3300046473 | Bacteria | 1024 |
| 391 | Ga0495639_0124220 | 3300046475 | Bacteria | 1232 |
| 392 | Ga0495662_0046426 | 3300046476 | Bacteria | 2098 |
| 393 | Ga0495584_0002062 | 3300046491 | Bacteria | 11532 |
| 394 | Ga0495584_0015685 | 3300046491 | Bacteria | 3864 |
| 395 | Ga0495584_0032865 | 3300046491 | Bacteria | 2625 |
| 396 | Ga0495584_0285596 | 3300046491 | Bacteria | 838 |
| 397 | Ga0495585_0233178 | 3300046492 | Bacteria | 924 |
| 398 | Ga0495594_0076500 | 3300046499 | Bacteria | 1866 |
| 399 | Ga0495607_0202009 | 3300046501 | Bacteria | 983 |
| 400 | Ga0495607_0266714 | 3300046501 | Bacteria | 818 |
| 401 | Ga0495608_0497921 | 3300046511 | Bacteria | 738 |
| 402 | Ga0495610_0000045 | 3300046512 | Bacteria | 155304 |
| 403 | Ga0495610_0000329 | 3300046512 | Bacteria | 50268 |
| 404 | Ga0495618_0093956 | 3300046514 | Bacteria | 1918 |
| 405 | Ga0495620_0050725 | 3300046515 | Bacteria | 1769 |
| 406 | Ga0495628_0512412 | 3300046516 | Bacteria | 865 |
| 407 | Ga0495630_0348054 | 3300046517 | Bacteria | 1134 |
| 408 | Ga0495632_0163131 | 3300046519 | Bacteria | 1026 |
| 409 | Ga0495637_0047045 | 3300046520 | Bacteria | 1823 |
| 410 | Ga0495637_0095504 | 3300046520 | Bacteria | 1167 |
| 411 | Ga0495643_0139047 | 3300046522 | Bacteria | 1213 |
| 412 | Ga0495644_0031597 | 3300046523 | Bacteria | 2001 |
| 413 | Ga0495663_0076147 | 3300046525 | Bacteria | 1075 |
| 414 | Ga0495666_0033689 | 3300046526 | Bacteria | 2501 |
| 415 | Ga0495666_0165317 | 3300046526 | Bacteria | 1025 |
| 416 | Ga0495642_0148524 | 3300046528 | Bacteria | 1013 |
| 417 | Ga0495654_0285459 | 3300046530 | Bacteria | 678 |
| 418 | Ga0495665_0223413 | 3300046531 | Bacteria | 973 |
| 419 | Ga0495640_0128079 | 3300046533 | Bacteria | 1645 |
| 420 | Ga0495640_0198126 | 3300046533 | Bacteria | 1274 |
| 421 | Ga0495587_0523851 | 3300046536 | Bacteria | 655 |
| 422 | Ga0495598_0001481 | 3300046537 | Bacteria | 4674 |
| 423 | Ga0495609_0174608 | 3300046538 | Bacteria | 906 |
| 424 | Ga0495667_0133817 | 3300046559 | Bacteria | 1599 |
| 425 | Ga0495656_0021206 | 3300046615 | Bacteria | 2528 |
| 426 | Ga0495656_0222424 | 3300046615 | Bacteria | 944 |
| 427 | Ga0495668_0073818 | 3300046616 | Bacteria | 1873 |
| 428 | Ga0495668_0140565 | 3300046616 | Bacteria | 1321 |
| 429 | Ga0495634_0196991 | 3300046642 | Bacteria | 1253 |
| 430 | Ga0495611_0117487 | 3300046648 | Bacteria | 1240 |
| 431 | Ga0495611_0258636 | 3300046648 | Bacteria | 806 |
| 432 | Ga0495625_0349079 | 3300046660 | Bacteria | 936 |
| 433 | Ga0495625_0821340 | 3300046660 | Bacteria | 539 |
| 434 | Ga0495635_0172509 | 3300046663 | Bacteria | 1471 |
| 435 | Ga0495659_0008153 | 3300046664 | Bacteria | 3330 |
| 436 | Ga0495659_0094573 | 3300046664 | Bacteria | 1151 |
| 437 | Ga0495661_0112410 | 3300046665 | Bacteria | 1516 |
| 438 | Ga0495661_0421804 | 3300046665 | Bacteria | 646 |
| 439 | Ga0495588_0068735 | 3300046674 | Bacteria | 1840 |
| 440 | Ga0495599_0654510 | 3300046678 | Bacteria | 608 |
| 441 | Ga0495647_0012713 | 3300046681 | Bacteria | 2904 |
| 442 | Ga0495647_0373535 | 3300046681 | Bacteria | 652 |
| 443 | Ga0495658_0062204 | 3300046683 | Bacteria | 2145 |
| 444 | Ga0495658_0176686 | 3300046683 | Bacteria | 1323 |
| 445 | Ga0495669_0196503 | 3300046684 | Bacteria | 963 |
| 446 | Ga0495669_0359349 | 3300046684 | Bacteria | 704 |
| 447 | Ga0495613_0133902 | 3300046689 | Bacteria | 1774 |
| 448 | Ga0495624_0166688 | 3300046690 | Bacteria | 1344 |
| 449 | Ga0495624_0675924 | 3300046690 | Bacteria | 613 |
| 450 | Ga0495670_0076056 | 3300046691 | Bacteria | 1705 |
| 451 | Ga0495670_0663428 | 3300046691 | Bacteria | 568 |
| 452 | Ga0495589_0052863 | 3300046794 | Bacteria | 2006 |
| 453 | Ga0495589_0378976 | 3300046794 | Bacteria | 650 |
| 454 | Ga0495660_0234121 | 3300046810 | Bacteria | 859 |
| 455 | Ga0495581_0508633 | 3300047315 | Bacteria | 700 |
| 456 | Ga0495672_0169930 | 3300047320 | Bacteria | 1113 |
| 457 | Ga0495676_0016979 | 3300047321 | Bacteria | 6445 |
| 458 | Ga0495676_0129890 | 3300047321 | Bacteria | 1820 |
| 459 | Ga0495683_0090783 | 3300047323 | Bacteria | 1480 |
| 460 | Ga0495679_039302 | 3300047446 | Bacteria | 1476 |
| 461 | Ga0495686_0337277 | 3300047472 | Bacteria | 823 |
| 462 | Ga0495593_0024050 | 3300047673 | Bacteria | 3380 |
| 463 | Ga0495602_0670899 | 3300048088 | Bacteria | 706 |
| 464 | Ga0496100_0046625 | 3300048903 | Bacteria | 2788 |
| 465 | Ga0496100_0164529 | 3300048903 | Bacteria | 1592 |
| 466 | Ga0496101_0062581 | 3300048904 | Bacteria | 2706 |
| 467 | Ga0496101_0110523 | 3300048904 | Bacteria | 2068 |
| 468 | Ga0496101_0315289 | 3300048904 | Bacteria | 1226 |
| 469 | Ga0496101_0520066 | 3300048904 | Bacteria | 940 |
| 470 | Ga0496102_0057096 | 3300048905 | Bacteria | 3562 |
| 471 | Ga0496102_0083544 | 3300048905 | Bacteria | 2947 |
| 472 | Ga0496102_0105955 | 3300048905 | Bacteria | 2616 |
| 473 | Ga0496102_0382815 | 3300048905 | Bacteria | 1324 |
| 474 | Ga0496102_0505164 | 3300048905 | Bacteria | 1131 |
| 475 | Ga0496103_0007060 | 3300048906 | Bacteria | 6705 |
| 476 | Ga0496103_0039098 | 3300048906 | Bacteria | 2914 |
| 477 | Ga0496103_0391251 | 3300048906 | Bacteria | 893 |
| 478 | Ga0496104_0001526 | 3300048907 | Bacteria | 19967 |
| 479 | Ga0496104_0002719 | 3300048907 | Bacteria | 15219 |
| 480 | Ga0496104_0004554 | 3300048907 | Bacteria | 12081 |
| 481 | Ga0496104_0055837 | 3300048907 | Bacteria | 3734 |
| 482 | Ga0496104_0819044 | 3300048907 | Bacteria | 837 |
| 483 | Ga0496105_0002373 | 3300048908 | Bacteria | 13644 |
| 484 | Ga0496105_0014281 | 3300048908 | Bacteria | 6320 |
| 485 | Ga0496105_0022845 | 3300048908 | Bacteria | 5069 |
| 486 | Ga0496105_0109297 | 3300048908 | Bacteria | 2283 |
| 487 | Ga0496106_0150503 | 3300048909 | Bacteria | 1835 |
| 488 | Ga0496106_0178550 | 3300048909 | Bacteria | 1685 |
| 489 | Ga0496107_0065105 | 3300048910 | Bacteria | 2642 |
| 490 | Ga0496107_0132177 | 3300048910 | Bacteria | 1843 |
| 491 | Ga0496107_0165321 | 3300048910 | Bacteria | 1640 |
| 492 | Ga0496107_0196651 | 3300048910 | Bacteria | 1498 |
| 493 | Ga0496107_0242398 | 3300048910 | Bacteria | 1341 |
| 494 | Ga0496108_0016959 | 3300048911 | Bacteria | 5952 |
| 495 | Ga0496108_0068969 | 3300048911 | Bacteria | 2984 |
| 496 | Ga0496108_0164591 | 3300048911 | Bacteria | 1917 |
| 497 | Ga0496108_0185262 | 3300048911 | Bacteria | 1803 |
| 498 | Ga0496109_0002911 | 3300048912 | Bacteria | 14299 |
| 499 | Ga0496109_0037918 | 3300048912 | Bacteria | 4356 |
| 500 | Ga0496109_0074081 | 3300048912 | Bacteria | 3129 |
| 501 | Ga0496109_0669253 | 3300048912 | Bacteria | 975 |
| 502 | Ga0496109_1560568 | 3300048912 | Bacteria | 595 |
| 503 | Ga0496110_0012106 | 3300048913 | Bacteria | 7086 |
| 504 | Ga0496110_0024954 | 3300048913 | Bacteria | 5102 |
| 505 | Ga0496110_0287294 | 3300048913 | Bacteria | 1498 |
| 506 | Ga0496110_1283811 | 3300048913 | Bacteria | 641 |
| 507 | Ga0496111_0011310 | 3300048914 | Bacteria | 6007 |
| 508 | Ga0496111_0098104 | 3300048914 | Bacteria | 2151 |
| 509 | Ga0496111_0576818 | 3300048914 | Bacteria | 824 |
| 510 | Ga0496112_0019868 | 3300048915 | Bacteria | 6356 |
| 511 | Ga0496112_0025277 | 3300048915 | Bacteria | 5701 |
| 512 | Ga0496112_0402896 | 3300048915 | Bacteria | 1308 |
| 513 | Ga0496112_1032652 | 3300048915 | Bacteria | 741 |
| 514 | Ga0496113_0000438 | 3300048916 | Bacteria | 20214 |
| 515 | Ga0496113_0202073 | 3300048916 | Bacteria | 1579 |
| 516 | Ga0496113_0293813 | 3300048916 | Bacteria | 1300 |
| 517 | Ga0496113_0904046 | 3300048916 | Bacteria | 698 |
| 518 | Ga0496114_0013133 | 3300048917 | Bacteria | 6637 |
| 519 | Ga0496114_0073769 | 3300048917 | Bacteria | 2872 |
| 520 | Ga0496114_0094034 | 3300048917 | Bacteria | 2549 |
| 521 | Ga0496115_0055603 | 3300048918 | Bacteria | 3179 |
| 522 | Ga0496115_0074877 | 3300048918 | Bacteria | 2749 |
