F471762

General Info

Members Datasets Scaffolds Average Seq Length
641 355 607 236

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100060431|Ga0070663_1000604314
Length 238
Sequence MSTLCPPSRRNWSRAAWISAAVAAMVGLALAAPEAFAHGVSDKDKLYIQSVSGVHALPYAYLGAKHMVTGYDHLLFLFGVIFFLYRLKDVVRYVTLFAVGHSITLLLGVLLNIHASPYIVDAIIGLSVVYKGFDNLGGEPNPRAAVLIFGFFHGFGLATKIQELAFSREGLLGNLISFNVGVEIGQFLALSMILIAMTFWRQTASFGRSAVFANGALMCAGFVLIGYQLSGLLQVTPS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899620 Rhizobium sp. Pop5 Isolate Nodule
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
5 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2738543018 Massilia sp. GV045 Isolate Unclassified
8 2738543030 Massilia sp. GV097 Isolate Unclassified
9 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
10 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
11 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
12 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
13 2818991436 Collimonas arenae 515 Isolate Unclassified
14 2818991450 Burkholderia sp. 604 Isolate Unclassified
15 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
16 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
17 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
20 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
21 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
22 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
23 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
24 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
25 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
26 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
27 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
28 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
29 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
30 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
310 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
311 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
312 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
313 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
314 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
315 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
316 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
319 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
320 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
321 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
322 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
335 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
342 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
343 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
350 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
351 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
352 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
353 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
354 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
355 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.23
Metatranscriptomes 0.47
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 1.09
Rhizoplane 2.65
Rhizosphere 82.22
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2810169 2162886007 Bacteria 4628
2 SwRhRL2b_contig_3606524 2162886007 Bacteria 6484
3 JGI24739J22299_10024580 3300001989 Bacteria 2123
4 Ga0055526_1000140 3300003771 Bacteria 63275
5 Ga0055537_1000113 3300003773 Bacteria 61047
6 Ga0055524_1017491 3300003775 Bacteria 2528
7 Ga0055534_1000023 3300003784 Bacteria 135301
8 Ga0055528_1000030 3300003790 Bacteria 121679
9 Ga0065704_10000381 3300005289 Bacteria 26659
10 Ga0065704_10000743 3300005289 Bacteria 24338
11 Ga0065712_10074421 3300005290 Bacteria 4099
12 Ga0065715_10091000 3300005293 Bacteria 6228
13 Ga0070658_10452842 3300005327 Bacteria 1106
14 Ga0070690_100012685 3300005330 Bacteria 4962
15 Ga0070670_100011405 3300005331 Bacteria 7601
16 Ga0070670_100056444 3300005331 Bacteria 3370
17 Ga0070670_100234080 3300005331 Bacteria 1599
18 Ga0068869_100001690 3300005334 Bacteria 13181
19 Ga0070666_10009275 3300005335 Bacteria 6132
20 Ga0070666_10016408 3300005335 Bacteria 4739
21 Ga0070666_10031767 3300005335 Bacteria 3487
22 Ga0070689_100002431 3300005340 Bacteria 12171
23 Ga0070687_100000745 3300005343 Bacteria 10806
24 Ga0070661_100057859 3300005344 Bacteria 2840
25 Ga0070668_100002999 3300005347 Bacteria 12474
26 Ga0070668_100008625 3300005347 Bacteria 7571
27 Ga0070668_100008723 3300005347 Bacteria 7530
28 Ga0070668_100269788 3300005347 Bacteria 1418
29 Ga0070669_100000081 3300005353 Bacteria 91877
30 Ga0070669_100000510 3300005353 Bacteria 29305
31 Ga0070669_100019080 3300005353 Bacteria 4902
32 Ga0070669_100102806 3300005353 Bacteria 2158
33 Ga0070675_100005984 3300005354 Bacteria 9321
34 Ga0070671_100005749 3300005355 Bacteria 9878
35 Ga0070671_100009303 3300005355 Bacteria 7889
36 Ga0070671_100107557 3300005355 Bacteria 2342
37 Ga0070674_100109976 3300005356 Bacteria 2022
38 Ga0070673_100011869 3300005364 Bacteria 5963
39 Ga0070659_100065043 3300005366 Bacteria 2888
40 Ga0070667_100221948 3300005367 Bacteria 1682
41 Ga0070667_100289517 3300005367 Bacteria 1472
42 Ga0070705_100025518 3300005440 Bacteria 3205
43 Ga0070663_100060431 3300005455 Bacteria 2726
44 Ga0070662_100024086 3300005457 Bacteria 4190
45 Ga0070662_100095391 3300005457 Bacteria 2242
46 Ga0068867_100163601 3300005459 Bacteria 1756
47 Ga0070685_10001937 3300005466 Bacteria 10750
48 Ga0070679_100836392 3300005530 Bacteria 864
49 Ga0068853_100047780 3300005539 Bacteria 3673
50 Ga0070672_100062494 3300005543 Bacteria 2939
51 Ga0070686_100006153 3300005544 Bacteria 6662
52 Ga0070665_100000227 3300005548 Bacteria 93439
53 Ga0070665_100000927 3300005548 Bacteria 37571
54 Ga0070665_100211516 3300005548 Bacteria 1940
55 Ga0068855_100245956 3300005563 Bacteria 1996
56 Ga0070664_100000407 3300005564 Bacteria 32028
57 Ga0070664_100280141 3300005564 Bacteria 1503
58 Ga0068857_100006474 3300005577 Bacteria 10042
59 Ga0068857_100176604 3300005577 Bacteria 1943
60 Ga0068854_100007020 3300005578 Bacteria 7185
61 Ga0070702_100000337 3300005615 Bacteria 16318
62 Ga0070702_100058102 3300005615 Bacteria 2240
63 Ga0068852_100005603 3300005616 Bacteria 9004
64 Ga0068852_100053366 3300005616 Bacteria 3479
65 Ga0068852_100340086 3300005616 Bacteria 1462
66 Ga0068852_100377511 3300005616 Bacteria 1390
67 Ga0068859_100005511 3300005617 Bacteria 12889
68 Ga0068864_100002840 3300005618 Bacteria 14309
69 Ga0068866_10190291 3300005718 Bacteria 1219
70 Ga0068861_100002090 3300005719 Bacteria 12948
71 Ga0068861_100017772 3300005719 Bacteria 5053
72 Ga0068851_10006290 3300005834 Bacteria 5419
73 Ga0068863_100004022 3300005841 Bacteria 14521
74 Ga0068863_100013953 3300005841 Bacteria 7745
75 Ga0068858_100000386 3300005842 Bacteria 46187
76 Ga0068858_100007537 3300005842 Bacteria 10519
77 Ga0068858_100053591 3300005842 Bacteria 3731
78 Ga0068858_100943901 3300005842 Bacteria 844
79 Ga0068860_100000719 3300005843 Bacteria 37763
80 Ga0068860_100023234 3300005843 Bacteria 5991
81 Ga0068860_100027388 3300005843 Bacteria 5490
82 Ga0068860_100030476 3300005843 Bacteria 5188
83 Ga0068862_100000044 3300005844 Bacteria 156665
84 Ga0068862_100000717 3300005844 Bacteria 33735
85 Ga0068862_100007978 3300005844 Bacteria 8758
86 Ga0068862_100018471 3300005844 Bacteria 5806
87 Ga0068862_100321379 3300005844 Bacteria 1429
88 Ga0068862_100533992 3300005844 Bacteria 1118
89 Ga0075363_100078589 3300006048 Bacteria 1801
90 Ga0075432_10003497 3300006058 Bacteria 5318
91 Ga0097621_100014346 3300006237 Bacteria 5928
92 Ga0068871_100085590 3300006358 Bacteria 2618
93 Ga0075428_100000169 3300006844 Bacteria 60729
94 Ga0075428_100032405 3300006844 Bacteria 5773
95 Ga0075430_100065220 3300006846 Bacteria 3059
96 Ga0075431_100001534 3300006847 Bacteria 21414
97 Ga0075431_100115893 3300006847 Bacteria 2766
98 Ga0075434_100143758 3300006871 Bacteria 2406
99 Ga0075429_100010561 3300006880 Bacteria 7985
100 Ga0075429_100133492 3300006880 Bacteria 2172
101 Ga0097620_100005511 3300006931 Bacteria 12889
102 Ga0075435_100135190 3300007076 Bacteria 2065
103 Ga0105240_10001044 3300009093 Bacteria 49217
104 Ga0105240_10043932 3300009093 Bacteria 5682
105 Ga0111539_10000211 3300009094 Bacteria 69441
106 Ga0111539_10036727 3300009094 Bacteria 5920
107 Ga0111539_10045457 3300009094 Bacteria 5256
108 Ga0105245_10827443 3300009098 Bacteria 965
109 Ga0105247_10001669 3300009101 Bacteria 15666
110 Ga0105247_10024848 3300009101 Bacteria 3612
111 Ga0114129_10005515 3300009147 Bacteria 17894
112 Ga0105241_10063864 3300009174 Bacteria 2842
113 Ga0105241_10250715 3300009174 Bacteria 1501
114 Ga0105248_10000481 3300009177 Bacteria 45536
115 Ga0105248_10027224 3300009177 Bacteria 6361
116 Ga0105248_10984768 3300009177 Bacteria 952
117 Ga0105237_10066212 3300009545 Bacteria 3608
118 Ga0105238_10006969 3300009551 Bacteria 11292
119 Ga0105238_10031389 3300009551 Bacteria 5408
120 Ga0105249_10000045 3300009553 Bacteria 182927
121 Ga0105249_10007119 3300009553 Bacteria 9765
122 Ga0105249_10010625 3300009553 Bacteria 8087
123 Ga0105249_10026864 3300009553 Bacteria 5190