| 523 | Ga0496115_0108138 | 3300048918 | Bacteria | 2283 |
| 524 | Ga0496115_0198868 | 3300048918 | Bacteria | 1656 |
| 525 | Ga0496115_0306727 | 3300048918 | Bacteria | 1300 |
| 526 | Ga0496115_0481436 | 3300048918 | Bacteria | 999 |
| 527 | Ga0496121_0003431 | 3300048924 | Bacteria | 22656 |
| 528 | Ga0496122_0001629 | 3300048925 | Bacteria | 35029 |
| 529 | Ga0496123_0000906 | 3300048926 | Bacteria | 46669 |
| 530 | Ga0496124_0690235 | 3300048927 | Bacteria | 649 |
| 531 | Ga0496125_0206798 | 3300048928 | Bacteria | 1279 |
| 532 | Ga0496126_0016480 | 3300048929 | Bacteria | 7386 |
| 533 | Ga0496126_0190763 | 3300048929 | Bacteria | 1736 |
| 534 | Ga0501031_0003015 | 3300049568 | Bacteria | 10775 |
| 535 | Ga0501032_0247253 | 3300049569 | Bacteria | 1158 |
| 536 | Ga0501033_0083990 | 3300049570 | Bacteria | 2333 |
| 537 | Ga0501034_0037064 | 3300049571 | Bacteria | 4938 |
| 538 | Ga0501034_0156136 | 3300049571 | Bacteria | 2255 |
| 539 | Ga0501034_0322581 | 3300049571 | Bacteria | 1477 |
| 540 | Ga0501036_0130895 | 3300049572 | Bacteria | 2118 |
| 541 | Ga0501038_0291082 | 3300049574 | Bacteria | 1283 |
| 542 | Ga0501040_0742395 | 3300049576 | Bacteria | 710 |
| 543 | Ga0501041_0279235 | 3300049577 | Bacteria | 1051 |
| 544 | Ga0501041_0356381 | 3300049577 | Bacteria | 925 |
| 545 | Ga0501043_0512928 | 3300049579 | Bacteria | 894 |
| 546 | Ga0501043_1018177 | 3300049579 | Bacteria | 589 |
| 547 | Ga0501047_0210018 | 3300049581 | Bacteria | 1805 |
| 548 | Ga0501048_0654025 | 3300049582 | Bacteria | 755 |
| 549 | Ga0501068_0090545 | 3300049584 | Bacteria | 1887 |
| 550 | Ga0501069_0275280 | 3300049585 | Bacteria | 984 |
| 551 | Ga0501070_0086786 | 3300049586 | Bacteria | 2590 |
| 552 | Ga0501070_0449854 | 3300049586 | Bacteria | 1038 |
| 553 | Ga0501070_0863275 | 3300049586 | Bacteria | 707 |
| 554 | Ga0501072_0211276 | 3300049588 | Bacteria | 1546 |
| 555 | Ga0501074_0353724 | 3300049590 | Bacteria | 1042 |
| 556 | Ga0501074_0741965 | 3300049590 | Bacteria | 692 |
| 557 | Ga0501074_0805200 | 3300049590 | Bacteria | 662 |
| 558 | Ga0501075_0134980 | 3300049591 | Bacteria | 1880 |
| 559 | Ga0501075_0198855 | 3300049591 | Bacteria | 1529 |
| 560 | Ga0501076_0200435 | 3300049592 | Bacteria | 1630 |
| 561 | Ga0501076_0315405 | 3300049592 | Bacteria | 1283 |
| 562 | Ga0501076_0422270 | 3300049592 | Bacteria | 1097 |
| 563 | Ga0501077_0027098 | 3300049593 | Bacteria | 3639 |
| 564 | Ga0501252_016884 | 3300049682 | Bacteria | 923 |
| 565 | Ga0501079_0086393 | 3300049741 | Bacteria | 2428 |
| 566 | Ga0501079_0812376 | 3300049741 | Bacteria | 736 |
| 567 | Ga0501080_0102658 | 3300049742 | Bacteria | 2652 |
| 568 | Ga0501080_0605314 | 3300049742 | Bacteria | 972 |
| 569 | Ga0501080_1403791 | 3300049742 | Bacteria | 596 |
| 570 | Ga0501081_0183731 | 3300049743 | Bacteria | 1513 |
| 571 | Ga0501081_0517738 | 3300049743 | Bacteria | 890 |
| 572 | Ga0501241_003227 | 3300049758 | Bacteria | 3095 |
| 573 | Ga0501035_0225766 | 3300049822 | Bacteria | 1597 |
| 574 | Ga0501044_0261350 | 3300049823 | Bacteria | 1669 |
| 575 | Ga0501045_0109882 | 3300049824 | Bacteria | 2044 |
| 576 | nmdc:mga0yw44_276465_c1 | 3300050492 | Bacteria | 1122 |
| 577 | nmdc:mga0yw44_312690_c1 | 3300050492 | Bacteria | 1054 |
| 578 | nmdc:mga0yw44_34166_c1 | 3300050492 | Bacteria | 2978 |
| 579 | nmdc:mga0yw44_626643_c1 | 3300050492 | Bacteria | 731 |
| 580 | nmdc:mga0yw44_87583_c1 | 3300050492 | Bacteria | 1963 |
| 581 | nmdc:mga04h51_291439_c1 | 3300050495 | Bacteria | 663 |
| 582 | nmdc:mga05p37_108351_c1 | 3300050507 | Bacteria | 3417 |
| 583 | nmdc:mga05p37_199748_c1 | 3300050507 | Bacteria | 2423 |
| 584 | nmdc:mga05p37_34403_c1 | 3300050507 | Bacteria | 6207 |
| 585 | nmdc:mga05p37_367150_c1 | 3300050507 | Bacteria | 1690 |
| 586 | nmdc:mga05p37_4993_c1 | 3300050507 | Bacteria | 8817 |
| 587 | nmdc:mga09592_44194_c1 | 3300050508 | Bacteria | 3749 |
| 588 | nmdc:mga09592_52542_c1 | 3300050508 | Bacteria | 3440 |
| 589 | nmdc:mga0qj67_212097_c1 | 3300050509 | Bacteria | 1573 |
| 590 | nmdc:mga0qj67_83_c1 | 3300050509 | Bacteria | 63959 |
| 591 | nmdc:mga06r32_1272653_c1 | 3300050510 | Bacteria | 680 |
| 592 | nmdc:mga06r32_25066_c1 | 3300050510 | Bacteria | 5542 |
| 593 | nmdc:mga06r32_259924_c1 | 3300050510 | Bacteria | 1724 |
| 594 | nmdc:mga06r32_362432_c1 | 3300050510 | Bacteria | 1433 |
| 595 | nmdc:mga08y16_1137082_c1 | 3300050511 | Bacteria | 754 |
| 596 | nmdc:mga08y16_142421_c1 | 3300050511 | Bacteria | 2492 |
| 597 | nmdc:mga0n895_141084_c1 | 3300050512 | Bacteria | 2438 |
| 598 | nmdc:mga0n895_236465_c1 | 3300050512 | Bacteria | 1854 |
| 599 | nmdc:mga0n895_623985_c1 | 3300050512 | Bacteria | 1079 |
| 600 | nmdc:mga0n895_70025_c1 | 3300050512 | Bacteria | 3476 |
| 601 | nmdc:mga0n895_76758_c1 | 3300050512 | Bacteria | 3322 |
| 602 | nmdc:mga0rr50_182233_c1 | 3300050513 | Bacteria | 1717 |
| 603 | nmdc:mga0rr50_231994_c1 | 3300050513 | Bacteria | 1527 |
| 604 | nmdc:mga0a205_127324_c1 | 3300050515 | Bacteria | 2446 |
| 605 | nmdc:mga0a205_59177_c1 | 3300050515 | Bacteria | 3701 |
| 606 | Ga0495601_0091840 | 3300053077 | Bacteria | 1955 |
| 607 | Ga0495601_0100294 | 3300053077 | Bacteria | 1870 |
| 608 | Ga0495601_0216083 | 3300053077 | Bacteria | 1252 |
| 609 | Ga0495612_0137262 | 3300053078 | Bacteria | 1059 |
| 610 | Ga0495655_0004837 | 3300053083 | Bacteria | 2336 |
| 611 | Ga0495595_0115426 | 3300053084 | Bacteria | 1305 |
| 612 | Ga0495619_0670344 | 3300053085 | Bacteria | 706 |
| 613 | Ga0500651_0000207 | 3300053093 | Bacteria | 36951 |
| 614 | Ga0500641_0189197 | 3300053096 | Bacteria | 882 |
| 615 | Ga0500616_0143260 | 3300053153 | Bacteria | 1114 |
| 616 | Ga0501084_0174742 | 3300054114 | Bacteria | 1813 |
| 617 | Ga0501084_0375844 | 3300054114 | Bacteria | 1201 |
| 618 | Ga0501082_0057982 | 3300060353 | Bacteria | 3336 |
| 619 | Ga0501082_0632172 | 3300060353 | Bacteria | 937 |
| 620 | Ga0530510_0404773 | 3300061734 | Bacteria | 1029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2585427687 | 2586210442 | 149 |
| 2 | iso_pu_bacteria | 2738541283 | 2738754289 | 149 |
| 3 | iso_pu_bacteria | 2738541284 | 2738762947 | 149 |
| 4 | iso_pu_bacteria | 2738541302 | 2738855767 | 149 |
| 5 | iso_pu_bacteria | 2738543023 | 2739301647 | 149 |
| 6 | iso_pu_bacteria | 2739367651 | 2739590180 | 149 |
| 7 | iso_pu_bacteria | 2739367656 | 2739615398 | 149 |
| 8 | iso_pu_bacteria | 2775506987 | 2776614555 | 149 |
| 9 | iso_pu_bacteria | 2818991437 | 2819548432 | 149 |
| 10 | iso_pu_bacteria | 2842722452 | 2842723004 | 149 |
| 11 | iso_pu_bacteria | 2842909656 | 2842913960 | 149 |
| 12 | iso_pu_bacteria | 2849281842 | 2849283701 | 149 |
| 13 | iso_pu_bacteria | 2852627209 | 2852627684 | 149 |
| 14 | iso_pu_bacteria | 2857627736 | 2857630173 | 149 |
| 15 | iso_pu_bacteria | 2902048731 | 2902053049 | 149 |
| 16 | iso_pu_bacteria | 2904445276 | 2904449545 | 149 |
| 17 | iso_pu_bacteria | 2919186247 | 2919187855 | 149 |
| 18 | iso_pu_bacteria | 2939664404 | 2939664878 | 149 |
| 19 | iso_pu_bacteria | 2945997725 | 2945999970 | 149 |
| 20 | iso_pu_bacteria | 2954016120 | 2954016577 | 149 |
| 21 | iso_pu_bacteria | 2739367663 | 2739644405 | 150 |
| 22 | 3300025944 | Ga0207661_10745007 | Ga0207661_107450071 | 152 |
| 23 | 3300048907 | Ga0496104_0819044 | Ga0496104_0819044_43_555 | 152 |
| 24 | 3300049571 | Ga0501034_0037064 | Ga0501034_0037064_3755_4243 | 152 |
| 25 | 2162886007 | SwRhRL2b_contig_2896220 | SwRhRL2b_0742.00000990 | 153 |
| 26 | 2162886007 | SwRhRL2b_contig_475676 | SwRhRL2b_0167.00008630 | 153 |
| 27 | 3300001977 | JGI24746J21847_1032408 | JGI24746J21847_10324081 | 153 |
| 28 | 3300001990 | JGI24737J22298_10108803 | JGI24737J22298_101088031 | 153 |
| 29 | 3300001991 | JGI24743J22301_10071135 | JGI24743J22301_100711351 | 153 |