124 Ga0105249_10059838 3300009553 Bacteria 3494
125 Ga0105239_10134079 3300010375 Bacteria 2756
126 Ga0105239_10310621 3300010375 Bacteria 1777
127 Ga0105239_10660568 3300010375 Bacteria 1194
128 Ga0105246_10083515 3300011119 Bacteria 2282
129 Ga0105246_10085753 3300011119 Bacteria 2256
130 Ga0105246_10250212 3300011119 Bacteria 1406
131 Ga0157370_10198314 3300013104 Bacteria 1862
132 Ga0157374_10052349 3300013296 Bacteria 3802
133 Ga0157378_10409737 3300013297 Bacteria 1337
134 Ga0163162_10005070 3300013306 Bacteria 12692
135 Ga0163162_10010863 3300013306 Bacteria 8863
136 Ga0163162_10206270 3300013306 Bacteria 2095
137 Ga0163163_10000701 3300014325 Bacteria 28457
138 Ga0163163_10712689 3300014325 Bacteria 1067
139 Ga0157380_10014944 3300014326 Bacteria 5692
140 Ga0157377_10004768 3300014745 Bacteria 6284
141 Ga0157379_10077036 3300014968 Bacteria 2986
142 Ga0157376_10030454 3300014969 Bacteria 4309
143 Ga0182006_1029609 3300015261 Bacteria 2217
144 Ga0182007_10000611 3300015262 Bacteria 20801
145 Ga0182007_10001540 3300015262 Bacteria 12294
146 Ga0182005_1000653 3300015265 Bacteria 16514
147 Ga0163161_10120631 3300017792 Bacteria 1970
148 Ga0163161_10143068 3300017792 Bacteria 1812
149 Ga0209148_1000227 3300025254 Bacteria 92428
150 Ga0209565_1000003 3300025263 Bacteria 1099648
151 Ga0209673_1000003 3300025273 Bacteria 980859
152 Ga0209675_1000003 3300025291 Bacteria 1003982
153 Ga0209564_1000012 3300025295 Bacteria 792078
154 Ga0209256_1000235 3300025299 Bacteria 98834
155 Ga0209051_1017508 3300025303 Bacteria 3200
156 Ga0209257_1000190 3300025304 Bacteria 153686
157 Ga0209257_1000467 3300025304 Bacteria 73784
158 Ga0207656_10008505 3300025321 Bacteria 3780
159 Ga0207696_1010931 3300025711 Bacteria 3301
160 Ga0207655_1013477 3300025728 Bacteria 4691
161 Ga0207713_1000492 3300025735 Bacteria 40745
162 Ga0207713_1002098 3300025735 Bacteria 14868
163 Ga0207713_1008187 3300025735 Bacteria 6050
164 Ga0207710_10001776 3300025900 Bacteria 10419
165 Ga0207680_10001300 3300025903 Bacteria 11819
166 Ga0207680_10011897 3300025903 Bacteria 4416
167 Ga0207680_10015898 3300025903 Bacteria 3938
168 Ga0207647_10000500 3300025904 Bacteria 31386
169 Ga0207647_10011593 3300025904 Bacteria 6173
170 Ga0207654_10076195 3300025911 Bacteria 2007
171 Ga0207654_10108026 3300025911 Bacteria 1726
172 Ga0207707_10123394 3300025912 Bacteria 2265
173 Ga0207695_10000007 3300025913 Bacteria 1092551
174 Ga0207695_10014078 3300025913 Bacteria 9499
175 Ga0207695_10079689 3300025913 Bacteria 3318
176 Ga0207671_10021376 3300025914 Bacteria 4909
177 Ga0207671_10077048 3300025914 Bacteria 2496
178 Ga0207660_10039700 3300025917 Bacteria 3292
179 Ga0207662_10001211 3300025918 Bacteria 12334
180 Ga0207681_10000630 3300025923 Bacteria 23561
181 Ga0207681_10003919 3300025923 Bacteria 9228
182 Ga0207681_10005572 3300025923 Bacteria 7734
183 Ga0207681_10091493 3300025923 Bacteria 2173
184 Ga0207694_10003986 3300025924 Bacteria 11641
185 Ga0207694_10005080 3300025924 Bacteria 10170
186 Ga0207650_10095707 3300025925 Bacteria 2276
187 Ga0207650_10122363 3300025925 Bacteria 2027
188 Ga0207650_10251191 3300025925 Unclassified 1432
189 Ga0207659_10006777 3300025926 Bacteria 7040
190 Ga0207644_10002093 3300025931 Bacteria 12926
191 Ga0207644_10007470 3300025931 Bacteria 7128
192 Ga0207644_10039125 3300025931 Bacteria 3346
193 Ga0207706_10004925 3300025933 Bacteria 12483
194 Ga0207706_10007815 3300025933 Bacteria 9870
195 Ga0207686_10394569 3300025934 Bacteria 1052
196 Ga0207670_10009198 3300025936 Bacteria 5623
197 Ga0207669_10221806 3300025937 Bacteria 1388
198 Ga0207669_10296729 3300025937 Bacteria 1226
199 Ga0207704_10010945 3300025938 Bacteria 4446
200 Ga0207691_10003092 3300025940 Bacteria 16238
201 Ga0207711_10003285 3300025941 Bacteria 14057
202 Ga0207711_10041672 3300025941 Bacteria 3910
203 Ga0207711_10158375 3300025941 Bacteria 2048
204 Ga0207689_10042532 3300025942 Bacteria 3758
205 Ga0207679_10012714 3300025945 Bacteria 5497
206 Ga0207667_10137182 3300025949 Bacteria 2519
207 Ga0207651_10028775 3300025960 Bacteria 3510
208 Ga0207712_10000169 3300025961 Bacteria 67461
209 Ga0207712_10000174 3300025961 Bacteria 66500
210 Ga0207712_10009969 3300025961 Bacteria 6021
211 Ga0207712_10045977 3300025961 Bacteria 3024
212 Ga0207712_10081715 3300025961 Bacteria 2354
213 Ga0207668_10013971 3300025972 Bacteria 4960
214 Ga0207668_10199429 3300025972 Bacteria 1592
215 Ga0207668_10417531 3300025972 Bacteria 1138
216 Ga0207640_10001595 3300025981 Bacteria 12185
217 Ga0207658_10025917 3300025986 Bacteria 4107
218 Ga0207658_10053665 3300025986 Bacteria 2979
219 Ga0207658_10633928 3300025986 Bacteria 962
220 Ga0207677_10081942 3300026023 Bacteria 2317
221 Ga0207703_10001066 3300026035 Bacteria 26163
222 Ga0207703_10039620 3300026035 Bacteria 3766
223 Ga0207703_10168827 3300026035 Bacteria 1923
224 Ga0207639_10001687 3300026041 Bacteria 14904
225 Ga0207678_10009490 3300026067 Bacteria 8558
226 Ga0207678_10117713 3300026067 Bacteria 2267
227 Ga0207708_10019290 3300026075 Bacteria 5139
228 Ga0207702_10261965 3300026078 Bacteria 1628
229 Ga0207641_10000930 3300026088 Bacteria 30233
230 Ga0207641_10001988 3300026088 Bacteria 19523
231 Ga0207641_10005043 3300026088 Bacteria 11314
232 Ga0207648_10027433 3300026089 Bacteria 5055
233 Ga0207676_10001544 3300026095 Bacteria 16997
234 Ga0207674_10008195 3300026116 Bacteria 12108
235 Ga0207674_10023959 3300026116 Bacteria 6528
236 Ga0207675_100001056 3300026118 Bacteria 27310
237 Ga0207698_10002253 3300026142 Bacteria 11416
238 Ga0207698_10056303 3300026142 Bacteria 3036
239 Ga0207698_10463224 3300026142 Bacteria 1226
240 Ga0209281_1006317 3300027111 Bacteria 3112
241 Ga0209983_1024293 3300027665 Bacteria 1275
242 Ga0209974_10017268 3300027876 Bacteria 2394
243 Ga0207428_10012513 3300027907 Bacteria 7450
244 Ga0207428_10018147 3300027907 Bacteria 6016
245 Ga0268266_10000006 3300028379 Bacteria 1410021
246 Ga0268266_10001167 3300028379 Bacteria 32520
247 Ga0268265_10000045 3300028380 Bacteria 180378
248 Ga0268265_10001502 3300028380 Bacteria 19459
249 Ga0268265_10009556 3300028380 Bacteria 6548
250 Ga0268265_10079359 3300028380 Bacteria 2584
251 Ga0268265_10084186 3300028380 Bacteria 2520
252 Ga0268264_10000524 3300028381 Bacteria 48665
253 Ga0268264_10014318 3300028381 Bacteria 6522
254 Ga0268264_10060345 3300028381 Bacteria 3179
255 Ga0268264_10063142 3300028381 Bacteria 3113
256 Ga0307517_10000058 3300028786 Bacteria 148725
257 Ga0307515_10000101 3300028794 Bacteria 199593
258 Ga0307515_10038042 3300028794 Bacteria 7712
259 Ga0307515_10069954 3300028794 Bacteria 4786
260 Ga0307509_10001175 3300031507 Bacteria 44735
261 Ga0307509_10002372 3300031507 Bacteria 30641
262 Ga0307408_100000004 3300031548 Bacteria 572889
263 Ga0307408_100001956 3300031548 Bacteria 14901
264 Ga0307408_100003404 3300031548 Bacteria 10909
265 Ga0307408_100020319 3300031548 Bacteria 4480
266 Ga0307408_100051401 3300031548 Bacteria 2968
267 Ga0307408_100070399 3300031548 Bacteria 2582
268 Ga0307408_100125360 3300031548 Bacteria 1996
269 Ga0307408_100172390 3300031548 Bacteria 1728
270 Ga0307408_100399522 3300031548 Bacteria 1180
271 Ga0307408_100493292 3300031548 Bacteria 1071
272 Ga0307508_10002424 3300031616 Bacteria 19668
273 Ga0307508_10017078 3300031616 Bacteria 6600
274 Ga0307514_10000560 3300031649 Bacteria 71030
275 Ga0307516_10000002 3300031730 Bacteria 467851
276 Ga0307516_10092183 3300031730 Bacteria 2857
277 Ga0307405_10000033 3300031731 Bacteria 96827
278 Ga0307405_10003174 3300031731 Bacteria 7478
279 Ga0307405_10076457 3300031731 Bacteria 2172
280 Ga0307413_10049451 3300031824 Bacteria 2520
281 Ga0307413_10332210 3300031824 Bacteria 1166
282 Ga0307410_10201688 3300031852 Bacteria 1519
283 Ga0307406_10013809 3300031901 Bacteria 4634
284 Ga0307406_10049685 3300031901 Bacteria 2655
285 Ga0307406_10096947 3300031901 Bacteria 1999
286 Ga0307406_10233033 3300031901 Bacteria 1376
287 Ga0307407_10396052 3300031903 Bacteria 989
288 Ga0307412_10000192 3300031911 Bacteria 42797
289 Ga0307412_10000366 3300031911 Bacteria 28099
290 Ga0307412_10002880 3300031911 Bacteria 9537
291 Ga0307412_10034550 3300031911 Bacteria 3222
292 Ga0307412_10079894 3300031911 Bacteria 2257
293 Ga0307409_100687550 3300031995 Bacteria 1021
294 Ga0307409_100828299 3300031995 Bacteria 935
295 Ga0307416_100098602 3300032002 Bacteria 2535
296 Ga0307416_100284282 3300032002 Bacteria 1633
297 Ga0307416_100327332 3300032002 Bacteria 1538
298 Ga0307416_100582527 3300032002 Bacteria 1196
299 Ga0307414_10000217 3300032004 Bacteria 37929
300 Ga0307414_10092835 3300032004 Bacteria 2248
301 Ga0307414_10113141 3300032004 Bacteria 2071
302 Ga0307414_10121468 3300032004 Bacteria 2009
303 Ga0307414_10338577 3300032004 Bacteria 1287
304 Ga0307414_10425698 3300032004 Bacteria 1159
305 Ga0307414_10537396 3300032004 Bacteria 1040
306 Ga0307411_10002212 3300032005 Bacteria 8470
307 Ga0307411_10059735 3300032005 Bacteria 2529
308 Ga0307411_10120724 3300032005 Bacteria 1896
309 Ga0307411_10421939 3300032005 Bacteria 1108
310 Ga0307415_100429595 3300032126 Bacteria 1136
311 Ga0307507_10059082 3300033179 Bacteria 3594
312 Ga0373958_0013596 3300034819 Bacteria 1412
313 Ga0373931_0021027 3300035691 Bacteria 3270
314 Ga0395899_0176686 3300037312 Bacteria 1501
315 Ga0395899_0442563 3300037312 Bacteria 852
316 Ga0395900_0011596 3300037418 Bacteria 9019
317 Ga0395900_0027038 3300037418 Bacteria 5873
318 Ga0395898_0169252 3300037466 Bacteria 2088
319 Ga0395905_0001243 3300037471 Bacteria 31598
320 Ga0395901_0074514 3300038443 Bacteria 3541
321 Ga0439447_001889 3300041407 Bacteria 7664
322 Ga0439442_028700 3300042002 Bacteria 1160
323 Ga0439432_001825 3300042006 Bacteria 7996
324 Ga0439432_047920 3300042006 Bacteria 1339
325 Ga0450906_000091 3300042145 Bacteria 15006
326 Ga0439459_0028362 3300042438 Bacteria 1123
327 Ga0439464_0026469 3300042439 Bacteria 1609
328 Ga0451576_0026526 3300045051 Bacteria 6232
329 Ga0495617_001818 3300046452 Bacteria 9086
330 Ga0495627_000001 3300046453 Bacteria 1104709
331 Ga0495627_001641 3300046453 Bacteria 12429
332 Ga0495592_0030598 3300046454 Bacteria 4071
333 Ga0495590_0000002 3300046457 Bacteria 485720
334 Ga0495590_0020628 3300046457 Bacteria 2341
335 Ga0495590_0060048 3300046457 Bacteria 1331
336 Ga0495591_004660 3300046458 Bacteria 6597
337 Ga0495638_0000126 3300046460 Bacteria 125113
338 Ga0495638_0003311 3300046460 Bacteria 12710
339 Ga0495638_0020048 3300046460 Bacteria 4419
340 Ga0495638_0037189 3300046460 Bacteria 3097
341 Ga0495651_0030812 3300046462 Bacteria 4182
342 Ga0495651_0113652 3300046462 Bacteria 1998
343 Ga0495653_0004514 3300046463 Bacteria 11242
344 Ga0495653_0006369 3300046463 Bacteria 9678
345 Ga0495650_0000291 3300046471 Bacteria 92452
346 Ga0495650_0004572 3300046471 Bacteria 9421
347 Ga0495605_0000116 3300046474 Bacteria 103357
348 Ga0495605_0001567 3300046474 Bacteria 14863
349 Ga0495605_0027386 3300046474 Bacteria 2954
350 Ga0495605_0042178 3300046474 Bacteria 2270
351 Ga0495605_0068552 3300046474 Bacteria 1681
352 Ga0495639_0003529 3300046475 Bacteria 6754
353 Ga0495584_0015154 3300046491 Bacteria 3926
354 Ga0495584_0039067 3300046491 Bacteria 2398
355 Ga0495584_0048457 3300046491 Bacteria 2142
356 Ga0495585_0006286 3300046492 Bacteria 7380
357 Ga0495596_0000139 3300046500 Bacteria 49660
358 Ga0495607_0000057 3300046501 Bacteria 110023
359 Ga0495607_0001363 3300046501 Bacteria 21775
360 Ga0495607_0001449 3300046501 Bacteria 21112
361 Ga0495607_0055832 3300046501 Bacteria 2270
362 Ga0495583_0000048 3300046506 Bacteria 217130
363 Ga0495583_0001854 3300046506 Bacteria 19698
364 Ga0495583_0016551 3300046506 Bacteria 3957
365 Ga0495606_0001736 3300046507 Bacteria 27992
366 Ga0495606_0003774 3300046507 Bacteria 15743
367 Ga0495606_0162465 3300046507 Bacteria 1302
368 Ga0495608_0040901 3300046511 Bacteria 3104
369 Ga0495610_0054249 3300046512 Bacteria 1937
370 Ga0495610_0068750 3300046512 Bacteria 1659
371 Ga0495616_0001690 3300046513 Bacteria 15055
372 Ga0495616_0008872 3300046513 Bacteria 5916
373 Ga0495616_0015263 3300046513 Bacteria 4272
374 Ga0495616_0083376 3300046513 Bacteria 1525
375 Ga0495628_0000797 3300046516 Bacteria 29081
376 Ga0495631_0045134 3300046518 Bacteria 1941
377 Ga0495632_0002572 3300046519 Bacteria 13709
378 Ga0495632_0011453 3300046519 Bacteria 5173
379 Ga0495632_0044748 3300046519 Bacteria 2208
380 Ga0495632_0234926 3300046519 Bacteria 826
381 Ga0495637_0000835 3300046520 Bacteria 20364
382 Ga0495637_0006203 3300046520 Bacteria 6015
383 Ga0495643_0000076 3300046522 Bacteria 166614
384 Ga0495643_0000383 3300046522 Bacteria 58554
385 Ga0495643_0000563 3300046522 Bacteria 45920
386 Ga0495643_0009593 3300046522 Bacteria 6006
387 Ga0495643_0160231 3300046522 Bacteria 1107
388 Ga0495644_0000994 3300046523 Bacteria 11798
389 Ga0495648_0000081 3300046524 Bacteria 125267
390 Ga0495648_0008164 3300046524 Bacteria 8261
391 Ga0495648_0129394 3300046524 Bacteria 1344
392 Ga0495663_0031944 3300046525 Bacteria 1566
393 Ga0495642_0000336 3300046528 Bacteria 25588
394 Ga0495642_0004808 3300046528 Bacteria 5223
395 Ga0495652_0003865 3300046529 Bacteria 14606
396 Ga0495652_0252026 3300046529 Bacteria 1307
397 Ga0495654_0000517 3300046530 Bacteria 31432
398 Ga0495654_0003493 3300046530 Bacteria 9594
399 Ga0495654_0007386 3300046530 Bacteria 6140
400 Ga0495587_0031499 3300046536 Bacteria 3211
401 Ga0495609_0000009 3300046538 Bacteria 354860
402 Ga0495609_0000481 3300046538 Bacteria 32044
403 Ga0495609_0000805 3300046538 Bacteria 23447
404 Ga0495609_0001357 3300046538 Bacteria 16491
405 Ga0495609_0194681 3300046538 Bacteria 849
406 Ga0495597_0000005 3300046542 Bacteria 286580
407 Ga0495597_0000657 3300046542 Bacteria 28084
408 Ga0495645_0109995 3300046543 Bacteria 1951
409 Ga0495622_0000250 3300046557 Bacteria 41868
410 Ga0495622_0138764 3300046557 Bacteria 1104
411 Ga0495633_0000182 3300046558 Bacteria 81881
412 Ga0495633_0100349 3300046558 Bacteria 1344
413 Ga0495656_0005296 3300046615 Bacteria 4444
414 Ga0495656_0057167 3300046615 Bacteria 1688
415 Ga0495656_0057738 3300046615 Bacteria 1681
416 Ga0495668_0000081 3300046616 Bacteria 157245
417 Ga0495668_0054982 3300046616 Bacteria 2198
418 Ga0495668_0198896 3300046616 Bacteria 1097
419 Ga0495625_0000075 3300046660 Bacteria 163672
420 Ga0495625_0000085 3300046660 Bacteria 151877
421 Ga0495625_0002309 3300046660 Bacteria 20852
422 Ga0495625_0019647 3300046660 Bacteria 5232
423 Ga0495625_0052942 3300046660 Bacteria 2905
424 Ga0495625_0083107 3300046660 Bacteria 2226
425 Ga0495625_0135114 3300046660 Bacteria 1668
426 Ga0495659_0091845 3300046664 Bacteria 1166
427 Ga0495661_0000032 3300046665 Bacteria 170076
428 Ga0495661_0000296 3300046665 Bacteria 56421
429 Ga0495661_0001556 3300046665 Bacteria 18911
430 Ga0495661_0002595 3300046665 Bacteria 13854
431 Ga0495661_0005929 3300046665 Bacteria 8635
432 Ga0495661_0046303 3300046665 Bacteria 2656
433 Ga0495661_0106028 3300046665 Bacteria 1573
434 Ga0495661_0119979 3300046665 Bacteria 1454
435 Ga0495661_0143402 3300046665 Bacteria 1297
436 Ga0495588_0000062 3300046674 Bacteria 253674
437 Ga0495657_0106721 3300046675 Bacteria 1778
438 Ga0495599_0118850 3300046678 Bacteria 1643
439 Ga0495623_0006238 3300046679 Bacteria 7756
440 Ga0495646_0012579 3300046680 Bacteria 5378
441 Ga0495646_0193574 3300046680 Bacteria 1110
442 Ga0495669_0003442 3300046684 Bacteria 6520
443 Ga0495669_0009489 3300046684 Bacteria 4104
444 Ga0495624_0065500 3300046690 Bacteria 2270
445 Ga0495670_0008160 3300046691 Bacteria 5148
446 Ga0495670_0013252 3300046691 Bacteria 4055
447 Ga0495670_0182532 3300046691 Bacteria 1108
448 Ga0495671_0011479 3300046692 Bacteria 4869
449 Ga0495649_0004303 3300046694 Bacteria 9342
450 Ga0495649_0007543 3300046694 Bacteria 6622
451 Ga0495649_0046939 3300046694 Bacteria 2350
452 Ga0495649_0051552 3300046694 Bacteria 2231
453 Ga0495589_0000022 3300046794 Bacteria 196021
454 Ga0495589_0000262 3300046794 Bacteria 43085
455 Ga0495600_0015479 3300046809 Bacteria 4821
456 Ga0495660_0000044 3300046810 Bacteria 150926
457 Ga0495660_0000885 3300046810 Bacteria 22126
458 Ga0495660_0021618 3300046810 Bacteria 3682
459 Ga0495660_0099572 3300046810 Bacteria 1498
460 Ga0495660_0103970 3300046810 Bacteria 1458
461 Ga0495660_0170272 3300046810 Bacteria 1061
462 Ga0495636_0003729 3300047318 Bacteria 5933
463 Ga0495636_0037815 3300047318 Bacteria 1994
464 Ga0495636_0049374 3300047318 Bacteria 1759
465 Ga0495672_0004947 3300047320 Bacteria 10700
466 Ga0495672_0005111 3300047320 Bacteria 10475
467 Ga0495672_0008750 3300047320 Bacteria 7420
468 Ga0495672_0009727 3300047320 Bacteria 6932
469 Ga0495672_0054831 3300047320 Bacteria 2328
470 Ga0495680_0035839 3300047322 Bacteria 3990
471 Ga0495683_0006780 3300047323 Bacteria 6226
472 Ga0495687_000024 3300047443 Bacteria 316676
473 Ga0495687_000030 3300047443 Bacteria 279992
474 Ga0495687_000036 3300047443 Bacteria 255427
475 Ga0495687_000099 3300047443 Bacteria 132139
476 Ga0495687_003585 3300047443 Bacteria 11130
477 Ga0495687_004614 3300047443 Bacteria 9206
478 Ga0495687_004678 3300047443 Bacteria 9119
479 Ga0495687_013260 3300047443 Bacteria 4313
480 Ga0495687_020999 3300047443 Bacteria 3171
481 Ga0495677_0000018 3300047445 Bacteria 120412
482 Ga0495677_0000180 3300047445 Bacteria 29724
483 Ga0495677_0002528 3300047445 Bacteria 7152
484 Ga0495677_0003843 3300047445 Bacteria 5814
485 Ga0495677_0018519 3300047445 Bacteria 2524
486 Ga0495677_0046428 3300047445 Bacteria 1594
487 Ga0495679_010064 3300047446 Bacteria 3741
488 Ga0495685_009501 3300047447 Bacteria 3251
489 Ga0495673_0004005 3300047469 Bacteria 9406
490 Ga0495673_0046905 3300047469 Bacteria 1912
491 Ga0495681_0000470 3300047470 Bacteria 30938
492 Ga0495681_0002740 3300047470 Bacteria 12472
493 Ga0495681_0009448 3300047470 Bacteria 6009
494 Ga0495686_0138949 3300047472 Bacteria 1434
495 Ga0495602_0009630 3300048088 Bacteria 10041
496 Ga0495602_0033932 3300048088 Bacteria 4780
497 Ga0495626_0000021 3300048091 Bacteria 217213
498 Ga0495626_0001492 3300048091 Bacteria 18472
499 Ga0495626_0001909 3300048091 Bacteria 15532
500 Ga0495626_0034766 3300048091 Bacteria 2409
501 Ga0496101_0131929 3300048904 Bacteria 1897
502 Ga0496101_0487975 3300048904 Unclassified 973
503 Ga0496102_0000141 3300048905 Bacteria 97499
504 Ga0496103_0000172 3300048906 Bacteria 67575