| 30 | 3300002074 | JGI24748J21848_1014993 | JGI24748J21848_10149931 | 153 |
| 31 | 3300002075 | JGI24738J21930_10015935 | JGI24738J21930_100159351 | 153 |
| 32 | 3300002077 | JGI24744J21845_10058966 | JGI24744J21845_100589661 | 153 |
| 33 | 3300002773 | JGI25152J39213_1000476 | JGI25152J39213_100047620 | 153 |
| 34 | 3300002774 | JGI25150J39212_1000002 | JGI25150J39212_1000002241 | 153 |
| 35 | 3300003187 | JGI25151J46595_10000003 | JGI25151J46595_10000003417 | 153 |
| 36 | 3300003215 | JGI25153J46596_10000003 | JGI25153J46596_10000003249 | 153 |
| 37 | 3300003323 | rootH1_10239678 | rootH1_102396782 | 153 |
| 38 | 3300003781 | Ga0055536_1000049 | Ga0055536_100004965 | 153 |
| 39 | 3300003791 | Ga0055530_10002714 | Ga0055530_100027148 | 153 |
| 40 | 3300005288 | Ga0065714_10002298 | Ga0065714_1000229825 | 153 |
| 41 | 3300005288 | Ga0065714_10002621 | Ga0065714_1000262114 | 153 |
| 42 | 3300005288 | Ga0065714_10014983 | Ga0065714_100149833 | 153 |
| 43 | 3300005288 | Ga0065714_10065634 | Ga0065714_1006563410 | 153 |
| 44 | 3300005288 | Ga0065714_10071503 | Ga0065714_100715035 | 153 |
| 45 | 3300005288 | Ga0065714_10084878 | Ga0065714_100848782 | 153 |
| 46 | 3300005288 | Ga0065714_10300924 | Ga0065714_103009241 | 153 |
| 47 | 3300005289 | Ga0065704_10000205 | Ga0065704_1000020511 | 153 |
| 48 | 3300005289 | Ga0065704_10001103 | Ga0065704_100011036 | 153 |
| 49 | 3300005289 | Ga0065704_10350957 | Ga0065704_103509571 | 153 |
| 50 | 3300005328 | Ga0070676_10021108 | Ga0070676_100211086 | 153 |
| 51 | 3300005329 | Ga0070683_100174484 | Ga0070683_1001744843 | 153 |
| 52 | 3300005329 | Ga0070683_101252790 | Ga0070683_1012527901 | 153 |
| 53 | 3300005330 | Ga0070690_100465800 | Ga0070690_1004658002 | 153 |
| 54 | 3300005336 | Ga0070680_100160460 | Ga0070680_1001604602 | 153 |
| 55 | 3300005336 | Ga0070680_100511318 | Ga0070680_1005113182 | 153 |
| 56 | 3300005337 | Ga0070682_101047603 | Ga0070682_1010476032 | 153 |
| 57 | 3300005339 | Ga0070660_100130664 | Ga0070660_1001306642 | 153 |
| 58 | 3300005340 | Ga0070689_100170832 | Ga0070689_1001708322 | 153 |
| 59 | 3300005343 | Ga0070687_100137403 | Ga0070687_1001374032 | 153 |
| 60 | 3300005344 | Ga0070661_100361993 | Ga0070661_1003619932 | 153 |
| 61 | 3300005345 | Ga0070692_10031592 | Ga0070692_100315922 | 153 |
| 62 | 3300005354 | Ga0070675_100144519 | Ga0070675_1001445192 | 153 |
| 63 | 3300005355 | Ga0070671_101154736 | Ga0070671_1011547361 | 153 |
| 64 | 3300005356 | Ga0070674_100742796 | Ga0070674_1007427961 | 153 |
| 65 | 3300005364 | Ga0070673_100174646 | Ga0070673_1001746462 | 153 |
| 66 | 3300005365 | Ga0070688_100098941 | Ga0070688_1000989412 | 153 |
| 67 | 3300005366 | Ga0070659_100171213 | Ga0070659_1001712133 | 153 |
| 68 | 3300005366 | Ga0070659_100250940 | Ga0070659_1002509402 | 153 |
| 69 | 3300005434 | Ga0070709_10010442 | Ga0070709_100104426 | 153 |
| 70 | 3300005434 | Ga0070709_11195096 | Ga0070709_111950961 | 153 |
| 71 | 3300005435 | Ga0070714_100014088 | Ga0070714_1000140885 | 153 |
| 72 | 3300005435 | Ga0070714_100169370 | Ga0070714_1001693703 | 153 |
| 73 | 3300005436 | Ga0070713_100019862 | Ga0070713_1000198625 | 153 |
| 74 | 3300005436 | Ga0070713_100146522 | Ga0070713_1001465221 | 153 |
| 75 | 3300005436 | Ga0070713_101484081 | Ga0070713_1014840811 | 153 |
| 76 | 3300005437 | Ga0070710_10004638 | Ga0070710_100046385 | 153 |
| 77 | 3300005439 | Ga0070711_100103337 | Ga0070711_1001033374 | 153 |
| 78 | 3300005439 | Ga0070711_100252837 | Ga0070711_1002528372 | 153 |
| 79 | 3300005440 | Ga0070705_101002554 | Ga0070705_1010025541 | 153 |
| 80 | 3300005441 | Ga0070700_100063622 | Ga0070700_1000636221 | 153 |
| 81 | 3300005445 | Ga0070708_100472124 | Ga0070708_1004721242 | 153 |
| 82 | 3300005457 | Ga0070662_100573661 | Ga0070662_1005736612 | 153 |
| 83 | 3300005459 | Ga0068867_100373779 | Ga0068867_1003737792 | 153 |
| 84 | 3300005468 | Ga0070707_100504733 | Ga0070707_1005047331 | 153 |
| 85 | 3300005468 | Ga0070707_100532588 | Ga0070707_1005325882 | 153 |
| 86 | 3300005468 | Ga0070707_101619042 | Ga0070707_1016190421 | 153 |
| 87 | 3300005468 | Ga0070707_101715756 | Ga0070707_1017157561 | 153 |
| 88 | 3300005471 | Ga0070698_100901080 | Ga0070698_1009010802 | 153 |
| 89 | 3300005471 | Ga0070698_101609910 | Ga0070698_1016099101 | 153 |
| 90 | 3300005518 | Ga0070699_100006185 | Ga0070699_1000061859 | 153 |
| 91 | 3300005518 | Ga0070699_100245715 | Ga0070699_1002457152 | 153 |
| 92 | 3300005518 | Ga0070699_100269752 | Ga0070699_1002697522 | 153 |
| 93 | 3300005530 | Ga0070679_100297936 | Ga0070679_1002979362 | 153 |
| 94 | 3300005535 | Ga0070684_100079215 | Ga0070684_1000792154 | 153 |
| 95 | 3300005536 | Ga0070697_101130273 | Ga0070697_1011302731 | 153 |
| 96 | 3300005539 | Ga0068853_100902600 | Ga0068853_1009026001 | 153 |
| 97 | 3300005543 | Ga0070672_100086675 | Ga0070672_1000866755 | 153 |
| 98 | 3300005545 | Ga0070695_100431358 | Ga0070695_1004313582 | 153 |
| 99 | 3300005546 | Ga0070696_100552426 | Ga0070696_1005524261 | 153 |
| 100 | 3300005549 | Ga0070704_100911846 | Ga0070704_1009118461 | 153 |
| 101 | 3300005563 | Ga0068855_101035675 | Ga0068855_1010356752 | 153 |
| 102 | 3300005563 | Ga0068855_101290013 | Ga0068855_1012900131 | 153 |
| 103 | 3300005564 | Ga0070664_100162359 | Ga0070664_1001623593 | 153 |
| 104 | 3300005577 | Ga0068857_100213576 | Ga0068857_1002135763 | 153 |
| 105 | 3300005578 | Ga0068854_100160911 | Ga0068854_1001609111 | 153 |
| 106 | 3300005614 | Ga0068856_100364760 | Ga0068856_1003647602 | 153 |
| 107 | 3300005615 | Ga0070702_100134722 | Ga0070702_1001347223 | 153 |
| 108 | 3300005615 | Ga0070702_100842093 | Ga0070702_1008420931 | 153 |
| 109 | 3300005616 | Ga0068852_100209977 | Ga0068852_1002099772 | 153 |
| 110 | 3300005618 | Ga0068864_100061026 | Ga0068864_1000610263 | 153 |
| 111 | 3300005618 | Ga0068864_100379031 | Ga0068864_1003790312 | 153 |
| 112 | 3300005718 | Ga0068866_10194047 | Ga0068866_101940472 | 153 |
| 113 | 3300005719 | Ga0068861_100225431 | Ga0068861_1002254313 | 153 |
| 114 | 3300005834 | Ga0068851_10086495 | Ga0068851_100864952 | 153 |
| 115 | 3300005840 | Ga0068870_10013225 | Ga0068870_100132252 | 153 |
| 116 | 3300005841 | Ga0068863_100189614 | Ga0068863_1001896142 | 153 |
| 117 | 3300005843 | Ga0068860_100178848 | Ga0068860_1001788482 | 153 |
| 118 | 3300005844 | Ga0068862_100007625 | Ga0068862_10000762512 | 153 |
| 119 | 3300005844 | Ga0068862_100421900 | Ga0068862_1004219002 | 153 |
| 120 | 3300005937 | Ga0081455_10001555 | Ga0081455_1000155526 | 153 |
| 121 | 3300005937 | Ga0081455_10012680 | Ga0081455_100126802 | 153 |
| 122 | 3300005937 | Ga0081455_10025015 | Ga0081455_100250159 | 153 |
| 123 | 3300005937 | Ga0081455_10060912 | Ga0081455_100609122 | 153 |
| 124 | 3300005937 | Ga0081455_10061060 | Ga0081455_100610602 | 153 |
| 125 | 3300005937 | Ga0081455_10095813 | Ga0081455_100958131 | 153 |
| 126 | 3300005937 | Ga0081455_10202434 | Ga0081455_102024342 | 153 |
| 127 | 3300005981 | Ga0081538_10107822 | Ga0081538_101078222 | 153 |
| 128 | 3300005983 | Ga0081540_1016285 | Ga0081540_10162853 | 153 |
| 129 | 3300006028 | Ga0070717_10029383 | Ga0070717_100293835 | 153 |
| 130 | 3300006028 | Ga0070717_10269715 | Ga0070717_102697152 | 153 |
| 131 | 3300006028 | Ga0070717_10517777 | Ga0070717_105177772 | 153 |
| 132 | 3300006028 | Ga0070717_11137417 | Ga0070717_111374171 | 153 |
| 133 | 3300006038 | Ga0075365_10033139 | Ga0075365_100331392 | 153 |
| 134 | 3300006038 | Ga0075365_10137905 | Ga0075365_101379051 | 153 |
| 135 | 3300006038 | Ga0075365_10304602 | Ga0075365_103046022 | 153 |
| 136 | 3300006042 | Ga0075368_10031945 | Ga0075368_100319454 | 153 |
| 137 | 3300006048 | Ga0075363_100637202 | Ga0075363_1006372021 | 153 |
| 138 | 3300006058 | Ga0075432_10209363 | Ga0075432_102093631 | 153 |
| 139 | 3300006163 | Ga0070715_10298585 | Ga0070715_102985851 | 153 |
| 140 | 3300006173 | Ga0070716_100016175 | Ga0070716_1000161755 | 153 |
| 141 | 3300006175 | Ga0070712_100013815 | Ga0070712_1000138154 | 153 |
| 142 | 3300006175 | Ga0070712_100326830 | Ga0070712_1003268301 | 153 |
| 143 | 3300006175 | Ga0070712_100452068 | Ga0070712_1004520681 | 153 |
| 144 | 3300006177 | Ga0075362_10302297 | Ga0075362_103022972 | 153 |
| 145 | 3300006178 | Ga0075367_10035549 | Ga0075367_100355493 | 153 |
| 146 | 3300006844 | Ga0075428_100017448 | Ga0075428_1000174484 | 153 |
| 147 | 3300006844 | Ga0075428_100143569 | Ga0075428_1001435694 | 153 |
| 148 | 3300006844 | Ga0075428_100196014 | Ga0075428_1001960142 | 153 |
| 149 | 3300006844 | Ga0075428_100401471 | Ga0075428_1004014713 | 153 |
| 150 | 3300006844 | Ga0075428_101042930 | Ga0075428_1010429302 | 153 |
| 151 | 3300006844 | Ga0075428_101063293 | Ga0075428_1010632931 | 153 |
| 152 | 3300006846 | Ga0075430_100000184 | Ga0075430_10000018422 | 153 |
| 153 | 3300006846 | Ga0075430_100923747 | Ga0075430_1009237472 | 153 |
| 154 | 3300006847 | Ga0075431_100103927 | Ga0075431_1001039272 | 153 |
| 155 | 3300006847 | Ga0075431_100187319 | Ga0075431_1001873192 | 153 |
| 156 | 3300006847 | Ga0075431_101210136 | Ga0075431_1012101362 | 153 |
| 157 | 3300006852 | Ga0075433_10050636 | Ga0075433_100506364 | 153 |
| 158 | 3300006852 | Ga0075433_10055747 | Ga0075433_100557477 | 153 |
| 159 | 3300006871 | Ga0075434_100020000 | Ga0075434_1000200008 | 153 |
| 160 | 3300006871 | Ga0075434_100132361 | Ga0075434_1001323615 | 153 |
| 161 | 3300006871 | Ga0075434_100176021 | Ga0075434_1001760214 | 153 |
| 162 | 3300006880 | Ga0075429_100034844 | Ga0075429_1000348443 | 153 |
| 163 | 3300006880 | Ga0075429_100993055 | Ga0075429_1009930552 | 153 |
| 164 | 3300007076 | Ga0075435_100083356 | Ga0075435_1000833561 | 153 |
| 165 | 3300007265 | Ga0099794_10013261 | Ga0099794_100132613 | 153 |
| 166 | 3300007788 | Ga0099795_10086914 | Ga0099795_100869142 | 153 |
| 167 | 3300009011 | Ga0105251_10204700 | Ga0105251_102047001 | 153 |
| 168 | 3300009036 | Ga0105244_10051568 | Ga0105244_100515681 | 153 |
| 169 | 3300009094 | Ga0111539_10078004 | Ga0111539_100780043 | 153 |
| 170 | 3300009098 | Ga0105245_10338237 | Ga0105245_103382372 | 153 |
| 171 | 3300009101 | Ga0105247_10025486 | Ga0105247_100254863 | 153 |
| 172 | 3300009101 | Ga0105247_10145370 | Ga0105247_101453702 | 153 |
| 173 | 3300009101 | Ga0105247_10512028 | Ga0105247_105120282 | 153 |
| 174 | 3300009147 | Ga0114129_10004024 | Ga0114129_1000402414 | 153 |
| 175 | 3300009147 | Ga0114129_10023533 | Ga0114129_1002353310 | 153 |
| 176 | 3300009147 | Ga0114129_10041836 | Ga0114129_100418366 | 153 |
| 177 | 3300009147 | Ga0114129_10072366 | Ga0114129_100723664 | 153 |
| 178 | 3300009147 | Ga0114129_10161736 | Ga0114129_101617362 | 153 |
| 179 | 3300009147 | Ga0114129_10362630 | Ga0114129_103626303 | 153 |
| 180 | 3300009147 | Ga0114129_10377185 | Ga0114129_103771853 | 153 |
| 181 | 3300009147 | Ga0114129_10653912 | Ga0114129_106539122 | 153 |
| 182 | 3300009147 | Ga0114129_10658940 | Ga0114129_106589402 | 153 |
| 183 | 3300009147 | Ga0114129_11039890 | Ga0114129_110398902 | 153 |
| 184 | 3300009148 | Ga0105243_10472442 | Ga0105243_104724422 | 153 |
| 185 | 3300009176 | Ga0105242_10461666 | Ga0105242_104616662 | 153 |
| 186 | 3300009177 | Ga0105248_10065217 | Ga0105248_100652172 | 153 |
| 187 | 3300009545 | Ga0105237_10004270 | Ga0105237_100042706 | 153 |
| 188 | 3300009545 | Ga0105237_10163664 | Ga0105237_101636642 | 153 |
| 189 | 3300009553 | Ga0105249_10108519 | Ga0105249_101085194 | 153 |
| 190 | 3300010159 | Ga0099796_10001225 | Ga0099796_100012254 | 153 |
| 191 | 3300010159 | Ga0099796_10123492 | Ga0099796_101234922 | 153 |
| 192 | 3300010375 | Ga0105239_11778771 | Ga0105239_117787711 | 153 |
| 193 | 3300011119 | Ga0105246_10402342 | Ga0105246_104023422 | 153 |
| 194 | 3300013100 | Ga0157373_10000974 | Ga0157373_1000097420 | 153 |
| 195 | 3300013100 | Ga0157373_10006199 | Ga0157373_100061998 | 153 |
| 196 | 3300013100 | Ga0157373_10087836 | Ga0157373_100878363 | 153 |
| 197 | 3300013102 | Ga0157371_10000119 | Ga0157371_1000011939 | 153 |
| 198 | 3300013102 | Ga0157371_10010487 | Ga0157371_100104873 | 153 |
| 199 | 3300013104 | Ga0157370_10004633 | Ga0157370_100046339 | 153 |
| 200 | 3300013104 | Ga0157370_10014232 | Ga0157370_100142327 | 153 |
| 201 | 3300013104 | Ga0157370_10051173 | Ga0157370_100511735 | 153 |
| 202 | 3300013104 | Ga0157370_10056450 | Ga0157370_100564504 | 153 |
| 203 | 3300013104 | Ga0157370_10086094 | Ga0157370_100860944 | 153 |
| 204 | 3300013104 | Ga0157370_10091869 | Ga0157370_100918694 | 153 |
| 205 | 3300013104 | Ga0157370_10164106 | Ga0157370_101641062 | 153 |
| 206 | 3300013104 | Ga0157370_10260512 | Ga0157370_102605123 | 153 |
| 207 | 3300013104 | Ga0157370_10802574 | Ga0157370_108025742 | 153 |
| 208 | 3300013105 | Ga0157369_10000015 | Ga0157369_1000001576 | 153 |
| 209 | 3300013296 | Ga0157374_10012482 | Ga0157374_100124822 | 153 |
| 210 | 3300013297 | Ga0157378_10642804 | Ga0157378_106428042 | 153 |
| 211 | 3300013306 | Ga0163162_10000520 | Ga0163162_1000052036 | 153 |
| 212 | 3300013306 | Ga0163162_10172620 | Ga0163162_101726203 | 153 |
| 213 | 3300013306 | Ga0163162_10299233 | Ga0163162_102992332 | 153 |
| 214 | 3300013307 | Ga0157372_10074067 | Ga0157372_100740673 | 153 |
| 215 | 3300013307 | Ga0157372_10443615 | Ga0157372_104436153 | 153 |
| 216 | 3300013308 | Ga0157375_10436731 | Ga0157375_104367313 | 153 |
| 217 | 3300014325 | Ga0163163_10015050 | Ga0163163_100150503 | 153 |
| 218 | 3300014325 | Ga0163163_11938078 | Ga0163163_119380781 | 153 |
| 219 | 3300014326 | Ga0157380_10130964 | Ga0157380_101309644 | 153 |
| 220 | 3300014497 | Ga0182008_10000069 | Ga0182008_1000006958 | 153 |
| 221 | 3300014497 | Ga0182008_10000247 | Ga0182008_100002479 | 153 |
| 222 | 3300014497 | Ga0182008_10001023 | Ga0182008_100010235 | 153 |
| 223 | 3300014497 | Ga0182008_10011758 | Ga0182008_100117584 | 153 |
| 224 | 3300014497 | Ga0182008_10017588 | Ga0182008_100175882 | 153 |
| 225 | 3300014497 | Ga0182008_10043944 | Ga0182008_100439443 | 153 |
| 226 | 3300014497 | Ga0182008_10121860 | Ga0182008_101218602 | 153 |
| 227 | 3300014497 | Ga0182008_10332552 | Ga0182008_103325521 | 153 |
| 228 | 3300014745 | Ga0157377_10102849 | Ga0157377_101028492 | 153 |
| 229 | 3300014968 | Ga0157379_10574214 | Ga0157379_105742142 | 153 |
| 230 | 3300014969 | Ga0157376_10528137 | Ga0157376_105281371 | 153 |
| 231 | 3300014969 | Ga0157376_10917396 | Ga0157376_109173962 | 153 |
| 232 | 3300014969 | Ga0157376_11165800 | Ga0157376_111658001 | 153 |
| 233 | 3300015261 | Ga0182006_1000091 | Ga0182006_100009155 | 153 |
| 234 | 3300015261 | Ga0182006_1000210 | Ga0182006_100021043 | 153 |
| 235 | 3300015261 | Ga0182006_1000352 | Ga0182006_10003525 | 153 |
| 236 | 3300015261 | Ga0182006_1009379 | Ga0182006_10093794 | 153 |
| 237 | 3300015262 | Ga0182007_10000010 | Ga0182007_10000010138 | 153 |
| 238 | 3300015262 | Ga0182007_10013273 | Ga0182007_100132732 | 153 |
| 239 | 3300015262 | Ga0182007_10045068 | Ga0182007_100450682 | 153 |
| 240 | 3300015682 | Ga0183373_1005 | Ga0183373_1005278 | 153 |
| 241 | 3300017792 | Ga0163161_10000046 | Ga0163161_1000004696 | 153 |
| 242 | 3300017792 | Ga0163161_10001264 | Ga0163161_1000126415 | 153 |
| 243 | 3300017792 | Ga0163161_10003880 | Ga0163161_100038802 | 153 |
| 244 | 3300017792 | Ga0163161_10019645 | Ga0163161_100196453 | 153 |
| 245 | 3300017792 | Ga0163161_11411151 | Ga0163161_114111511 | 153 |
| 246 | 3300021361 | Ga0213872_10302829 | Ga0213872_103028292 | 153 |
| 247 | 3300021441 | Ga0213871_10125562 | Ga0213871_101255621 | 153 |
| 248 | 3300025245 | Ga0207425_1000004 | Ga0207425_1000004704 | 153 |
| 249 | 3300025258 | Ga0209129_1000005 | Ga0209129_1000005238 | 153 |