505 Ga0496103_0000714 3300048906 Bacteria 24603
506 Ga0496103_0029085 3300048906 Bacteria 3357
507 Ga0496104_0000114 3300048907 Bacteria 75253
508 Ga0496104_0096802 3300048907 Bacteria 2824
509 Ga0496105_0000073 3300048908 Bacteria 76800
510 Ga0496106_0090662 3300048909 Bacteria 2359
511 Ga0496107_0189216 3300048910 Bacteria 1529
512 Ga0496108_0002349 3300048911 Bacteria 15150
513 Ga0496110_0178143 3300048913 Bacteria 1930
514 Ga0496111_0108992 3300048914 Bacteria 2039
515 Ga0496112_0131310 3300048915 Bacteria 2475
516 Ga0496113_0001094 3300048916 Bacteria 14674
517 Ga0496113_0166974 3300048916 Bacteria 1742
518 Ga0496116_0027993 3300048919 Bacteria 4093
519 Ga0496117_0000296 3300048920 Bacteria 88277
520 Ga0496117_0028492 3300048920 Bacteria 4324
521 Ga0496118_0000897 3300048921 Bacteria 46751
522 Ga0496118_0009768 3300048921 Bacteria 9621
523 Ga0496118_0017593 3300048921 Bacteria 6495
524 Ga0496118_0034052 3300048921 Bacteria 4166
525 Ga0496119_0000040 3300048922 Bacteria 208180
526 Ga0496120_0001789 3300048923 Bacteria 24155
527 Ga0496120_0066595 3300048923 Bacteria 1992
528 Ga0496121_0000349 3300048924 Bacteria 96428
529 Ga0496121_0001289 3300048924 Bacteria 43185
530 Ga0496121_0021553 3300048924 Bacteria 6305
531 Ga0496122_0000456 3300048925 Bacteria 84896
532 Ga0496123_0000847 3300048926 Bacteria 48919
533 Ga0496124_0001770 3300048927 Bacteria 30051
534 Ga0496124_0091700 3300048927 Bacteria 2475
535 Ga0496124_0094798 3300048927 Bacteria 2426
536 Ga0496124_0173736 3300048927 Bacteria 1665
537 Ga0496125_0000603 3300048928 Bacteria 61238
538 Ga0496125_0004486 3300048928 Bacteria 16083
539 Ga0496125_0027411 3300048928 Bacteria 5163
540 Ga0496126_0000044 3300048929 Bacteria 335904
541 Ga0496126_0027600 3300048929 Bacteria 5420
542 Ga0496126_0051608 3300048929 Bacteria 3743
543 Ga0495678_000615 3300049459 Bacteria 33335
544 Ga0495678_001847 3300049459 Bacteria 15487
545 Ga0495678_031817 3300049459 Bacteria 2195
546 Ga0495682_0014455 3300049460 Bacteria 2993
547 Ga0501314_000711 3300049530 Bacteria 2171
548 Ga0501314_001936 3300049530 Bacteria 1558
549 Ga0501337_001475 3300049553 Bacteria 1351
550 Ga0501034_0034001 3300049571 Bacteria 5169
551 Ga0501068_0011711 3300049584 Bacteria 4959
552 Ga0501075_0091181 3300049591 Bacteria 2313
553 Ga0501076_0113575 3300049592 Bacteria 2191
554 Ga0501198_006436 3300049649 Bacteria 1673
555 Ga0501217_019324 3300049661 Bacteria 1590
556 Ga0501222_000088 3300049662 Bacteria 24766
557 Ga0501223_000023 3300049663 Bacteria 64396
558 Ga0501224_000001 3300049664 Bacteria 308131
559 Ga0501227_000017 3300049665 Bacteria 25575
560 Ga0501235_004663 3300049669 Bacteria 2964
561 Ga0501235_012178 3300049669 Bacteria 1890
562 Ga0501240_022192 3300049673 Bacteria 964
563 Ga0501225_0000012 3300049705 Bacteria 73262
564 Ga0501225_0051679 3300049705 Bacteria 1145
565 Ga0501234_002530 3300049707 Bacteria 2876
566 Ga0501241_017251 3300049758 Bacteria 1319
567 Ga0501269_000062 3300049766 Bacteria 33601
568 Ga0501212_033239 3300049851 Bacteria 837
569 Ga0501226_000009 3300049853 Bacteria 194138
570 Ga0501226_000133 3300049853 Bacteria 14424
571 Ga0501226_001644 3300049853 Bacteria 2829
572 nmdc:mga03683_143629_c1 3300050489 Bacteria 1074
573 nmdc:mga0k408_142875_c1 3300050493 Bacteria 1424
574 nmdc:mga05p37_185292_c1 3300050507 Bacteria 2531
575 nmdc:mga09592_3175_c1 3300050508 Bacteria 13343
576 nmdc:mga0qj67_31712_c1 3300050509 Bacteria 4119
577 nmdc:mga0qj67_90370_c1 3300050509 Bacteria 2460
578 nmdc:mga06r32_304_c1 3300050510 Bacteria 40653
579 nmdc:mga06r32_7531_c1 3300050510 Bacteria 9790
580 nmdc:mga08y16_185997_c1 3300050511 Bacteria 2156
581 nmdc:mga08y16_26669_c1 3300050511 Bacteria 6089
582 nmdc:mga08y16_67_c1 3300050511 Bacteria 46512
583 nmdc:mga0n895_419829_c1 3300050512 Bacteria 1352
584 nmdc:mga0a205_184726_c1 3300050515 Bacteria 1978
585 Ga0495601_0014913 3300053077 Bacteria 4691
586 Ga0500578_0170688 3300053086 Bacteria 1345
587 Ga0500647_0023348 3300053091 Bacteria 2901
588 Ga0500651_0176328 3300053093 Bacteria 1271
589 Ga0500641_0109166 3300053096 Bacteria 1190
590 Ga0500555_001005 3300053103 Bacteria 9632
591 Ga0500556_0036718 3300053104 Bacteria 1701
592 Ga0500594_0095383 3300053118 Bacteria 909
593 Ga0500595_000649 3300053119 Bacteria 20941
594 Ga0500614_014410 3300053123 Bacteria 1750
595 Ga0500642_0076847 3300053130 Bacteria 1527
596 Ga0500655_000020 3300053133 Bacteria 44643
597 Ga0500658_0097414 3300053134 Bacteria 1280
598 Ga0500568_0005368 3300053139 Bacteria 6638
599 Ga0500568_0011431 3300053139 Bacteria 4120
600 Ga0500590_000179 3300053148 Bacteria 18932
601 Ga0500590_018523 3300053148 Bacteria 3603
602 Ga0500619_000597 3300053154 Bacteria 6164
603 Ga0500622_0009642 3300053156 Bacteria 5336
604 Ga0500622_0038508 3300053156 Bacteria 2493
605 Ga0500622_0067288 3300053156 Bacteria 1817
606 Ga0500639_021723 3300053163 Bacteria 3391
607 Ga0500636_0037424 3300053177 Bacteria 2871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10001044 Ga0105240_1000104432 196
2 3300009545 Ga0105237_10066212 Ga0105237_100662124 196
3 3300009551 Ga0105238_10006969 Ga0105238_100069695 196
4 3300010375 Ga0105239_10310621 Ga0105239_103106213 196
5 3300048921 Ga0496118_0034052 Ga0496118_0034052_852_1517 196
6 3300005548 Ga0070665_100000927 Ga0070665_10000092717 200
7 3300028379 Ga0268266_10001167 Ga0268266_1000116726 200
8 3300031901 Ga0307406_10013809 Ga0307406_100138092 200
9 3300048904 Ga0496101_0487975 Ga0496101_0487975_17_670 200
10 3300009093 Ga0105240_10043932 Ga0105240_100439325 201
11 3300009174 Ga0105241_10063864 Ga0105241_100638643 201
12 3300010375 Ga0105239_10134079 Ga0105239_101340793 201
13 3300025911 Ga0207654_10076195 Ga0207654_100761952 201
14 3300009098 Ga0105245_10827443 Ga0105245_108274431 203
15 3300009174 Ga0105241_10250715 Ga0105241_102507152 203
16 3300009177 Ga0105248_10984768 Ga0105248_109847682 203
17 3300009551 Ga0105238_10031389 Ga0105238_100313891 203
18 3300009553 Ga0105249_10007119 Ga0105249_1000711910 203
19 3300013104 Ga0157370_10198314 Ga0157370_101983142 203
20 3300013296 Ga0157374_10052349 Ga0157374_100523495 203
21 3300014325 Ga0163163_10712689 Ga0163163_107126891 203
22 3300031649 Ga0307514_10000560 Ga0307514_1000056068 203
23 3300037312 Ga0395899_0442563 Ga0395899_0442563_16_741 203
24 3300037418 Ga0395900_0011596 Ga0395900_0011596_6245_6970 203
25 3300037466 Ga0395898_0169252 Ga0395898_0169252_1348_2073 203
26 3300041407 Ga0439447_001889 Ga0439447_001889_6361_7083 203
27 3300046507 Ga0495606_0003774 Ga0495606_0003774_3942_4667 203
28 3300047443 Ga0495687_000036 Ga0495687_000036_187613_188338 203
29 3300005290 Ga0065712_10074421 Ga0065712_100744212 205
30 3300005293 Ga0065715_10091000 Ga0065715_100910007 205
31 3300005330 Ga0070690_100012685 Ga0070690_1000126855 205
32 3300005331 Ga0070670_100011405 Ga0070670_1000114053 205
33 3300005334 Ga0068869_100001690 Ga0068869_10000169012 205
34 3300005335 Ga0070666_10031767 Ga0070666_100317674 205
35 3300005340 Ga0070689_100002431 Ga0070689_1000024313 205
36 3300005343 Ga0070687_100000745 Ga0070687_10000074514 205
37 3300005347 Ga0070668_100002999 Ga0070668_10000299911 205
38 3300005347 Ga0070668_100269788 Ga0070668_1002697882 205
39 3300005353 Ga0070669_100019080 Ga0070669_1000190804 205
40 3300005353 Ga0070669_100102806 Ga0070669_1001028062 205
41 3300005354 Ga0070675_100005984 Ga0070675_1000059842 205
42 3300005355 Ga0070671_100107557 Ga0070671_1001075574 205
43 3300005356 Ga0070674_100109976 Ga0070674_1001099763 205
44 3300005364 Ga0070673_100011869 Ga0070673_1000118694 205
45 3300005366 Ga0070659_100065043 Ga0070659_1000650432 205
46 3300005440 Ga0070705_100025518 Ga0070705_1000255184 205
47 3300005457 Ga0070662_100095391 Ga0070662_1000953912 205
48 3300005459 Ga0068867_100163601 Ga0068867_1001636012 205
49 3300005530 Ga0070679_100836392 Ga0070679_1008363921 205
50 3300005543 Ga0070672_100062494 Ga0070672_1000624942 205
51 3300005544 Ga0070686_100006153 Ga0070686_1000061532 205
52 3300005564 Ga0070664_100000407 Ga0070664_1000004074 205
53 3300005577 Ga0068857_100006474 Ga0068857_10000647411 205
54 3300005615 Ga0070702_100000337 Ga0070702_10000033718 205
55 3300005615 Ga0070702_100058102 Ga0070702_1000581022 205
56 3300005616 Ga0068852_100377511 Ga0068852_1003775112 205
57 3300005617 Ga0068859_100005511 Ga0068859_1000055113 205
58 3300005618 Ga0068864_100002840 Ga0068864_1000028403 205
59 3300005718 Ga0068866_10190291 Ga0068866_101902912 205
60 3300005719 Ga0068861_100002090 Ga0068861_1000020902 205
61 3300005719 Ga0068861_100017772 Ga0068861_1000177723 205
62 3300005841 Ga0068863_100004022 Ga0068863_1000040222 205
63 3300005842 Ga0068858_100053591 Ga0068858_1000535914 205
64 3300005843 Ga0068860_100023234 Ga0068860_1000232343 205
65 3300005844 Ga0068862_100000717 Ga0068862_1000007172 205
66 3300005844 Ga0068862_100007978 Ga0068862_1000079784 205
67 3300005844 Ga0068862_100533992 Ga0068862_1005339922 205
68 3300006237 Ga0097621_100014346 Ga0097621_1000143463 205
69 3300006358 Ga0068871_100085590 Ga0068871_1000855902 205
70 3300006844 Ga0075428_100000169 Ga0075428_10000016920 205
71 3300006844 Ga0075428_100032405 Ga0075428_1000324055 205
72 3300006846 Ga0075430_100065220 Ga0075430_1000652202 205
73 3300006847 Ga0075431_100001534 Ga0075431_10000153417 205
74 3300006847 Ga0075431_100115893 Ga0075431_1001158932 205
75 3300006871 Ga0075434_100143758 Ga0075434_1001437583 205
76 3300006880 Ga0075429_100010561 Ga0075429_1000105618 205
77 3300006880 Ga0075429_100133492 Ga0075429_1001334923 205
78 3300006931 Ga0097620_100005511 Ga0097620_10000551117 205
79 3300007076 Ga0075435_100135190 Ga0075435_1001351902 205
80 3300009094 Ga0111539_10000211 Ga0111539_1000021140 205
81 3300009094 Ga0111539_10036727 Ga0111539_100367274 205
82 3300009094 Ga0111539_10045457 Ga0111539_100454576 205
83 3300009147 Ga0114129_10005515 Ga0114129_1000551519 205
84 3300009177 Ga0105248_10000481 Ga0105248_1000048125 205
85 3300009553 Ga0105249_10010625 Ga0105249_1001062510 205
86 3300009553 Ga0105249_10059838 Ga0105249_100598382 205
87 3300010375 Ga0105239_10660568 Ga0105239_106605682 205
88 3300011119 Ga0105246_10083515 Ga0105246_100835153 205
89 3300011119 Ga0105246_10250212 Ga0105246_102502122 205
90 3300013297 Ga0157378_10409737 Ga0157378_104097372 205
91 3300013306 Ga0163162_10010863 Ga0163162_100108638 205
92 3300013306 Ga0163162_10206270 Ga0163162_102062703 205
93 3300014325 Ga0163163_10000701 Ga0163163_100007013 205
94 3300014745 Ga0157377_10004768 Ga0157377_100047683 205
95 3300014968 Ga0157379_10077036 Ga0157379_100770364 205
96 3300014969 Ga0157376_10030454 Ga0157376_100304543 205
97 3300017792 Ga0163161_10120631 Ga0163161_101206312 205
98 3300025903 Ga0207680_10015898 Ga0207680_100158983 205
99 3300025912 Ga0207707_10123394 Ga0207707_101233942 205
100 3300025917 Ga0207660_10039700 Ga0207660_100397003 205
101 3300025918 Ga0207662_10001211 Ga0207662_100012114 205
102 3300025923 Ga0207681_10005572 Ga0207681_100055726 205
103 3300025923 Ga0207681_10091493 Ga0207681_100914932 205
104 3300025925 Ga0207650_10122363 Ga0207650_101223632 205
105 3300025926 Ga0207659_10006777 Ga0207659_100067772 205
106 3300025931 Ga0207644_10039125 Ga0207644_100391254 205
107 3300025933 Ga0207706_10007815 Ga0207706_100078159 205
108 3300025936 Ga0207670_10009198 Ga0207670_100091984 205
109 3300025937 Ga0207669_10221806 Ga0207669_102218062 205
110 3300025937 Ga0207669_10296729 Ga0207669_102967292 205
111 3300025938 Ga0207704_10010945 Ga0207704_100109452 205
112 3300025940 Ga0207691_10003092 Ga0207691_1000309217 205
113 3300025941 Ga0207711_10041672 Ga0207711_100416722 205
114 3300025942 Ga0207689_10042532 Ga0207689_100425324 205
115 3300025945 Ga0207679_10012714 Ga0207679_100127143 205
116 3300025960 Ga0207651_10028775 Ga0207651_100287752 205
117 3300025961 Ga0207712_10009969 Ga0207712_100099696 205
118 3300025961 Ga0207712_10081715 Ga0207712_100817153 205
119 3300025972 Ga0207668_10013971 Ga0207668_100139714 205
120 3300025972 Ga0207668_10199429 Ga0207668_101994293 205
121 3300026035 Ga0207703_10039620 Ga0207703_100396202 205
122 3300026075 Ga0207708_10019290 Ga0207708_100192904 205
123 3300026088 Ga0207641_10001988 Ga0207641_1000198821 205
124 3300026089 Ga0207648_10027433 Ga0207648_100274332 205
125 3300026095 Ga0207676_10001544 Ga0207676_100015448 205
126 3300026116 Ga0207674_10008195 Ga0207674_100081957 205
127 3300026116 Ga0207674_10023959 Ga0207674_100239596 205
128 3300026118 Ga0207675_100001056 Ga0207675_1000010569 205
129 3300027907 Ga0207428_10012513 Ga0207428_100125133 205
130 3300027907 Ga0207428_10018147 Ga0207428_100181475 205
131 3300028380 Ga0268265_10001502 Ga0268265_1000150218 205
132 3300028380 Ga0268265_10009556 Ga0268265_100095565 205
133 3300028381 Ga0268264_10060345 Ga0268264_100603452 205
134 3300031548 Ga0307408_100125360 Ga0307408_1001253601 205
135 3300031616 Ga0307508_10017078 Ga0307508_100170782 205
136 3300031730 Ga0307516_10092183 Ga0307516_100921834 205
137 3300032002 Ga0307416_100284282 Ga0307416_1002842822 205
138 3300032004 Ga0307414_10113141 Ga0307414_101131412 205
139 3300032005 Ga0307411_10059735 Ga0307411_100597353 205
140 3300033179 Ga0307507_10059082 Ga0307507_100590824 205
141 3300034819 Ga0373958_0013596 Ga0373958_0013596_153_842 205
142 3300035691 Ga0373931_0021027 Ga0373931_0021027_2140_2829 205
143 3300042438 Ga0439459_0028362 Ga0439459_0028362_245_934 205
144 3300042439 Ga0439464_0026469 Ga0439464_0026469_886_1575 205
145 3300045051 Ga0451576_0026526 Ga0451576_0026526_2653_3342 205
146 3300046453 Ga0495627_000001 Ga0495627_000001_99654_100400 205
147 3300046660 Ga0495625_0083107 Ga0495625_0083107_1111_1842 205
148 3300048907 Ga0496104_0096802 Ga0496104_0096802_1084_1773 205
149 3300048909 Ga0496106_0090662 Ga0496106_0090662_700_1389 205
150 3300048915 Ga0496112_0131310 Ga0496112_0131310_1089_1778 205
151 3300048916 Ga0496113_0166974 Ga0496113_0166974_120_809 205
152 3300049591 Ga0501075_0091181 Ga0501075_0091181_673_1362 205
153 3300049592 Ga0501076_0113575 Ga0501076_0113575_1432_2121 205
154 3300049661 Ga0501217_019324 Ga0501217_019324_436_1125 205
155 3300049705 Ga0501225_0051679 Ga0501225_0051679_148_837 205
156 3300049851 Ga0501212_033239 Ga0501212_033239_21_710 205
157 3300050507 nmdc:mga05p37_185292_c1 nmdc:mga05p37_185292_c1_1358_2047 205
158 3300050508 nmdc:mga09592_3175_c1 nmdc:mga09592_3175_c1_5847_6536 205
159 3300050509 nmdc:mga0qj67_31712_c1 nmdc:mga0qj67_31712_c1_2187_2876 205
160 3300050510 nmdc:mga06r32_304_c1 nmdc:mga06r32_304_c1_36613_37302 205
161 3300050510 nmdc:mga06r32_7531_c1 nmdc:mga06r32_7531_c1_4363_5052 205
162 3300050511 nmdc:mga08y16_185997_c1 nmdc:mga08y16_185997_c1_922_1611 205
163 3300050511 nmdc:mga08y16_26669_c1 nmdc:mga08y16_26669_c1_2325_3014 205
164 3300050511 nmdc:mga08y16_67_c1 nmdc:mga08y16_67_c1_9209_9898 205
165 3300050512 nmdc:mga0n895_419829_c1 nmdc:mga0n895_419829_c1_349_1038 205
166 3300050515 nmdc:mga0a205_184726_c1 nmdc:mga0a205_184726_c1_394_1083 205
167 iso_pu_bacteria 2961064222 2961067904 205
168 3300032005 Ga0307411_10120724 Ga0307411_101207242 206
169 3300046660 Ga0495625_0000085 Ga0495625_0000085_46073_46777 206
170 iso_pu_bacteria 2904479285 2904479732 206
171 3300005455 Ga0070663_100060431 Ga0070663_1000604314 207
172 3300005466 Ga0070685_10001937 Ga0070685_100019377 207
173 3300005616 Ga0068852_100053366 Ga0068852_1000533664 207
174 3300025913 Ga0207695_10000007 Ga0207695_10000007198 207
175 3300025914 Ga0207671_10021376 Ga0207671_100213766 207
176 3300025924 Ga0207694_10005080 Ga0207694_100050809 207
177 3300026067 Ga0207678_10117713 Ga0207678_101177133 207
178 3300026142 Ga0207698_10056303 Ga0207698_100563033 207
179 3300031852 Ga0307410_10201688 Ga0307410_102016881 207
180 3300049584 Ga0501068_0011711 Ga0501068_0011711_1342_2043 207
181 iso_pu_bacteria 2791355123 2792746111 207
182 3300028786 Ga0307517_10000058 Ga0307517_10000058110 208
183 3300031548 Ga0307408_100493292 Ga0307408_1004932922 208
184 3300053156 Ga0500622_0009642 Ga0500622_0009642_3178_3882 208
185 3300053156 Ga0500622_0038508 Ga0500622_0038508_688_1392 208
186 iso_pu_bacteria 2519899620 2520382074 208
187 iso_pu_bacteria 2857553236 2857555438 208
188 iso_pu_bacteria 2958122699 2958127027 208
189 iso_pu_bacteria 2977872689 2977878304 208
190 3300031507 Ga0307509_10001175 Ga0307509_1000117542 209
191 3300031507 Ga0307509_10002372 Ga0307509_1000237226 209
192 3300031548 Ga0307408_100000004 Ga0307408_100000004487 209
193 3300031548 Ga0307408_100399522 Ga0307408_1003995222 209
194 3300031901 Ga0307406_10096947 Ga0307406_100969472 209
195 3300031995 Ga0307409_100687550 Ga0307409_1006875502 209
196 3300032004 Ga0307414_10425698 Ga0307414_104256981 209
197 3300046491 Ga0495584_0015154 Ga0495584_0015154_1698_2405 209
198 3300046538 Ga0495609_0194681 Ga0495609_0194681_15_722 209
199 3300046542 Ga0495597_0000657 Ga0495597_0000657_2652_3359 209
200 3300046660 Ga0495625_0052942 Ga0495625_0052942_1332_2039 209
201 3300047318 Ga0495636_0003729 Ga0495636_0003729_1752_2459 209
202 3300047318 Ga0495636_0037815 Ga0495636_0037815_54_761 209
203 3300047320 Ga0495672_0004947 Ga0495672_0004947_8402_9109 209
204 3300047320 Ga0495672_0009727 Ga0495672_0009727_6223_6921 209
205 3300047443 Ga0495687_013260 Ga0495687_013260_1739_2446 209
206 3300047445 Ga0495677_0003843 Ga0495677_0003843_1855_2562 209
207 3300049460 Ga0495682_0014455 Ga0495682_0014455_1258_1965 209
208 iso_pu_bacteria 2585427591 2585828605 209
209 iso_pu_bacteria 2808606395 2809032502 209
210 2162886007 SwRhRL2b_contig_3606524 SwRhRL2b_0789.00004390 210
211 3300001989 JGI24739J22299_10024580 JGI24739J22299_100245803 210
212 3300005289 Ga0065704_10000381 Ga0065704_1000038111 210
213 3300005327 Ga0070658_10452842 Ga0070658_104528421 210
214 3300005331 Ga0070670_100234080 Ga0070670_1002340802 210
215 3300005335 Ga0070666_10016408 Ga0070666_100164085 210
216 3300005347 Ga0070668_100008625 Ga0070668_1000086255 210
217 3300005347 Ga0070668_100008723 Ga0070668_1000087232 210
218 3300005353 Ga0070669_100000081 Ga0070669_10000008148 210
219 3300005353 Ga0070669_100000510 Ga0070669_1000005103 210
220 3300005355 Ga0070671_100005749 Ga0070671_1000057498 210
221 3300005355 Ga0070671_100009303 Ga0070671_1000093036 210
222 3300005367 Ga0070667_100221948 Ga0070667_1002219482 210
223 3300005841 Ga0068863_100013953 Ga0068863_1000139539 210