| 250 | 3300025292 | Ga0209676_1000001 | Ga0209676_100000133 | 153 |
| 251 | 3300025294 | Ga0209025_1000009 | Ga0209025_1000009704 | 153 |
| 252 | 3300025297 | Ga0209758_1000010 | Ga0209758_1000010705 | 153 |
| 253 | 3300025298 | Ga0209050_1000258 | Ga0209050_100025866 | 153 |
| 254 | 3300025898 | Ga0207692_10074367 | Ga0207692_100743671 | 153 |
| 255 | 3300025900 | Ga0207710_10072226 | Ga0207710_100722263 | 153 |
| 256 | 3300025900 | Ga0207710_10156515 | Ga0207710_101565152 | 153 |
| 257 | 3300025901 | Ga0207688_10001906 | Ga0207688_100019062 | 153 |
| 258 | 3300025903 | Ga0207680_10347213 | Ga0207680_103472131 | 153 |
| 259 | 3300025904 | Ga0207647_10199996 | Ga0207647_101999962 | 153 |
| 260 | 3300025905 | Ga0207685_10227796 | Ga0207685_102277961 | 153 |
| 261 | 3300025905 | Ga0207685_10237167 | Ga0207685_102371671 | 153 |
| 262 | 3300025906 | Ga0207699_10003624 | Ga0207699_1000362410 | 153 |
| 263 | 3300025906 | Ga0207699_10299183 | Ga0207699_102991831 | 153 |
| 264 | 3300025907 | Ga0207645_10029712 | Ga0207645_100297122 | 153 |
| 265 | 3300025908 | Ga0207643_10002034 | Ga0207643_100020342 | 153 |
| 266 | 3300025909 | Ga0207705_10110720 | Ga0207705_101107202 | 153 |
| 267 | 3300025909 | Ga0207705_10297948 | Ga0207705_102979482 | 153 |
| 268 | 3300025910 | Ga0207684_10108001 | Ga0207684_101080012 | 153 |
| 269 | 3300025910 | Ga0207684_11192284 | Ga0207684_111922841 | 153 |
| 270 | 3300025912 | Ga0207707_10087991 | Ga0207707_100879915 | 153 |
| 271 | 3300025912 | Ga0207707_11205253 | Ga0207707_112052531 | 153 |
| 272 | 3300025914 | Ga0207671_10145482 | Ga0207671_101454822 | 153 |
| 273 | 3300025915 | Ga0207693_10013984 | Ga0207693_100139848 | 153 |
| 274 | 3300025915 | Ga0207693_10021233 | Ga0207693_100212334 | 153 |
| 275 | 3300025915 | Ga0207693_10066064 | Ga0207693_100660641 | 153 |
| 276 | 3300025916 | Ga0207663_10047518 | Ga0207663_100475182 | 153 |
| 277 | 3300025916 | Ga0207663_10072514 | Ga0207663_100725144 | 153 |
| 278 | 3300025916 | Ga0207663_10140946 | Ga0207663_101409463 | 153 |
| 279 | 3300025917 | Ga0207660_10399160 | Ga0207660_103991602 | 153 |
| 280 | 3300025918 | Ga0207662_10061769 | Ga0207662_100617694 | 153 |
| 281 | 3300025919 | Ga0207657_10092785 | Ga0207657_100927852 | 153 |
| 282 | 3300025920 | Ga0207649_10110308 | Ga0207649_101103082 | 153 |
| 283 | 3300025920 | Ga0207649_10444832 | Ga0207649_104448321 | 153 |
| 284 | 3300025920 | Ga0207649_10521698 | Ga0207649_105216981 | 153 |
| 285 | 3300025921 | Ga0207652_10633181 | Ga0207652_106331811 | 153 |
| 286 | 3300025922 | Ga0207646_10449344 | Ga0207646_104493442 | 153 |
| 287 | 3300025926 | Ga0207659_10116163 | Ga0207659_101161633 | 153 |
| 288 | 3300025928 | Ga0207700_10045730 | Ga0207700_100457302 | 153 |
| 289 | 3300025928 | Ga0207700_10301304 | Ga0207700_103013041 | 153 |
| 290 | 3300025929 | Ga0207664_10201131 | Ga0207664_102011313 | 153 |
| 291 | 3300025929 | Ga0207664_11629177 | Ga0207664_116291771 | 153 |
| 292 | 3300025931 | Ga0207644_10710694 | Ga0207644_107106941 | 153 |
| 293 | 3300025931 | Ga0207644_11219885 | Ga0207644_112198851 | 153 |
| 294 | 3300025933 | Ga0207706_10001779 | Ga0207706_1000177921 | 153 |
| 295 | 3300025933 | Ga0207706_10585015 | Ga0207706_105850151 | 153 |
| 296 | 3300025935 | Ga0207709_11214219 | Ga0207709_112142191 | 153 |
| 297 | 3300025936 | Ga0207670_10188449 | Ga0207670_101884491 | 153 |
| 298 | 3300025938 | Ga0207704_10052470 | Ga0207704_100524702 | 153 |
| 299 | 3300025939 | Ga0207665_10003101 | Ga0207665_100031018 | 153 |
| 300 | 3300025939 | Ga0207665_10032249 | Ga0207665_100322497 | 153 |
| 301 | 3300025940 | Ga0207691_10014229 | Ga0207691_1001422911 | 153 |
| 302 | 3300025942 | Ga0207689_10024325 | Ga0207689_100243254 | 153 |
| 303 | 3300025942 | Ga0207689_10571077 | Ga0207689_105710771 | 153 |
| 304 | 3300025949 | Ga0207667_10290196 | Ga0207667_102901961 | 153 |
| 305 | 3300025949 | Ga0207667_10848154 | Ga0207667_108481542 | 153 |
| 306 | 3300025960 | Ga0207651_10089023 | Ga0207651_100890234 | 153 |
| 307 | 3300025961 | Ga0207712_10028233 | Ga0207712_100282338 | 153 |
| 308 | 3300025972 | Ga0207668_10334791 | Ga0207668_103347911 | 153 |
| 309 | 3300025972 | Ga0207668_10519713 | Ga0207668_105197132 | 153 |
| 310 | 3300025981 | Ga0207640_10115254 | Ga0207640_101152542 | 153 |
| 311 | 3300025986 | Ga0207658_10534794 | Ga0207658_105347941 | 153 |
| 312 | 3300026023 | Ga0207677_10159831 | Ga0207677_101598312 | 153 |
| 313 | 3300026023 | Ga0207677_10682519 | Ga0207677_106825191 | 153 |
| 314 | 3300026035 | Ga0207703_10092926 | Ga0207703_100929263 | 153 |
| 315 | 3300026041 | Ga0207639_11055527 | Ga0207639_110555271 | 153 |
| 316 | 3300026067 | Ga0207678_10004671 | Ga0207678_1000467114 | 153 |
| 317 | 3300026067 | Ga0207678_10207359 | Ga0207678_102073592 | 153 |
| 318 | 3300026075 | Ga0207708_10001428 | Ga0207708_100014282 | 153 |
| 319 | 3300026078 | Ga0207702_11196580 | Ga0207702_111965801 | 153 |
| 320 | 3300026088 | Ga0207641_10161728 | Ga0207641_101617282 | 153 |
| 321 | 3300026089 | Ga0207648_10023316 | Ga0207648_100233163 | 153 |
| 322 | 3300026095 | Ga0207676_10229124 | Ga0207676_102291242 | 153 |
| 323 | 3300026095 | Ga0207676_10556798 | Ga0207676_105567982 | 153 |
| 324 | 3300026116 | Ga0207674_10118625 | Ga0207674_101186255 | 153 |
| 325 | 3300026118 | Ga0207675_100001777 | Ga0207675_10000177710 | 153 |
| 326 | 3300026121 | Ga0207683_10016920 | Ga0207683_100169208 | 153 |
| 327 | 3300027907 | Ga0207428_10688353 | Ga0207428_106883532 | 153 |
| 328 | 3300028379 | Ga0268266_10174676 | Ga0268266_101746762 | 153 |
| 329 | 3300028380 | Ga0268265_10404171 | Ga0268265_104041712 | 153 |
| 330 | 3300028380 | Ga0268265_10980893 | Ga0268265_109808932 | 153 |
| 331 | 3300028381 | Ga0268264_11387256 | Ga0268264_113872561 | 153 |
| 332 | 3300031239 | Ga0265328_10007157 | Ga0265328_100071572 | 153 |
| 333 | 3300031665 | Ga0316575_10328023 | Ga0316575_103280232 | 153 |
| 334 | 3300031712 | Ga0265342_10016851 | Ga0265342_100168515 | 153 |
| 335 | 3300031727 | Ga0316576_10008140 | Ga0316576_100081407 | 153 |
| 336 | 3300031727 | Ga0316576_10416010 | Ga0316576_104160102 | 153 |
| 337 | 3300031731 | Ga0307405_10000124 | Ga0307405_1000012413 | 153 |
| 338 | 3300031903 | Ga0307407_10000024 | Ga0307407_100000245 | 153 |
| 339 | 3300031911 | Ga0307412_10000004 | Ga0307412_10000004367 | 153 |
| 340 | 3300032002 | Ga0307416_100000037 | Ga0307416_10000003726 | 153 |
| 341 | 3300032004 | Ga0307414_10000477 | Ga0307414_1000047710 | 153 |
| 342 | 3300032004 | Ga0307414_10007084 | Ga0307414_100070844 | 153 |
| 343 | 3300032004 | Ga0307414_10023212 | Ga0307414_100232125 | 153 |
| 344 | 3300032004 | Ga0307414_10062991 | Ga0307414_100629912 | 153 |
| 345 | 3300032004 | Ga0307414_10663755 | Ga0307414_106637551 | 153 |
| 346 | 3300032004 | Ga0307414_10709093 | Ga0307414_107090931 | 153 |
| 347 | 3300032126 | Ga0307415_100420644 | Ga0307415_1004206442 | 153 |
| 348 | 3300035083 | Ga0373926_0017741 | Ga0373926_0017741_1817_2326 | 153 |
| 349 | 3300035083 | Ga0373926_0195730 | Ga0373926_0195730_73_582 | 153 |
| 350 | 3300035089 | Ga0373944_0263074 | Ga0373944_0263074_76_585 | 153 |
| 351 | 3300035113 | Ga0373936_0008396 | Ga0373936_0008396_2274_2783 | 153 |
| 352 | 3300035114 | Ga0373939_0034395 | Ga0373939_0034395_138_647 | 153 |
| 353 | 3300035116 | Ga0373945_0013269 | Ga0373945_0013269_2086_2595 | 153 |
| 354 | 3300035118 | Ga0373954_0268092 | Ga0373954_0268092_193_690 | 153 |
| 355 | 3300035118 | Ga0373954_0455726 | Ga0373954_0455726_110_619 | 153 |
| 356 | 3300035170 | Ga0373943_0002541 | Ga0373943_0002541_6492_7001 | 153 |
| 357 | 3300035170 | Ga0373943_0244126 | Ga0373943_0244126_402_911 | 153 |
| 358 | 3300035171 | Ga0373946_0001624 | Ga0373946_0001624_5999_6508 | 153 |
| 359 | 3300035171 | Ga0373946_0276453 | Ga0373946_0276453_258_767 | 153 |
| 360 | 3300035172 | Ga0373955_0015035 | Ga0373955_0015035_1442_1936 | 153 |
| 361 | 3300035172 | Ga0373955_0363482 | Ga0373955_0363482_66_575 | 153 |
| 362 | 3300035241 | Ga0373961_0162029 | Ga0373961_0162029_152_661 | 153 |
| 363 | 3300035242 | Ga0373962_0108799 | Ga0373962_0108799_240_746 | 153 |
| 364 | 3300035398 | Ga0316574_0000617 | Ga0316574_0000617_14183_14674 | 153 |
| 365 | 3300035398 | Ga0316574_0002473 | Ga0316574_0002473_1039_1533 | 153 |
| 366 | 3300035398 | Ga0316574_0183952 | Ga0316574_0183952_345_839 | 153 |
| 367 | 3300035398 | Ga0316574_0704480 | Ga0316574_0704480_99_590 | 153 |
| 368 | 3300035410 | Ga0373924_0067417 | Ga0373924_0067417_792_1286 | 153 |
| 369 | 3300035410 | Ga0373924_0214357 | Ga0373924_0214357_236_745 | 153 |
| 370 | 3300035692 | Ga0373935_0036974 | Ga0373935_0036974_1243_1752 | 153 |
| 371 | 3300035695 | Ga0373927_0036244 | Ga0373927_0036244_929_1438 | 153 |
| 372 | 3300035695 | Ga0373927_0132986 | Ga0373927_0132986_508_1017 | 153 |
| 373 | 3300035724 | Ga0373933_0170112 | Ga0373933_0170112_635_1129 | 153 |
| 374 | 3300035725 | Ga0373947_0007075 | Ga0373947_0007075_4647_5156 | 153 |
| 375 | 3300035725 | Ga0373947_0057470 | Ga0373947_0057470_608_1117 | 153 |
| 376 | 3300036401 | Ga0373937_0007210 | Ga0373937_0007210_882_1376 | 153 |
| 377 | 3300036647 | Ga0316582_0051307 | Ga0316582_0051307_12_506 | 153 |
| 378 | 3300036712 | Ga0316584_0108949 | Ga0316584_0108949_534_1019 | 153 |
| 379 | 3300036712 | Ga0316584_0187266 | Ga0316584_0187266_370_861 | 153 |
| 380 | 3300037068 | Ga0373925_0112019 | Ga0373925_0112019_418_927 | 153 |
| 381 | 3300037068 | Ga0373925_0212679 | Ga0373925_0212679_508_1017 | 153 |
| 382 | 3300037312 | Ga0395899_0024753 | Ga0395899_0024753_1574_2071 | 153 |
| 383 | 3300037418 | Ga0395900_0020334 | Ga0395900_0020334_5980_6477 | 153 |
| 384 | 3300037418 | Ga0395900_0160661 | Ga0395900_0160661_1757_2266 | 153 |
| 385 | 3300037466 | Ga0395898_0074320 | Ga0395898_0074320_551_1048 | 153 |
| 386 | 3300037466 | Ga0395898_0145263 | Ga0395898_0145263_116_625 | 153 |
| 387 | 3300037471 | Ga0395905_0100025 | Ga0395905_0100025_1040_1549 | 153 |
| 388 | 3300037853 | Ga0436364_1481812 | Ga0436364_1481812_498_1007 | 153 |
| 389 | 3300038443 | Ga0395901_0015210 | Ga0395901_0015210_4119_4616 | 153 |
| 390 | 3300038443 | Ga0395901_0304646 | Ga0395901_0304646_510_1019 | 153 |
| 391 | 3300039437 | Ga0436365_0282095 | Ga0436365_0282095_36_548 | 153 |
| 392 | 3300039438 | Ga0436360_0765232 | Ga0436360_0765232_1688_2197 | 153 |
| 393 | 3300039447 | Ga0436361_0123121 | Ga0436361_0123121_103_612 | 153 |
| 394 | 3300039447 | Ga0436361_0615857 | Ga0436361_0615857_2453_2962 | 153 |
| 395 | 3300041503 | Ga0451847_0973357 | Ga0451847_0973357_297_806 | 153 |
| 396 | 3300041505 | Ga0451849_1045727 | Ga0451849_1045727_404_913 | 153 |
| 397 | 3300041512 | Ga0451853_2315819 | Ga0451853_2315819_262_771 | 153 |
| 398 | 3300042013 | Ga0439456_130778 | Ga0439456_130778_24_536 | 153 |
| 399 | 3300044684 | Ga0466966_0097617 | Ga0466966_0097617_1219_1716 | 153 |
| 400 | 3300044712 | Ga0453684_2036152 | Ga0453684_2036152_41_559 | 153 |
| 401 | 3300045051 | Ga0451576_0011502 | Ga0451576_0011502_9451_9948 | 153 |
| 402 | 3300046453 | Ga0495627_129887 | Ga0495627_129887_151_612 | 153 |
| 403 | 3300046455 | Ga0495603_0042192 | Ga0495603_0042192_1802_2311 | 153 |
| 404 | 3300046455 | Ga0495603_0091294 | Ga0495603_0091294_634_1143 | 153 |
| 405 | 3300046457 | Ga0495590_0085057 | Ga0495590_0085057_266_778 | 153 |
| 406 | 3300046457 | Ga0495590_0137170 | Ga0495590_0137170_80_589 | 153 |
| 407 | 3300046460 | Ga0495638_0122956 | Ga0495638_0122956_600_1112 | 153 |
| 408 | 3300046463 | Ga0495653_0206391 | Ga0495653_0206391_796_1305 | 153 |
| 409 | 3300046463 | Ga0495653_0389697 | Ga0495653_0389697_195_704 | 153 |
| 410 | 3300046472 | Ga0495580_0147595 | Ga0495580_0147595_106_615 | 153 |
| 411 | 3300046473 | Ga0495582_0014215 | Ga0495582_0014215_3468_3977 | 153 |
| 412 | 3300046473 | Ga0495582_0089285 | Ga0495582_0089285_655_1164 | 153 |
| 413 | 3300046473 | Ga0495582_0246377 | Ga0495582_0246377_88_597 | 153 |
| 414 | 3300046475 | Ga0495639_0124220 | Ga0495639_0124220_288_797 | 153 |
| 415 | 3300046476 | Ga0495662_0046426 | Ga0495662_0046426_732_1241 | 153 |
| 416 | 3300046491 | Ga0495584_0002062 | Ga0495584_0002062_9760_10272 | 153 |
| 417 | 3300046491 | Ga0495584_0015685 | Ga0495584_0015685_2712_3221 | 153 |
| 418 | 3300046491 | Ga0495584_0032865 | Ga0495584_0032865_208_717 | 153 |
| 419 | 3300046491 | Ga0495584_0285596 | Ga0495584_0285596_184_693 | 153 |
| 420 | 3300046492 | Ga0495585_0233178 | Ga0495585_0233178_327_836 | 153 |
| 421 | 3300046499 | Ga0495594_0076500 | Ga0495594_0076500_609_1118 | 153 |
| 422 | 3300046501 | Ga0495607_0202009 | Ga0495607_0202009_23_532 | 153 |
| 423 | 3300046501 | Ga0495607_0266714 | Ga0495607_0266714_187_696 | 153 |
| 424 | 3300046511 | Ga0495608_0497921 | Ga0495608_0497921_12_521 | 153 |
| 425 | 3300046512 | Ga0495610_0000045 | Ga0495610_0000045_42455_42916 | 153 |
| 426 | 3300046512 | Ga0495610_0000329 | Ga0495610_0000329_32418_32879 | 153 |
| 427 | 3300046514 | Ga0495618_0093956 | Ga0495618_0093956_1343_1852 | 153 |
| 428 | 3300046515 | Ga0495620_0050725 | Ga0495620_0050725_158_667 | 153 |
| 429 | 3300046516 | Ga0495628_0512412 | Ga0495628_0512412_311_805 | 153 |
| 430 | 3300046517 | Ga0495630_0348054 | Ga0495630_0348054_439_948 | 153 |
| 431 | 3300046519 | Ga0495632_0163131 | Ga0495632_0163131_327_836 | 153 |
| 432 | 3300046520 | Ga0495637_0047045 | Ga0495637_0047045_370_879 | 153 |
| 433 | 3300046520 | Ga0495637_0095504 | Ga0495637_0095504_692_1153 | 153 |
| 434 | 3300046522 | Ga0495643_0139047 | Ga0495643_0139047_339_848 | 153 |
| 435 | 3300046523 | Ga0495644_0031597 | Ga0495644_0031597_507_1016 | 153 |
| 436 | 3300046525 | Ga0495663_0076147 | Ga0495663_0076147_410_919 | 153 |
| 437 | 3300046526 | Ga0495666_0033689 | Ga0495666_0033689_1083_1592 | 153 |
| 438 | 3300046526 | Ga0495666_0165317 | Ga0495666_0165317_136_645 | 153 |
| 439 | 3300046528 | Ga0495642_0148524 | Ga0495642_0148524_194_703 | 153 |
| 440 | 3300046530 | Ga0495654_0285459 | Ga0495654_0285459_128_637 | 153 |
| 441 | 3300046531 | Ga0495665_0223413 | Ga0495665_0223413_288_797 | 153 |
| 442 | 3300046533 | Ga0495640_0128079 | Ga0495640_0128079_837_1346 | 153 |
| 443 | 3300046533 | Ga0495640_0198126 | Ga0495640_0198126_118_627 | 153 |
| 444 | 3300046536 | Ga0495587_0523851 | Ga0495587_0523851_128_625 | 153 |
| 445 | 3300046537 | Ga0495598_0001481 | Ga0495598_0001481_3420_3929 | 153 |
| 446 | 3300046538 | Ga0495609_0174608 | Ga0495609_0174608_274_783 | 153 |
| 447 | 3300046559 | Ga0495667_0133817 | Ga0495667_0133817_862_1371 | 153 |
| 448 | 3300046615 | Ga0495656_0021206 | Ga0495656_0021206_903_1412 | 153 |
| 449 | 3300046615 | Ga0495656_0222424 | Ga0495656_0222424_362_871 | 153 |
| 450 | 3300046616 | Ga0495668_0073818 | Ga0495668_0073818_912_1421 | 153 |
| 451 | 3300046616 | Ga0495668_0140565 | Ga0495668_0140565_724_1233 | 153 |
| 452 | 3300046642 | Ga0495634_0196991 | Ga0495634_0196991_368_877 | 153 |
| 453 | 3300046648 | Ga0495611_0117487 | Ga0495611_0117487_631_1140 | 153 |
| 454 | 3300046648 | Ga0495611_0258636 | Ga0495611_0258636_237_749 | 153 |
| 455 | 3300046660 | Ga0495625_0349079 | Ga0495625_0349079_393_902 | 153 |
| 456 | 3300046660 | Ga0495625_0821340 | Ga0495625_0821340_62_523 | 153 |
| 457 | 3300046663 | Ga0495635_0172509 | Ga0495635_0172509_534_1043 | 153 |
| 458 | 3300046664 | Ga0495659_0008153 | Ga0495659_0008153_350_859 | 153 |
| 459 | 3300046664 | Ga0495659_0094573 | Ga0495659_0094573_107_616 | 153 |
| 460 | 3300046665 | Ga0495661_0112410 | Ga0495661_0112410_525_1034 | 153 |
| 461 | 3300046665 | Ga0495661_0421804 | Ga0495661_0421804_67_576 | 153 |