224 3300005842 Ga0068858_100007537 Ga0068858_1000075378 210
225 3300005842 Ga0068858_100943901 Ga0068858_1009439011 210
226 3300005843 Ga0068860_100027388 Ga0068860_1000273883 210
227 3300005843 Ga0068860_100030476 Ga0068860_1000304765 210
228 3300005844 Ga0068862_100018471 Ga0068862_1000184717 210
229 3300005844 Ga0068862_100321379 Ga0068862_1003213792 210
230 3300006058 Ga0075432_10003497 Ga0075432_100034975 210
231 3300009101 Ga0105247_10024848 Ga0105247_100248483 210
232 3300009177 Ga0105248_10027224 Ga0105248_100272245 210
233 3300009553 Ga0105249_10026864 Ga0105249_100268643 210
234 3300011119 Ga0105246_10085753 Ga0105246_100857532 210
235 3300013306 Ga0163162_10005070 Ga0163162_1000507010 210
236 3300015262 Ga0182007_10000611 Ga0182007_100006113 210
237 3300017792 Ga0163161_10143068 Ga0163161_101430683 210
238 3300025254 Ga0209148_1000227 Ga0209148_100022759 210
239 3300025303 Ga0209051_1017508 Ga0209051_10175082 210
240 3300025711 Ga0207696_1010931 Ga0207696_10109315 210
241 3300025735 Ga0207713_1000492 Ga0207713_100049230 210
242 3300025735 Ga0207713_1002098 Ga0207713_100209810 210
243 3300025735 Ga0207713_1008187 Ga0207713_10081877 210
244 3300025903 Ga0207680_10011897 Ga0207680_100118973 210
245 3300025904 Ga0207647_10011593 Ga0207647_100115934 210
246 3300025923 Ga0207681_10000630 Ga0207681_1000063017 210
247 3300025923 Ga0207681_10003919 Ga0207681_100039193 210
248 3300025925 Ga0207650_10251191 Ga0207650_102511911 210
249 3300025931 Ga0207644_10002093 Ga0207644_1000209310 210
250 3300025931 Ga0207644_10007470 Ga0207644_100074705 210
251 3300025941 Ga0207711_10003285 Ga0207711_100032855 210
252 3300025941 Ga0207711_10158375 Ga0207711_101583752 210
253 3300025961 Ga0207712_10045977 Ga0207712_100459774 210
254 3300025972 Ga0207668_10417531 Ga0207668_104175312 210
255 3300025986 Ga0207658_10025917 Ga0207658_100259174 210
256 3300026035 Ga0207703_10168827 Ga0207703_101688272 210
257 3300026088 Ga0207641_10000930 Ga0207641_1000093012 210
258 3300027111 Ga0209281_1006317 Ga0209281_10063174 210
259 3300028380 Ga0268265_10079359 Ga0268265_100793594 210
260 3300028380 Ga0268265_10084186 Ga0268265_100841863 210
261 3300028381 Ga0268264_10014318 Ga0268264_100143187 210
262 3300028381 Ga0268264_10063142 Ga0268264_100631425 210
263 3300028794 Ga0307515_10069954 Ga0307515_100699546 210
264 3300031548 Ga0307408_100001956 Ga0307408_1000019568 210
265 3300031548 Ga0307408_100003404 Ga0307408_10000340413 210
266 3300031548 Ga0307408_100020319 Ga0307408_1000203196 210
267 3300031548 Ga0307408_100070399 Ga0307408_1000703993 210
268 3300031548 Ga0307408_100172390 Ga0307408_1001723902 210
269 3300031731 Ga0307405_10000033 Ga0307405_1000003312 210
270 3300031731 Ga0307405_10003174 Ga0307405_100031745 210
271 3300031731 Ga0307405_10076457 Ga0307405_100764573 210
272 3300031824 Ga0307413_10332210 Ga0307413_103322102 210
273 3300031901 Ga0307406_10233033 Ga0307406_102330332 210
274 3300031903 Ga0307407_10396052 Ga0307407_103960521 210
275 3300031911 Ga0307412_10000192 Ga0307412_1000019218 210
276 3300031911 Ga0307412_10000366 Ga0307412_1000036618 210
277 3300031911 Ga0307412_10034550 Ga0307412_100345503 210
278 3300031911 Ga0307412_10079894 Ga0307412_100798944 210
279 3300032002 Ga0307416_100327332 Ga0307416_1003273322 210
280 3300032002 Ga0307416_100582527 Ga0307416_1005825272 210
281 3300032004 Ga0307414_10092835 Ga0307414_100928351 210
282 3300032005 Ga0307411_10002212 Ga0307411_100022126 210
283 3300032005 Ga0307411_10421939 Ga0307411_104219392 210
284 3300042002 Ga0439442_028700 Ga0439442_028700_212_934 210
285 3300042006 Ga0439432_001825 Ga0439432_001825_6615_7337 210
286 3300042006 Ga0439432_047920 Ga0439432_047920_51_773 210
287 3300042145 Ga0450906_000091 Ga0450906_000091_6650_7372 210
288 3300046452 Ga0495617_001818 Ga0495617_001818_7984_8706 210
289 3300046453 Ga0495627_001641 Ga0495627_001641_5072_5794 210
290 3300046457 Ga0495590_0000002 Ga0495590_0000002_176231_176947 210
291 3300046457 Ga0495590_0060048 Ga0495590_0060048_340_1062 210
292 3300046458 Ga0495591_004660 Ga0495591_004660_2458_3180 210
293 3300046460 Ga0495638_0000126 Ga0495638_0000126_21407_22123 210
294 3300046460 Ga0495638_0003311 Ga0495638_0003311_708_1430 210
295 3300046460 Ga0495638_0037189 Ga0495638_0037189_2138_2860 210
296 3300046471 Ga0495650_0000291 Ga0495650_0000291_21691_22407 210
297 3300046471 Ga0495650_0004572 Ga0495650_0004572_1567_2283 210
298 3300046474 Ga0495605_0000116 Ga0495605_0000116_10200_10901 210
299 3300046474 Ga0495605_0042178 Ga0495605_0042178_534_1256 210
300 3300046474 Ga0495605_0068552 Ga0495605_0068552_122_859 210
301 3300046475 Ga0495639_0003529 Ga0495639_0003529_3359_4075 210
302 3300046491 Ga0495584_0048457 Ga0495584_0048457_986_1708 210
303 3300046492 Ga0495585_0006286 Ga0495585_0006286_655_1377 210
304 3300046501 Ga0495607_0000057 Ga0495607_0000057_5226_5927 210
305 3300046501 Ga0495607_0055832 Ga0495607_0055832_173_895 210
306 3300046506 Ga0495583_0000048 Ga0495583_0000048_102994_103710 210
307 3300046506 Ga0495583_0001854 Ga0495583_0001854_15771_16493 210
308 3300046507 Ga0495606_0001736 Ga0495606_0001736_19192_19908 210
309 3300046507 Ga0495606_0162465 Ga0495606_0162465_497_1219 210
310 3300046512 Ga0495610_0054249 Ga0495610_0054249_422_1144 210
311 3300046512 Ga0495610_0068750 Ga0495610_0068750_906_1628 210
312 3300046513 Ga0495616_0001690 Ga0495616_0001690_9282_10004 210
313 3300046513 Ga0495616_0083376 Ga0495616_0083376_604_1326 210
314 3300046519 Ga0495632_0011453 Ga0495632_0011453_2798_3520 210
315 3300046519 Ga0495632_0044748 Ga0495632_0044748_756_1478 210
316 3300046519 Ga0495632_0234926 Ga0495632_0234926_79_801 210
317 3300046520 Ga0495637_0000835 Ga0495637_0000835_3962_4684 210
318 3300046520 Ga0495637_0006203 Ga0495637_0006203_3225_3947 210
319 3300046522 Ga0495643_0000076 Ga0495643_0000076_70625_71341 210
320 3300046522 Ga0495643_0000383 Ga0495643_0000383_18029_18730 210
321 3300046523 Ga0495644_0000994 Ga0495644_0000994_1866_2588 210
322 3300046524 Ga0495648_0000081 Ga0495648_0000081_21428_22144 210
323 3300046524 Ga0495648_0008164 Ga0495648_0008164_6707_7429 210
324 3300046524 Ga0495648_0129394 Ga0495648_0129394_225_947 210
325 3300046528 Ga0495642_0000336 Ga0495642_0000336_14180_14905 210
326 3300046528 Ga0495642_0004808 Ga0495642_0004808_3383_4099 210
327 3300046530 Ga0495654_0000517 Ga0495654_0000517_29105_29827 210
328 3300046530 Ga0495654_0003493 Ga0495654_0003493_4538_5260 210
329 3300046530 Ga0495654_0007386 Ga0495654_0007386_2317_3039 210
330 3300046538 Ga0495609_0000805 Ga0495609_0000805_9995_10711 210
331 3300046542 Ga0495597_0000005 Ga0495597_0000005_38319_39056 210
332 3300046557 Ga0495622_0000250 Ga0495622_0000250_20292_21008 210
333 3300046558 Ga0495633_0000182 Ga0495633_0000182_21362_22078 210
334 3300046558 Ga0495633_0100349 Ga0495633_0100349_269_976 210
335 3300046615 Ga0495656_0057167 Ga0495656_0057167_230_952 210
336 3300046615 Ga0495656_0057738 Ga0495656_0057738_763_1464 210
337 3300046616 Ga0495668_0000081 Ga0495668_0000081_63685_64401 210
338 3300046616 Ga0495668_0198896 Ga0495668_0198896_20_730 210
339 3300046660 Ga0495625_0000075 Ga0495625_0000075_60006_60722 210
340 3300046660 Ga0495625_0002309 Ga0495625_0002309_13281_14003 210
341 3300046665 Ga0495661_0000296 Ga0495661_0000296_17161_17862 210
342 3300046665 Ga0495661_0001556 Ga0495661_0001556_7733_8458 210
343 3300046665 Ga0495661_0046303 Ga0495661_0046303_979_1680 210
344 3300046665 Ga0495661_0143402 Ga0495661_0143402_337_1059 210
345 3300046674 Ga0495588_0000062 Ga0495588_0000062_106378_107103 210
346 3300046691 Ga0495670_0013252 Ga0495670_0013252_442_1164 210
347 3300046691 Ga0495670_0182532 Ga0495670_0182532_138_854 210
348 3300046692 Ga0495671_0011479 Ga0495671_0011479_2442_3164 210
349 3300046694 Ga0495649_0004303 Ga0495649_0004303_4861_5583 210
350 3300046694 Ga0495649_0051552 Ga0495649_0051552_149_850 210
351 3300046794 Ga0495589_0000022 Ga0495589_0000022_73853_74554 210
352 3300046810 Ga0495660_0000044 Ga0495660_0000044_42228_42929 210
353 3300046810 Ga0495660_0000885 Ga0495660_0000885_21037_21774 210
354 3300046810 Ga0495660_0021618 Ga0495660_0021618_1379_2101 210
355 3300046810 Ga0495660_0170272 Ga0495660_0170272_189_905 210
356 3300047320 Ga0495672_0005111 Ga0495672_0005111_1022_1723 210
357 3300047320 Ga0495672_0008750 Ga0495672_0008750_1701_2423 210
358 3300047322 Ga0495680_0035839 Ga0495680_0035839_1754_2476 210
359 3300047323 Ga0495683_0006780 Ga0495683_0006780_2795_3517 210
360 3300047443 Ga0495687_000099 Ga0495687_000099_32454_33155 210
361 3300047443 Ga0495687_004614 Ga0495687_004614_5614_6330 210
362 3300047443 Ga0495687_004678 Ga0495687_004678_5614_6330 210
363 3300047445 Ga0495677_0000180 Ga0495677_0000180_26076_26777 210
364 3300047469 Ga0495673_0004005 Ga0495673_0004005_6846_7568 210
365 3300047470 Ga0495681_0000470 Ga0495681_0000470_13980_14702 210
366 3300047470 Ga0495681_0002740 Ga0495681_0002740_6628_7350 210
367 3300047470 Ga0495681_0009448 Ga0495681_0009448_4833_5555 210
368 3300048091 Ga0495626_0000021 Ga0495626_0000021_139102_139803 210
369 3300048091 Ga0495626_0001492 Ga0495626_0001492_7842_8567 210
370 3300048904 Ga0496101_0131929 Ga0496101_0131929_616_1338 210
371 3300048905 Ga0496102_0000141 Ga0496102_0000141_55983_56705 210
372 3300048906 Ga0496103_0000172 Ga0496103_0000172_55208_55930 210
373 3300048906 Ga0496103_0000714 Ga0496103_0000714_17517_18209 210
374 3300048906 Ga0496103_0029085 Ga0496103_0029085_67_783 210
375 3300048907 Ga0496104_0000114 Ga0496104_0000114_20587_21309 210
376 3300048908 Ga0496105_0000073 Ga0496105_0000073_47282_48004 210
377 3300048910 Ga0496107_0189216 Ga0496107_0189216_72_794 210
378 3300048916 Ga0496113_0001094 Ga0496113_0001094_5015_5737 210
379 3300048920 Ga0496117_0000296 Ga0496117_0000296_2768_3490 210
380 3300048920 Ga0496117_0028492 Ga0496117_0028492_589_1404 210
381 3300048921 Ga0496118_0000897 Ga0496118_0000897_41965_42696 210
382 3300048921 Ga0496118_0009768 Ga0496118_0009768_8221_8943 210
383 3300048921 Ga0496118_0017593 Ga0496118_0017593_3004_3720 210
384 3300048922 Ga0496119_0000040 Ga0496119_0000040_48620_49342 210
385 3300048923 Ga0496120_0001789 Ga0496120_0001789_18419_19141 210
386 3300048923 Ga0496120_0066595 Ga0496120_0066595_602_1318 210
387 3300048924 Ga0496121_0001289 Ga0496121_0001289_36204_36926 210
388 3300048924 Ga0496121_0021553 Ga0496121_0021553_1457_2173 210
389 3300048925 Ga0496122_0000456 Ga0496122_0000456_55209_55931 210
390 3300048926 Ga0496123_0000847 Ga0496123_0000847_28797_29519 210
391 3300048927 Ga0496124_0001770 Ga0496124_0001770_6279_7001 210
392 3300048927 Ga0496124_0091700 Ga0496124_0091700_46_762 210
393 3300048927 Ga0496124_0173736 Ga0496124_0173736_431_1147 210
394 3300048928 Ga0496125_0000603 Ga0496125_0000603_41116_41838 210
395 3300048928 Ga0496125_0004486 Ga0496125_0004486_13953_14669 210
396 3300048929 Ga0496126_0000044 Ga0496126_0000044_278934_279656 210
397 3300048929 Ga0496126_0027600 Ga0496126_0027600_314_1030 210
398 3300049459 Ga0495678_000615 Ga0495678_000615_17849_18565 210
399 3300049459 Ga0495678_001847 Ga0495678_001847_682_1404 210
400 3300049530 Ga0501314_000711 Ga0501314_000711_957_1679 210
401 3300049530 Ga0501314_001936 Ga0501314_001936_479_1201 210
402 3300049553 Ga0501337_001475 Ga0501337_001475_153_875 210
403 3300049662 Ga0501222_000088 Ga0501222_000088_316_1038 210
404 3300049665 Ga0501227_000017 Ga0501227_000017_10434_11156 210
405 3300049669 Ga0501235_004663 Ga0501235_004663_2123_2845 210
406 3300049673 Ga0501240_022192 Ga0501240_022192_113_835 210
407 3300049758 Ga0501241_017251 Ga0501241_017251_440_1162 210
408 3300049766 Ga0501269_000062 Ga0501269_000062_21558_22280 210
409 3300049853 Ga0501226_000009 Ga0501226_000009_160948_161670 210
410 3300049853 Ga0501226_001644 Ga0501226_001644_1198_1920 210
411 3300053091 Ga0500647_0023348 Ga0500647_0023348_412_1122 210
412 3300053093 Ga0500651_0176328 Ga0500651_0176328_150_857 210
413 3300053096 Ga0500641_0109166 Ga0500641_0109166_138_845 210
414 3300053123 Ga0500614_014410 Ga0500614_014410_510_1220 210
415 3300053130 Ga0500642_0076847 Ga0500642_0076847_83_793 210
416 3300053133 Ga0500655_000020 Ga0500655_000020_41165_41872 210
417 3300053134 Ga0500658_0097414 Ga0500658_0097414_325_1047 210
418 3300053148 Ga0500590_000179 Ga0500590_000179_11750_12457 210
419 3300053156 Ga0500622_0067288 Ga0500622_0067288_1072_1779 210
420 3300053163 Ga0500639_021723 Ga0500639_021723_91_801 210
421 3300053177 Ga0500636_0037424 Ga0500636_0037424_498_1205 210
422 iso_pu_bacteria 2582581305 2585263095 210
423 iso_pu_bacteria 2643221650 2644280945 210
424 iso_pu_bacteria 2826581358 2826586318 210
425 iso_pu_bacteria 2842849001 2842852725 210
426 iso_pu_bacteria 2929144301 2929146727 210
427 iso_pu_bacteria 3007855910 3007860410 210
428 iso_pu_bacteria 3007866637 3007868693 210
429 iso_pu_bacteria 651053060 651177918 210
430 iso_pu_bacteria 8047673197 8047674194 210
431 iso_pu_bacteria 8054285046 8054289942 210
432 iso_pu_bacteria 8056125926 8056128869 210
433 iso_pu_bacteria 8056177738 8056182385 210
434 3300003771 Ga0055526_1000140 Ga0055526_100014012 211
435 3300003773 Ga0055537_1000113 Ga0055537_100011361 211
436 3300003775 Ga0055524_1017491 Ga0055524_10174912 211
437 3300003784 Ga0055534_1000023 Ga0055534_100002352 211
438 3300003790 Ga0055528_1000030 Ga0055528_100003052 211
439 3300025263 Ga0209565_1000003 Ga0209565_1000003162 211
440 3300025273 Ga0209673_1000003 Ga0209673_100000348 211
441 3300025291 Ga0209675_1000003 Ga0209675_1000003876 211
442 3300025295 Ga0209564_1000012 Ga0209564_1000012685 211
443 3300025299 Ga0209256_1000235 Ga0209256_100023540 211
444 3300031824 Ga0307413_10049451 Ga0307413_100494512 211
445 3300032004 Ga0307414_10000217 Ga0307414_1000021721 211
446 3300032004 Ga0307414_10121468 Ga0307414_101214682 211
447 3300032004 Ga0307414_10338577 Ga0307414_103385772 211
448 3300032004 Ga0307414_10537396 Ga0307414_105373962 211
449 3300037312 Ga0395899_0176686 Ga0395899_0176686_306_1028 211
450 3300037418 Ga0395900_0027038 Ga0395900_0027038_717_1439 211
451 3300037471 Ga0395905_0001243 Ga0395905_0001243_4712_5434 211
452 3300038443 Ga0395901_0074514 Ga0395901_0074514_2283_3005 211
453 3300046463 Ga0495653_0006369 Ga0495653_0006369_5873_6598 211
454 3300046474 Ga0495605_0001567 Ga0495605_0001567_7014_7727 211
455 3300046474 Ga0495605_0027386 Ga0495605_0027386_32_733 211
456 3300046500 Ga0495596_0000139 Ga0495596_0000139_14005_14706 211
457 3300046501 Ga0495607_0001449 Ga0495607_0001449_15363_16076 211
458 3300046513 Ga0495616_0015263 Ga0495616_0015263_361_1074 211
459 3300046522 Ga0495643_0000563 Ga0495643_0000563_14413_15114 211
460 3300046522 Ga0495643_0160231 Ga0495643_0160231_99_812 211
461 3300046536 Ga0495587_0031499 Ga0495587_0031499_1068_1793 211
462 3300046538 Ga0495609_0000009 Ga0495609_0000009_115152_115865 211
463 3300046538 Ga0495609_0001357 Ga0495609_0001357_10029_10730 211
464 3300046615 Ga0495656_0005296 Ga0495656_0005296_1827_2540 211
465 3300046660 Ga0495625_0135114 Ga0495625_0135114_769_1470 211
466 3300046665 Ga0495661_0000032 Ga0495661_0000032_38531_39244 211
467 3300046665 Ga0495661_0002595 Ga0495661_0002595_5762_6463 211
468 3300046665 Ga0495661_0005929 Ga0495661_0005929_526_1227 211
469 3300046665 Ga0495661_0119979 Ga0495661_0119979_113_826 211
470 3300046680 Ga0495646_0193574 Ga0495646_0193574_68_778 211
471 3300046684 Ga0495669_0003442 Ga0495669_0003442_4852_5553 211
472 3300046691 Ga0495670_0008160 Ga0495670_0008160_1420_2133 211
473 3300046794 Ga0495589_0000262 Ga0495589_0000262_3768_4481 211
474 3300047320 Ga0495672_0054831 Ga0495672_0054831_346_1047 211
475 3300047443 Ga0495687_000024 Ga0495687_000024_202203_202916 211
476 3300047443 Ga0495687_000030 Ga0495687_000030_187742_188443 211
477 3300047445 Ga0495677_0000018 Ga0495677_0000018_38585_39298 211
478 3300047445 Ga0495677_0018519 Ga0495677_0018519_1657_2358 211
479 3300047445 Ga0495677_0046428 Ga0495677_0046428_127_840 211
480 3300047472 Ga0495686_0138949 Ga0495686_0138949_305_1027 211
481 3300048091 Ga0495626_0001909 Ga0495626_0001909_13208_13909 211
482 3300048091 Ga0495626_0034766 Ga0495626_0034766_1220_1921 211
483 3300050493 nmdc:mga0k408_142875_c1 nmdc:mga0k408_142875_c1_498_1211 211
484 3300053118 Ga0500594_0095383 Ga0500594_0095383_24_746 211
485 3300053139 Ga0500568_0005368 Ga0500568_0005368_1101_1823 211
486 3300053148 Ga0500590_018523 Ga0500590_018523_1531_2259 211
487 iso_pu_bacteria 2894232714 2894240060 211
488 3300005616 Ga0068852_100005603 Ga0068852_10000560312 212
489 3300006048 Ga0075363_100078589 Ga0075363_1000785892 212
490 3300025304 Ga0209257_1000190 Ga0209257_1000190152 212
491 3300025304 Ga0209257_1000467 Ga0209257_100046743 212
492 3300026142 Ga0207698_10002253 Ga0207698_1000225310 212
493 3300027665 Ga0209983_1024293 Ga0209983_10242932 212
494 3300027876 Ga0209974_10017268 Ga0209974_100172684 212
495 3300031995 Ga0307409_100828299 Ga0307409_1008282991 212
496 3300046460 Ga0495638_0020048 Ga0495638_0020048_2606_3298 212
497 3300046491 Ga0495584_0039067 Ga0495584_0039067_822_1514 212
498 3300046501 Ga0495607_0001363 Ga0495607_0001363_17139_17831 212
499 3300046506 Ga0495583_0016551 Ga0495583_0016551_2728_3420 212
500 3300046513 Ga0495616_0008872 Ga0495616_0008872_956_1648 212
501 3300046525 Ga0495663_0031944 Ga0495663_0031944_225_917 212
502 3300046538 Ga0495609_0000481 Ga0495609_0000481_12164_12856 212
503 3300046616 Ga0495668_0054982 Ga0495668_0054982_826_1518 212
504 3300046660 Ga0495625_0019647 Ga0495625_0019647_1830_2522 212
505 3300046664 Ga0495659_0091845 Ga0495659_0091845_414_1106 212
506 3300046665 Ga0495661_0106028 Ga0495661_0106028_439_1131 212
507 3300046684 Ga0495669_0009489 Ga0495669_0009489_2430_3122 212
508 3300046694 Ga0495649_0046939 Ga0495649_0046939_1577_2269 212
509 3300046810 Ga0495660_0103970 Ga0495660_0103970_694_1386 212
510 3300047318 Ga0495636_0049374 Ga0495636_0049374_897_1589 212
511 3300047443 Ga0495687_020999 Ga0495687_020999_505_1197 212
512 3300047445 Ga0495677_0002528 Ga0495677_0002528_6023_6715 212
513 3300047446 Ga0495679_010064 Ga0495679_010064_1169_1861 212
514 3300047447 Ga0495685_009501 Ga0495685_009501_421_1113 212
515 3300047469 Ga0495673_0046905 Ga0495673_0046905_234_965 212
516 3300050489 nmdc:mga03683_143629_c1 nmdc:mga03683_143629_c1_301_1020 212
517 iso_pu_bacteria 2738541280 2738737668 212
518 iso_pu_bacteria 2738543018 2739272732 212
519 iso_pu_bacteria 2738543030 2739341776 212
520 iso_pu_bacteria 2818991450 2819622449 212
521 iso_pu_bacteria 2835312727 2835319642 212
522 iso_pu_bacteria 2928108538 2928111874 212
523 iso_pu_bacteria 2928135762 2928139113 212
524 iso_pu_bacteria 2928503688 2928508811 212
525 3300015261 Ga0182006_1029609 Ga0182006_10296092 213
526 3300015262 Ga0182007_10001540 Ga0182007_100015407 213
527 3300015265 Ga0182005_1000653 Ga0182005_10006536 213
528 3300025913 Ga0207695_10014078 Ga0207695_100140789 213
529 3300025986 Ga0207658_10633928 Ga0207658_106339282 213
530 3300028794 Ga0307515_10000101 Ga0307515_1000010160 213
531 3300046454 Ga0495592_0030598 Ga0495592_0030598_238_981 213
532 3300046462 Ga0495651_0030812 Ga0495651_0030812_75_935 213
533 3300046462 Ga0495651_0113652 Ga0495651_0113652_897_1640 213
534 3300046463 Ga0495653_0004514 Ga0495653_0004514_5606_6349 213
535 3300046511 Ga0495608_0040901 Ga0495608_0040901_505_1248 213
536 3300046516 Ga0495628_0000797 Ga0495628_0000797_13510_14253 213
537 3300046522 Ga0495643_0009593 Ga0495643_0009593_5269_5976 213
538 3300046529 Ga0495652_0003865 Ga0495652_0003865_13403_14146 213
539 3300046529 Ga0495652_0252026 Ga0495652_0252026_512_1255 213
540 3300046543 Ga0495645_0109995 Ga0495645_0109995_905_1648 213
541 3300046557 Ga0495622_0138764 Ga0495622_0138764_148_891 213
542 3300046675 Ga0495657_0106721 Ga0495657_0106721_288_1031 213
543 3300046678 Ga0495599_0118850 Ga0495599_0118850_651_1394 213
544 3300046679 Ga0495623_0006238 Ga0495623_0006238_1782_2525 213
545 3300046680 Ga0495646_0012579 Ga0495646_0012579_4478_5221 213
546 3300046690 Ga0495624_0065500 Ga0495624_0065500_1168_1911 213
547 3300046809 Ga0495600_0015479 Ga0495600_0015479_3404_4147 213
548 3300048088 Ga0495602_0009630 Ga0495602_0009630_389_1249 213
549 3300048088 Ga0495602_0033932 Ga0495602_0033932_3404_4147 213
550 3300053077 Ga0495601_0014913 Ga0495601_0014913_1923_2666 213
551 3300053119 Ga0500595_000649 Ga0500595_000649_7293_8036 213
552 3300053154 Ga0500619_000597 Ga0500619_000597_5227_5970 213
553 iso_pu_bacteria 2818991436 2819542652 213
554 2162886007 SwRhRL2b_contig_2810169 SwRhRL2b_0512.00002360 214
555 3300005289 Ga0065704_10000743 Ga0065704_100007432 214
556 3300005331 Ga0070670_100056444 Ga0070670_1000564442 214
557 3300005335 Ga0070666_10009275 Ga0070666_100092754 214
558 3300005344 Ga0070661_100057859 Ga0070661_1000578592 214
559 3300005367 Ga0070667_100289517 Ga0070667_1002895172 214
560 3300005457 Ga0070662_100024086 Ga0070662_1000240865 214
561 3300005539 Ga0068853_100047780 Ga0068853_1000477803 214
562 3300005548 Ga0070665_100000227 Ga0070665_10000022773 214
563 3300005548 Ga0070665_100211516 Ga0070665_1002115162 214
564 3300005563 Ga0068855_100245956 Ga0068855_1002459562 214
565 3300005564 Ga0070664_100280141 Ga0070664_1002801413 214
566 3300005577 Ga0068857_100176604 Ga0068857_1001766043 214
567 3300005578 Ga0068854_100007020 Ga0068854_1000070204 214
568 3300005616 Ga0068852_100340086 Ga0068852_1003400862 214
569 3300005834 Ga0068851_10006290 Ga0068851_100062906 214
570 3300005842 Ga0068858_100000386 Ga0068858_10000038639 214
571 3300005843 Ga0068860_100000719 Ga0068860_10000071913 214
572 3300005844 Ga0068862_100000044 Ga0068862_100000044134 214
573 3300009101 Ga0105247_10001669 Ga0105247_100016696 214
574 3300009553 Ga0105249_10000045 Ga0105249_1000004558 214
575 3300014326 Ga0157380_10014944 Ga0157380_100149444 214
576 3300025321 Ga0207656_10008505 Ga0207656_100085054 214
577 3300025728 Ga0207655_1013477 Ga0207655_10134771 214
578 3300025900 Ga0207710_10001776 Ga0207710_100017766 214
579 3300025903 Ga0207680_10001300 Ga0207680_100013009 214
580 3300025904 Ga0207647_10000500 Ga0207647_1000050015 214
581 3300025911 Ga0207654_10108026 Ga0207654_101080262 214
582 3300025913 Ga0207695_10079689 Ga0207695_100796894 214
583 3300025914 Ga0207671_10077048 Ga0207671_100770483 214
584 3300025924 Ga0207694_10003986 Ga0207694_100039867 214
585 3300025925 Ga0207650_10095707 Ga0207650_100957072 214
586 3300025933 Ga0207706_10004925 Ga0207706_100049255 214
587 3300025934 Ga0207686_10394569 Ga0207686_103945692 214
588 3300025949 Ga0207667_10137182 Ga0207667_101371823 214
589 3300025961 Ga0207712_10000169 Ga0207712_100001698 214
590 3300025961 Ga0207712_10000174 Ga0207712_1000017458 214
591 3300025981 Ga0207640_10001595 Ga0207640_1000159510 214
592 3300025986 Ga0207658_10053665 Ga0207658_100536653 214
593 3300026023 Ga0207677_10081942 Ga0207677_100819423 214
594 3300026035 Ga0207703_10001066 Ga0207703_1000106610 214
595 3300026041 Ga0207639_10001687 Ga0207639_100016878 214
596 3300026067 Ga0207678_10009490 Ga0207678_100094908 214
597 3300026078 Ga0207702_10261965 Ga0207702_102619652 214
598 3300026088 Ga0207641_10005043 Ga0207641_100050436 214
599 3300026142 Ga0207698_10463224 Ga0207698_104632242 214
600 3300028379 Ga0268266_10000006 Ga0268266_10000006629 214
601 3300028380 Ga0268265_10000045 Ga0268265_1000004552 214
602 3300028381 Ga0268264_10000524 Ga0268264_100005249 214
603 3300028794 Ga0307515_10038042 Ga0307515_100380425 214
604 3300031548 Ga0307408_100051401 Ga0307408_1000514014 214
605 3300031616 Ga0307508_10002424 Ga0307508_1000242417 214
606 3300031730 Ga0307516_10000002 Ga0307516_10000002400 214
607 3300031901 Ga0307406_10049685 Ga0307406_100496853 214
608 3300031911 Ga0307412_10002880 Ga0307412_100028803 214
609 3300032002 Ga0307416_100098602 Ga0307416_1000986024 214
610 3300032126 Ga0307415_100429595 Ga0307415_1004295952 214
611 3300046457 Ga0495590_0020628 Ga0495590_0020628_331_1068 214
612 3300046518 Ga0495631_0045134 Ga0495631_0045134_556_1281 214
613 3300046519 Ga0495632_0002572 Ga0495632_0002572_7034_7771 214
614 3300046694 Ga0495649_0007543 Ga0495649_0007543_98_835 214
615 3300046810 Ga0495660_0099572 Ga0495660_0099572_370_1107 214
616 3300047443 Ga0495687_003585 Ga0495687_003585_8717_9454 214
617 3300048911 Ga0496108_0002349 Ga0496108_0002349_4223_4951 214
618 3300048913 Ga0496110_0178143 Ga0496110_0178143_241_933 214
619 3300048914 Ga0496111_0108992 Ga0496111_0108992_73_765 214
620 3300048919 Ga0496116_0027993 Ga0496116_0027993_1874_2566 214
621 3300048924 Ga0496121_0000349 Ga0496121_0000349_30162_30854 214
622 3300048927 Ga0496124_0094798 Ga0496124_0094798_54_746 214
623 3300048928 Ga0496125_0027411 Ga0496125_0027411_1446_2138 214
624 3300048929 Ga0496126_0051608 Ga0496126_0051608_2169_2861 214
625 3300049459 Ga0495678_031817 Ga0495678_031817_90_827 214
626 3300049571 Ga0501034_0034001 Ga0501034_0034001_4429_5151 214
627 3300049649 Ga0501198_006436 Ga0501198_006436_828_1550 214
628 3300049663 Ga0501223_000023 Ga0501223_000023_51796_52518 214
629 3300049664 Ga0501224_000001 Ga0501224_000001_134241_134963 214
630 3300049669 Ga0501235_012178 Ga0501235_012178_32_754 214
631 3300049705 Ga0501225_0000012 Ga0501225_0000012_27664_28386 214
632 3300049707 Ga0501234_002530 Ga0501234_002530_301_1023 214
633 3300049853 Ga0501226_000133 Ga0501226_000133_13488_14210 214
634 3300050509 nmdc:mga0qj67_90370_c1 nmdc:mga0qj67_90370_c1_646_1371 214
635 3300053086 Ga0500578_0170688 Ga0500578_0170688_277_1014 214
636 3300053103 Ga0500555_001005 Ga0500555_001005_2889_3614 214
637 3300053104 Ga0500556_0036718 Ga0500556_0036718_771_1496 214
638 3300053139 Ga0500568_0011431 Ga0500568_0011431_2730_3491 214
639 iso_pu_bacteria 2808606404 2809081494 214
640 iso_pu_bacteria 2808606405 2809085849 214
641 iso_pu_bacteria 2880518877 2880522652 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13795

HupE_UreJ_2

HupE / UreJ protein

59

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wn1-assembly1.cif.gz_A structure of pfnt1(y190a) in complex with nanobody 48 and inosine 0.4308 26 189
1pw4-assembly1.cif.gz_A crystal structure of the glycerol-3-phosphate transporter from e.coli 0.3761 26 210
1pw4-assembly1.cif.gz_A crystal structure of the glycerol-3-phosphate transporter from e.coli 0.3412 26 210
7wn1-assembly1.cif.gz_A structure of pfnt1(y190a) in complex with nanobody 48 and inosine 0.3234 26 189
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.3193 45 213
ID Description Score Start End Superfamily
af_A4HVP9_281_498_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4725 31 190 1.20.1250.20
af_Q4CZV9_1_129_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4725 73 191 1.20.1250.20
af_H2KZQ1_21_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4717 45 185 1.20.1250.20
af_P47040_222_404_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4694 68 199 1.20.1250.20
af_Q8IBB7_261_466_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4635 45 185 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A380SYY3-F1-model_v4 Plasmid pTOM9 ORF1-like protein 0.9271 24 164 GO:0016020
AF-A0A3D1IK34-F1-model_v4 HupE/UreJ family protein 0.9241 55 149 GO:0016020
AF-A0A6B1GTY5-F1-model_v4 HupE/UreJ family protein 0.9154 47 153 GO:0016020
AF-A0A2E8A8S5-F1-model_v4 HupE/UreJ family protein 0.9024 23 169 GO:0016020
AF-A0A3D1IK34-F1-model_v4 HupE/UreJ family protein 0.8975 55 149 GO:0016020

Feature Viewer

pLDDT pTM Quality
74.96 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map