| 462 | 3300046674 | Ga0495588_0068735 | Ga0495588_0068735_935_1444 | 153 |
| 463 | 3300046678 | Ga0495599_0654510 | Ga0495599_0654510_86_580 | 153 |
| 464 | 3300046681 | Ga0495647_0012713 | Ga0495647_0012713_1926_2435 | 153 |
| 465 | 3300046681 | Ga0495647_0373535 | Ga0495647_0373535_19_528 | 153 |
| 466 | 3300046683 | Ga0495658_0062204 | Ga0495658_0062204_222_731 | 153 |
| 467 | 3300046683 | Ga0495658_0176686 | Ga0495658_0176686_45_554 | 153 |
| 468 | 3300046684 | Ga0495669_0196503 | Ga0495669_0196503_432_941 | 153 |
| 469 | 3300046684 | Ga0495669_0359349 | Ga0495669_0359349_117_626 | 153 |
| 470 | 3300046689 | Ga0495613_0133902 | Ga0495613_0133902_51_560 | 153 |
| 471 | 3300046690 | Ga0495624_0166688 | Ga0495624_0166688_802_1311 | 153 |
| 472 | 3300046690 | Ga0495624_0675924 | Ga0495624_0675924_70_579 | 153 |
| 473 | 3300046691 | Ga0495670_0076056 | Ga0495670_0076056_389_898 | 153 |
| 474 | 3300046691 | Ga0495670_0663428 | Ga0495670_0663428_44_553 | 153 |
| 475 | 3300046794 | Ga0495589_0052863 | Ga0495589_0052863_579_1088 | 153 |
| 476 | 3300046794 | Ga0495589_0378976 | Ga0495589_0378976_82_591 | 153 |
| 477 | 3300046810 | Ga0495660_0234121 | Ga0495660_0234121_224_733 | 153 |
| 478 | 3300047315 | Ga0495581_0508633 | Ga0495581_0508633_169_678 | 153 |
| 479 | 3300047320 | Ga0495672_0169930 | Ga0495672_0169930_458_967 | 153 |
| 480 | 3300047321 | Ga0495676_0016979 | Ga0495676_0016979_2574_3083 | 153 |
| 481 | 3300047321 | Ga0495676_0129890 | Ga0495676_0129890_1202_1711 | 153 |
| 482 | 3300047323 | Ga0495683_0090783 | Ga0495683_0090783_742_1251 | 153 |
| 483 | 3300047446 | Ga0495679_039302 | Ga0495679_039302_404_913 | 153 |
| 484 | 3300047472 | Ga0495686_0337277 | Ga0495686_0337277_27_524 | 153 |
| 485 | 3300047673 | Ga0495593_0024050 | Ga0495593_0024050_2053_2562 | 153 |
| 486 | 3300048088 | Ga0495602_0670899 | Ga0495602_0670899_86_583 | 153 |
| 487 | 3300048903 | Ga0496100_0046625 | Ga0496100_0046625_581_1090 | 153 |
| 488 | 3300048903 | Ga0496100_0164529 | Ga0496100_0164529_964_1473 | 153 |
| 489 | 3300048904 | Ga0496101_0062581 | Ga0496101_0062581_2065_2574 | 153 |
| 490 | 3300048904 | Ga0496101_0110523 | Ga0496101_0110523_1128_1637 | 153 |
| 491 | 3300048904 | Ga0496101_0315289 | Ga0496101_0315289_200_709 | 153 |
| 492 | 3300048904 | Ga0496101_0520066 | Ga0496101_0520066_30_539 | 153 |
| 493 | 3300048905 | Ga0496102_0057096 | Ga0496102_0057096_1602_2111 | 153 |
| 494 | 3300048905 | Ga0496102_0083544 | Ga0496102_0083544_559_1068 | 153 |
| 495 | 3300048905 | Ga0496102_0105955 | Ga0496102_0105955_1488_1997 | 153 |
| 496 | 3300048905 | Ga0496102_0382815 | Ga0496102_0382815_55_564 | 153 |
| 497 | 3300048905 | Ga0496102_0505164 | Ga0496102_0505164_110_619 | 153 |
| 498 | 3300048906 | Ga0496103_0007060 | Ga0496103_0007060_1351_1860 | 153 |
| 499 | 3300048906 | Ga0496103_0039098 | Ga0496103_0039098_1442_1951 | 153 |
| 500 | 3300048906 | Ga0496103_0391251 | Ga0496103_0391251_11_517 | 153 |
| 501 | 3300048907 | Ga0496104_0001526 | Ga0496104_0001526_17247_17756 | 153 |
| 502 | 3300048907 | Ga0496104_0002719 | Ga0496104_0002719_4962_5471 | 153 |
| 503 | 3300048907 | Ga0496104_0004554 | Ga0496104_0004554_4273_4782 | 153 |
| 504 | 3300048907 | Ga0496104_0055837 | Ga0496104_0055837_2474_2983 | 153 |
| 505 | 3300048908 | Ga0496105_0002373 | Ga0496105_0002373_13034_13543 | 153 |
| 506 | 3300048908 | Ga0496105_0014281 | Ga0496105_0014281_3738_4247 | 153 |
| 507 | 3300048908 | Ga0496105_0022845 | Ga0496105_0022845_1073_1582 | 153 |
| 508 | 3300048908 | Ga0496105_0109297 | Ga0496105_0109297_440_949 | 153 |
| 509 | 3300048909 | Ga0496106_0150503 | Ga0496106_0150503_110_619 | 153 |
| 510 | 3300048909 | Ga0496106_0178550 | Ga0496106_0178550_873_1382 | 153 |
| 511 | 3300048910 | Ga0496107_0065105 | Ga0496107_0065105_698_1207 | 153 |
| 512 | 3300048910 | Ga0496107_0132177 | Ga0496107_0132177_489_998 | 153 |
| 513 | 3300048910 | Ga0496107_0165321 | Ga0496107_0165321_609_1118 | 153 |
| 514 | 3300048910 | Ga0496107_0196651 | Ga0496107_0196651_746_1255 | 153 |
| 515 | 3300048910 | Ga0496107_0242398 | Ga0496107_0242398_638_1135 | 153 |
| 516 | 3300048911 | Ga0496108_0016959 | Ga0496108_0016959_1441_1950 | 153 |
| 517 | 3300048911 | Ga0496108_0068969 | Ga0496108_0068969_1143_1652 | 153 |
| 518 | 3300048911 | Ga0496108_0164591 | Ga0496108_0164591_455_964 | 153 |
| 519 | 3300048911 | Ga0496108_0185262 | Ga0496108_0185262_508_1017 | 153 |
| 520 | 3300048912 | Ga0496109_0002911 | Ga0496109_0002911_11055_11564 | 153 |
| 521 | 3300048912 | Ga0496109_0037918 | Ga0496109_0037918_2315_2824 | 153 |
| 522 | 3300048912 | Ga0496109_0074081 | Ga0496109_0074081_1221_1730 | 153 |
| 523 | 3300048912 | Ga0496109_0669253 | Ga0496109_0669253_333_842 | 153 |
| 524 | 3300048912 | Ga0496109_1560568 | Ga0496109_1560568_41_550 | 153 |
| 525 | 3300048913 | Ga0496110_0012106 | Ga0496110_0012106_1896_2405 | 153 |
| 526 | 3300048913 | Ga0496110_0024954 | Ga0496110_0024954_489_998 | 153 |
| 527 | 3300048913 | Ga0496110_0287294 | Ga0496110_0287294_887_1396 | 153 |
| 528 | 3300048913 | Ga0496110_1283811 | Ga0496110_1283811_58_567 | 153 |
| 529 | 3300048914 | Ga0496111_0011310 | Ga0496111_0011310_4984_5493 | 153 |
| 530 | 3300048914 | Ga0496111_0098104 | Ga0496111_0098104_605_1114 | 153 |
| 531 | 3300048914 | Ga0496111_0576818 | Ga0496111_0576818_138_647 | 153 |
| 532 | 3300048915 | Ga0496112_0019868 | Ga0496112_0019868_3559_4068 | 153 |
| 533 | 3300048915 | Ga0496112_0025277 | Ga0496112_0025277_1896_2405 | 153 |
| 534 | 3300048915 | Ga0496112_0402896 | Ga0496112_0402896_413_922 | 153 |
| 535 | 3300048915 | Ga0496112_1032652 | Ga0496112_1032652_97_606 | 153 |
| 536 | 3300048916 | Ga0496113_0000438 | Ga0496113_0000438_14514_15023 | 153 |
| 537 | 3300048916 | Ga0496113_0202073 | Ga0496113_0202073_150_659 | 153 |
| 538 | 3300048916 | Ga0496113_0293813 | Ga0496113_0293813_109_618 | 153 |
| 539 | 3300048916 | Ga0496113_0904046 | Ga0496113_0904046_28_537 | 153 |
| 540 | 3300048917 | Ga0496114_0013133 | Ga0496114_0013133_1956_2465 | 153 |
| 541 | 3300048917 | Ga0496114_0073769 | Ga0496114_0073769_988_1497 | 153 |
| 542 | 3300048917 | Ga0496114_0094034 | Ga0496114_0094034_1105_1614 | 153 |
| 543 | 3300048918 | Ga0496115_0055603 | Ga0496115_0055603_2356_2865 | 153 |
| 544 | 3300048918 | Ga0496115_0074877 | Ga0496115_0074877_1955_2464 | 153 |
| 545 | 3300048918 | Ga0496115_0108138 | Ga0496115_0108138_719_1228 | 153 |
| 546 | 3300048918 | Ga0496115_0198868 | Ga0496115_0198868_1097_1606 | 153 |
| 547 | 3300048918 | Ga0496115_0306727 | Ga0496115_0306727_735_1244 | 153 |
| 548 | 3300048918 | Ga0496115_0481436 | Ga0496115_0481436_466_963 | 153 |
| 549 | 3300048924 | Ga0496121_0003431 | Ga0496121_0003431_10800_11297 | 153 |
| 550 | 3300048925 | Ga0496122_0001629 | Ga0496122_0001629_1738_2199 | 153 |
| 551 | 3300048926 | Ga0496123_0000906 | Ga0496123_0000906_44087_44548 | 153 |
| 552 | 3300048927 | Ga0496124_0690235 | Ga0496124_0690235_54_548 | 153 |
| 553 | 3300048928 | Ga0496125_0206798 | Ga0496125_0206798_801_1262 | 153 |
| 554 | 3300048929 | Ga0496126_0016480 | Ga0496126_0016480_1661_2158 | 153 |
| 555 | 3300048929 | Ga0496126_0190763 | Ga0496126_0190763_332_829 | 153 |
| 556 | 3300049568 | Ga0501031_0003015 | Ga0501031_0003015_805_1326 | 153 |
| 557 | 3300049569 | Ga0501032_0247253 | Ga0501032_0247253_356_877 | 153 |
| 558 | 3300049570 | Ga0501033_0083990 | Ga0501033_0083990_1534_2055 | 153 |
| 559 | 3300049571 | Ga0501034_0156136 | Ga0501034_0156136_834_1355 | 153 |
| 560 | 3300049571 | Ga0501034_0322581 | Ga0501034_0322581_363_872 | 153 |
| 561 | 3300049572 | Ga0501036_0130895 | Ga0501036_0130895_885_1406 | 153 |
| 562 | 3300049574 | Ga0501038_0291082 | Ga0501038_0291082_262_783 | 153 |
| 563 | 3300049576 | Ga0501040_0742395 | Ga0501040_0742395_172_681 | 153 |
| 564 | 3300049577 | Ga0501041_0279235 | Ga0501041_0279235_131_640 | 153 |
| 565 | 3300049577 | Ga0501041_0356381 | Ga0501041_0356381_391_876 | 153 |
| 566 | 3300049579 | Ga0501043_0512928 | Ga0501043_0512928_286_807 | 153 |
| 567 | 3300049579 | Ga0501043_1018177 | Ga0501043_1018177_52_561 | 153 |
| 568 | 3300049581 | Ga0501047_0210018 | Ga0501047_0210018_822_1325 | 153 |
| 569 | 3300049582 | Ga0501048_0654025 | Ga0501048_0654025_92_601 | 153 |
| 570 | 3300049584 | Ga0501068_0090545 | Ga0501068_0090545_1310_1819 | 153 |
| 571 | 3300049585 | Ga0501069_0275280 | Ga0501069_0275280_200_709 | 153 |
| 572 | 3300049586 | Ga0501070_0086786 | Ga0501070_0086786_1847_2356 | 153 |
| 573 | 3300049586 | Ga0501070_0449854 | Ga0501070_0449854_333_854 | 153 |
| 574 | 3300049586 | Ga0501070_0863275 | Ga0501070_0863275_22_531 | 153 |
| 575 | 3300049588 | Ga0501072_0211276 | Ga0501072_0211276_967_1476 | 153 |
| 576 | 3300049590 | Ga0501074_0353724 | Ga0501074_0353724_329_838 | 153 |
| 577 | 3300049590 | Ga0501074_0741965 | Ga0501074_0741965_118_627 | 153 |
| 578 | 3300049590 | Ga0501074_0805200 | Ga0501074_0805200_16_525 | 153 |
| 579 | 3300049591 | Ga0501075_0134980 | Ga0501075_0134980_1229_1738 | 153 |
| 580 | 3300049591 | Ga0501075_0198855 | Ga0501075_0198855_354_839 | 153 |
| 581 | 3300049592 | Ga0501076_0200435 | Ga0501076_0200435_41_550 | 153 |
| 582 | 3300049592 | Ga0501076_0315405 | Ga0501076_0315405_146_631 | 153 |
| 583 | 3300049592 | Ga0501076_0422270 | Ga0501076_0422270_483_992 | 153 |
| 584 | 3300049593 | Ga0501077_0027098 | Ga0501077_0027098_2887_3396 | 153 |
| 585 | 3300049682 | Ga0501252_016884 | Ga0501252_016884_46_549 | 153 |
| 586 | 3300049741 | Ga0501079_0086393 | Ga0501079_0086393_1895_2404 | 153 |
| 587 | 3300049741 | Ga0501079_0812376 | Ga0501079_0812376_143_652 | 153 |
| 588 | 3300049742 | Ga0501080_0102658 | Ga0501080_0102658_1829_2338 | 153 |
| 589 | 3300049742 | Ga0501080_0605314 | Ga0501080_0605314_220_729 | 153 |
| 590 | 3300049742 | Ga0501080_1403791 | Ga0501080_1403791_69_578 | 153 |
| 591 | 3300049743 | Ga0501081_0183731 | Ga0501081_0183731_945_1454 | 153 |
| 592 | 3300049743 | Ga0501081_0517738 | Ga0501081_0517738_236_745 | 153 |
| 593 | 3300049758 | Ga0501241_003227 | Ga0501241_003227_1607_2068 | 153 |
| 594 | 3300049822 | Ga0501035_0225766 | Ga0501035_0225766_452_973 | 153 |
| 595 | 3300049823 | Ga0501044_0261350 | Ga0501044_0261350_268_771 | 153 |
| 596 | 3300049824 | Ga0501045_0109882 | Ga0501045_0109882_1180_1689 | 153 |
| 597 | 3300050492 | nmdc:mga0yw44_276465_c1 | nmdc:mga0yw44_276465_c1_443_952 | 153 |
| 598 | 3300050492 | nmdc:mga0yw44_312690_c1 | nmdc:mga0yw44_312690_c1_326_835 | 153 |
| 599 | 3300050492 | nmdc:mga0yw44_34166_c1 | nmdc:mga0yw44_34166_c1_2375_2884 | 153 |
| 600 | 3300050492 | nmdc:mga0yw44_626643_c1 | nmdc:mga0yw44_626643_c1_16_525 | 153 |
| 601 | 3300050492 | nmdc:mga0yw44_87583_c1 | nmdc:mga0yw44_87583_c1_95_604 | 153 |
| 602 | 3300050495 | nmdc:mga04h51_291439_c1 | nmdc:mga04h51_291439_c1_73_582 | 153 |
| 603 | 3300050507 | nmdc:mga05p37_108351_c1 | nmdc:mga05p37_108351_c1_2637_3143 | 153 |
| 604 | 3300050507 | nmdc:mga05p37_199748_c1 | nmdc:mga05p37_199748_c1_660_1169 | 153 |
| 605 | 3300050507 | nmdc:mga05p37_34403_c1 | nmdc:mga05p37_34403_c1_3371_3880 | 153 |
| 606 | 3300050507 | nmdc:mga05p37_367150_c1 | nmdc:mga05p37_367150_c1_915_1424 | 153 |
| 607 | 3300050507 | nmdc:mga05p37_4993_c1 | nmdc:mga05p37_4993_c1_3927_4436 | 153 |
| 608 | 3300050508 | nmdc:mga09592_44194_c1 | nmdc:mga09592_44194_c1_2741_3247 | 153 |
| 609 | 3300050508 | nmdc:mga09592_52542_c1 | nmdc:mga09592_52542_c1_1301_1810 | 153 |
| 610 | 3300050509 | nmdc:mga0qj67_212097_c1 | nmdc:mga0qj67_212097_c1_1001_1510 | 153 |
| 611 | 3300050509 | nmdc:mga0qj67_83_c1 | nmdc:mga0qj67_83_c1_20960_21466 | 153 |
| 612 | 3300050510 | nmdc:mga06r32_1272653_c1 | nmdc:mga06r32_1272653_c1_137_643 | 153 |
| 613 | 3300050510 | nmdc:mga06r32_25066_c1 | nmdc:mga06r32_25066_c1_953_1462 | 153 |
| 614 | 3300050510 | nmdc:mga06r32_259924_c1 | nmdc:mga06r32_259924_c1_661_1170 | 153 |
| 615 | 3300050510 | nmdc:mga06r32_362432_c1 | nmdc:mga06r32_362432_c1_261_758 | 153 |
| 616 | 3300050511 | nmdc:mga08y16_1137082_c1 | nmdc:mga08y16_1137082_c1_116_625 | 153 |
| 617 | 3300050511 | nmdc:mga08y16_142421_c1 | nmdc:mga08y16_142421_c1_193_702 | 153 |
| 618 | 3300050512 | nmdc:mga0n895_141084_c1 | nmdc:mga0n895_141084_c1_349_858 | 153 |
| 619 | 3300050512 | nmdc:mga0n895_236465_c1 | nmdc:mga0n895_236465_c1_1204_1713 | 153 |
| 620 | 3300050512 | nmdc:mga0n895_623985_c1 | nmdc:mga0n895_623985_c1_37_546 | 153 |
| 621 | 3300050512 | nmdc:mga0n895_70025_c1 | nmdc:mga0n895_70025_c1_2807_3316 | 153 |
| 622 | 3300050512 | nmdc:mga0n895_76758_c1 | nmdc:mga0n895_76758_c1_2487_2996 | 153 |
| 623 | 3300050513 | nmdc:mga0rr50_182233_c1 | nmdc:mga0rr50_182233_c1_1151_1660 | 153 |
| 624 | 3300050513 | nmdc:mga0rr50_231994_c1 | nmdc:mga0rr50_231994_c1_271_780 | 153 |
| 625 | 3300050515 | nmdc:mga0a205_127324_c1 | nmdc:mga0a205_127324_c1_1152_1661 | 153 |
| 626 | 3300050515 | nmdc:mga0a205_59177_c1 | nmdc:mga0a205_59177_c1_1113_1622 | 153 |
| 627 | 3300053077 | Ga0495601_0091840 | Ga0495601_0091840_859_1368 | 153 |
| 628 | 3300053077 | Ga0495601_0100294 | Ga0495601_0100294_903_1397 | 153 |
| 629 | 3300053077 | Ga0495601_0216083 | Ga0495601_0216083_250_759 | 153 |
| 630 | 3300053078 | Ga0495612_0137262 | Ga0495612_0137262_230_739 | 153 |
| 631 | 3300053083 | Ga0495655_0004837 | Ga0495655_0004837_796_1305 | 153 |
| 632 | 3300053084 | Ga0495595_0115426 | Ga0495595_0115426_337_846 | 153 |
| 633 | 3300053085 | Ga0495619_0670344 | Ga0495619_0670344_20_529 | 153 |
| 634 | 3300053093 | Ga0500651_0000207 | Ga0500651_0000207_6047_6508 | 153 |
| 635 | 3300053096 | Ga0500641_0189197 | Ga0500641_0189197_140_649 | 153 |
| 636 | 3300053153 | Ga0500616_0143260 | Ga0500616_0143260_372_872 | 153 |
| 637 | 3300054114 | Ga0501084_0174742 | Ga0501084_0174742_1063_1563 | 153 |
| 638 | 3300054114 | Ga0501084_0375844 | Ga0501084_0375844_122_631 | 153 |
| 639 | 3300060353 | Ga0501082_0057982 | Ga0501082_0057982_2784_3293 | 153 |
| 640 | 3300060353 | Ga0501082_0632172 | Ga0501082_0632172_64_573 | 153 |
| 641 | 3300061734 | Ga0530510_0404773 | Ga0530510_0404773_302_811 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9676 | 2 | 146 |
| 1qjc-assembly1.cif.gz_B | phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine | 0.9636 | 2 | 147 |
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9636 | 2 | 146 |
| 4f3r-assembly3.cif.gz_C | structure of phosphopantetheine adenylyltransferase (cbu_0288) from coxiella burnetii | 0.9609 | 1 | 152 |
| 6b7d-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine | 0.9609 | 2 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f3rC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9688 | 1 | 152 | 3.40.50.620 |
| 3nd7D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9518 | 2 | 153 | 3.40.50.620 |
| 4f3rC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9492 | 1 | 152 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.946 | 1 | 148 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9384 | 1 | 149 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520CJY5-F1-model_v4 | Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) | 0.991 | 1 | 136 |
GO:0004595
GO:0005737 GO:0015937 |
| AF-A0A4R3KTT7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9896 | 2 | 151 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A2A5FK01-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9882 | 1 | 153 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A7C1DZP1-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9878 | 2 | 146 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A7C7FMZ9-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.987 | 2 | 148 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar