F471762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 641 | 355 | 607 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100060431|Ga0070663_1000604314 |
| Length | 238 |
| Sequence | MSTLCPPSRRNWSRAAWISAAVAAMVGLALAAPEAFAHGVSDKDKLYIQSVSGVHALPYAYLGAKHMVTGYDHLLFLFGVIFFLYRLKDVVRYVTLFAVGHSITLLLGVLLNIHASPYIVDAIIGLSVVYKGFDNLGGEPNPRAAVLIFGFFHGFGLATKIQELAFSREGLLGNLISFNVGVEIGQFLALSMILIAMTFWRQTASFGRSAVFANGALMCAGFVLIGYQLSGLLQVTPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 5 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 6 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 7 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 8 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 9 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 10 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 11 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 12 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 13 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 14 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 15 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 16 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 17 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 18 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 19 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 20 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 21 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 22 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 23 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 24 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 25 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 26 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 27 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 28 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 29 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 30 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 182 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 204 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 205 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 206 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 207 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 310 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 311 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 335 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 336 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 342 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 343 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 347 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 349 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 350 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 351 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 352 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 353 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 354 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 355 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.23 |
| Metatranscriptomes | 0.47 |
| Isolates | 5.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.08 |
| Nodule | 1.09 |
| Rhizoplane | 2.65 |
| Rhizosphere | 82.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2810169 | 2162886007 | Bacteria | 4628 |
| 2 | SwRhRL2b_contig_3606524 | 2162886007 | Bacteria | 6484 |
| 3 | JGI24739J22299_10024580 | 3300001989 | Bacteria | 2123 |
| 4 | Ga0055526_1000140 | 3300003771 | Bacteria | 63275 |
| 5 | Ga0055537_1000113 | 3300003773 | Bacteria | 61047 |
| 6 | Ga0055524_1017491 | 3300003775 | Bacteria | 2528 |
| 7 | Ga0055534_1000023 | 3300003784 | Bacteria | 135301 |
| 8 | Ga0055528_1000030 | 3300003790 | Bacteria | 121679 |
| 9 | Ga0065704_10000381 | 3300005289 | Bacteria | 26659 |
| 10 | Ga0065704_10000743 | 3300005289 | Bacteria | 24338 |
| 11 | Ga0065712_10074421 | 3300005290 | Bacteria | 4099 |
| 12 | Ga0065715_10091000 | 3300005293 | Bacteria | 6228 |
| 13 | Ga0070658_10452842 | 3300005327 | Bacteria | 1106 |
| 14 | Ga0070690_100012685 | 3300005330 | Bacteria | 4962 |
| 15 | Ga0070670_100011405 | 3300005331 | Bacteria | 7601 |
| 16 | Ga0070670_100056444 | 3300005331 | Bacteria | 3370 |
| 17 | Ga0070670_100234080 | 3300005331 | Bacteria | 1599 |
| 18 | Ga0068869_100001690 | 3300005334 | Bacteria | 13181 |
| 19 | Ga0070666_10009275 | 3300005335 | Bacteria | 6132 |
| 20 | Ga0070666_10016408 | 3300005335 | Bacteria | 4739 |
| 21 | Ga0070666_10031767 | 3300005335 | Bacteria | 3487 |
| 22 | Ga0070689_100002431 | 3300005340 | Bacteria | 12171 |
| 23 | Ga0070687_100000745 | 3300005343 | Bacteria | 10806 |
| 24 | Ga0070661_100057859 | 3300005344 | Bacteria | 2840 |
| 25 | Ga0070668_100002999 | 3300005347 | Bacteria | 12474 |
| 26 | Ga0070668_100008625 | 3300005347 | Bacteria | 7571 |
| 27 | Ga0070668_100008723 | 3300005347 | Bacteria | 7530 |
| 28 | Ga0070668_100269788 | 3300005347 | Bacteria | 1418 |
| 29 | Ga0070669_100000081 | 3300005353 | Bacteria | 91877 |
| 30 | Ga0070669_100000510 | 3300005353 | Bacteria | 29305 |
| 31 | Ga0070669_100019080 | 3300005353 | Bacteria | 4902 |
| 32 | Ga0070669_100102806 | 3300005353 | Bacteria | 2158 |
| 33 | Ga0070675_100005984 | 3300005354 | Bacteria | 9321 |
| 34 | Ga0070671_100005749 | 3300005355 | Bacteria | 9878 |
| 35 | Ga0070671_100009303 | 3300005355 | Bacteria | 7889 |
| 36 | Ga0070671_100107557 | 3300005355 | Bacteria | 2342 |
| 37 | Ga0070674_100109976 | 3300005356 | Bacteria | 2022 |
| 38 | Ga0070673_100011869 | 3300005364 | Bacteria | 5963 |
| 39 | Ga0070659_100065043 | 3300005366 | Bacteria | 2888 |
| 40 | Ga0070667_100221948 | 3300005367 | Bacteria | 1682 |
| 41 | Ga0070667_100289517 | 3300005367 | Bacteria | 1472 |
| 42 | Ga0070705_100025518 | 3300005440 | Bacteria | 3205 |
| 43 | Ga0070663_100060431 | 3300005455 | Bacteria | 2726 |
| 44 | Ga0070662_100024086 | 3300005457 | Bacteria | 4190 |
| 45 | Ga0070662_100095391 | 3300005457 | Bacteria | 2242 |
| 46 | Ga0068867_100163601 | 3300005459 | Bacteria | 1756 |
| 47 | Ga0070685_10001937 | 3300005466 | Bacteria | 10750 |
| 48 | Ga0070679_100836392 | 3300005530 | Bacteria | 864 |
| 49 | Ga0068853_100047780 | 3300005539 | Bacteria | 3673 |
| 50 | Ga0070672_100062494 | 3300005543 | Bacteria | 2939 |
| 51 | Ga0070686_100006153 | 3300005544 | Bacteria | 6662 |
| 52 | Ga0070665_100000227 | 3300005548 | Bacteria | 93439 |
| 53 | Ga0070665_100000927 | 3300005548 | Bacteria | 37571 |
| 54 | Ga0070665_100211516 | 3300005548 | Bacteria | 1940 |
| 55 | Ga0068855_100245956 | 3300005563 | Bacteria | 1996 |
| 56 | Ga0070664_100000407 | 3300005564 | Bacteria | 32028 |
| 57 | Ga0070664_100280141 | 3300005564 | Bacteria | 1503 |
| 58 | Ga0068857_100006474 | 3300005577 | Bacteria | 10042 |
| 59 | Ga0068857_100176604 | 3300005577 | Bacteria | 1943 |
| 60 | Ga0068854_100007020 | 3300005578 | Bacteria | 7185 |
| 61 | Ga0070702_100000337 | 3300005615 | Bacteria | 16318 |
| 62 | Ga0070702_100058102 | 3300005615 | Bacteria | 2240 |
| 63 | Ga0068852_100005603 | 3300005616 | Bacteria | 9004 |
| 64 | Ga0068852_100053366 | 3300005616 | Bacteria | 3479 |
| 65 | Ga0068852_100340086 | 3300005616 | Bacteria | 1462 |
| 66 | Ga0068852_100377511 | 3300005616 | Bacteria | 1390 |
| 67 | Ga0068859_100005511 | 3300005617 | Bacteria | 12889 |
| 68 | Ga0068864_100002840 | 3300005618 | Bacteria | 14309 |
| 69 | Ga0068866_10190291 | 3300005718 | Bacteria | 1219 |
| 70 | Ga0068861_100002090 | 3300005719 | Bacteria | 12948 |
| 71 | Ga0068861_100017772 | 3300005719 | Bacteria | 5053 |
| 72 | Ga0068851_10006290 | 3300005834 | Bacteria | 5419 |
| 73 | Ga0068863_100004022 | 3300005841 | Bacteria | 14521 |
| 74 | Ga0068863_100013953 | 3300005841 | Bacteria | 7745 |
| 75 | Ga0068858_100000386 | 3300005842 | Bacteria | 46187 |
| 76 | Ga0068858_100007537 | 3300005842 | Bacteria | 10519 |
| 77 | Ga0068858_100053591 | 3300005842 | Bacteria | 3731 |
| 78 | Ga0068858_100943901 | 3300005842 | Bacteria | 844 |
| 79 | Ga0068860_100000719 | 3300005843 | Bacteria | 37763 |
| 80 | Ga0068860_100023234 | 3300005843 | Bacteria | 5991 |
| 81 | Ga0068860_100027388 | 3300005843 | Bacteria | 5490 |
| 82 | Ga0068860_100030476 | 3300005843 | Bacteria | 5188 |
| 83 | Ga0068862_100000044 | 3300005844 | Bacteria | 156665 |
| 84 | Ga0068862_100000717 | 3300005844 | Bacteria | 33735 |
| 85 | Ga0068862_100007978 | 3300005844 | Bacteria | 8758 |
| 86 | Ga0068862_100018471 | 3300005844 | Bacteria | 5806 |
| 87 | Ga0068862_100321379 | 3300005844 | Bacteria | 1429 |
| 88 | Ga0068862_100533992 | 3300005844 | Bacteria | 1118 |
| 89 | Ga0075363_100078589 | 3300006048 | Bacteria | 1801 |
| 90 | Ga0075432_10003497 | 3300006058 | Bacteria | 5318 |
| 91 | Ga0097621_100014346 | 3300006237 | Bacteria | 5928 |
| 92 | Ga0068871_100085590 | 3300006358 | Bacteria | 2618 |
| 93 | Ga0075428_100000169 | 3300006844 | Bacteria | 60729 |
| 94 | Ga0075428_100032405 | 3300006844 | Bacteria | 5773 |
| 95 | Ga0075430_100065220 | 3300006846 | Bacteria | 3059 |
| 96 | Ga0075431_100001534 | 3300006847 | Bacteria | 21414 |
| 97 | Ga0075431_100115893 | 3300006847 | Bacteria | 2766 |
| 98 | Ga0075434_100143758 | 3300006871 | Bacteria | 2406 |
| 99 | Ga0075429_100010561 | 3300006880 | Bacteria | 7985 |
| 100 | Ga0075429_100133492 | 3300006880 | Bacteria | 2172 |
| 101 | Ga0097620_100005511 | 3300006931 | Bacteria | 12889 |
| 102 | Ga0075435_100135190 | 3300007076 | Bacteria | 2065 |
| 103 | Ga0105240_10001044 | 3300009093 | Bacteria | 49217 |
| 104 | Ga0105240_10043932 | 3300009093 | Bacteria | 5682 |
| 105 | Ga0111539_10000211 | 3300009094 | Bacteria | 69441 |
| 106 | Ga0111539_10036727 | 3300009094 | Bacteria | 5920 |
| 107 | Ga0111539_10045457 | 3300009094 | Bacteria | 5256 |
| 108 | Ga0105245_10827443 | 3300009098 | Bacteria | 965 |
| 109 | Ga0105247_10001669 | 3300009101 | Bacteria | 15666 |
| 110 | Ga0105247_10024848 | 3300009101 | Bacteria | 3612 |
| 111 | Ga0114129_10005515 | 3300009147 | Bacteria | 17894 |
| 112 | Ga0105241_10063864 | 3300009174 | Bacteria | 2842 |
| 113 | Ga0105241_10250715 | 3300009174 | Bacteria | 1501 |
| 114 | Ga0105248_10000481 | 3300009177 | Bacteria | 45536 |
| 115 | Ga0105248_10027224 | 3300009177 | Bacteria | 6361 |
| 116 | Ga0105248_10984768 | 3300009177 | Bacteria | 952 |
| 117 | Ga0105237_10066212 | 3300009545 | Bacteria | 3608 |
| 118 | Ga0105238_10006969 | 3300009551 | Bacteria | 11292 |
| 119 | Ga0105238_10031389 | 3300009551 | Bacteria | 5408 |
| 120 | Ga0105249_10000045 | 3300009553 | Bacteria | 182927 |
| 121 | Ga0105249_10007119 | 3300009553 | Bacteria | 9765 |
| 122 | Ga0105249_10010625 | 3300009553 | Bacteria | 8087 |
| 123 | Ga0105249_10026864 | 3300009553 | Bacteria | 5190 |
| 124 | Ga0105249_10059838 | 3300009553 | Bacteria | 3494 |
| 125 | Ga0105239_10134079 | 3300010375 | Bacteria | 2756 |
| 126 | Ga0105239_10310621 | 3300010375 | Bacteria | 1777 |
| 127 | Ga0105239_10660568 | 3300010375 | Bacteria | 1194 |
| 128 | Ga0105246_10083515 | 3300011119 | Bacteria | 2282 |
| 129 | Ga0105246_10085753 | 3300011119 | Bacteria | 2256 |
| 130 | Ga0105246_10250212 | 3300011119 | Bacteria | 1406 |
| 131 | Ga0157370_10198314 | 3300013104 | Bacteria | 1862 |
| 132 | Ga0157374_10052349 | 3300013296 | Bacteria | 3802 |
| 133 | Ga0157378_10409737 | 3300013297 | Bacteria | 1337 |
| 134 | Ga0163162_10005070 | 3300013306 | Bacteria | 12692 |
| 135 | Ga0163162_10010863 | 3300013306 | Bacteria | 8863 |
| 136 | Ga0163162_10206270 | 3300013306 | Bacteria | 2095 |
| 137 | Ga0163163_10000701 | 3300014325 | Bacteria | 28457 |
| 138 | Ga0163163_10712689 | 3300014325 | Bacteria | 1067 |
| 139 | Ga0157380_10014944 | 3300014326 | Bacteria | 5692 |
| 140 | Ga0157377_10004768 | 3300014745 | Bacteria | 6284 |
| 141 | Ga0157379_10077036 | 3300014968 | Bacteria | 2986 |
| 142 | Ga0157376_10030454 | 3300014969 | Bacteria | 4309 |
| 143 | Ga0182006_1029609 | 3300015261 | Bacteria | 2217 |
| 144 | Ga0182007_10000611 | 3300015262 | Bacteria | 20801 |
| 145 | Ga0182007_10001540 | 3300015262 | Bacteria | 12294 |
| 146 | Ga0182005_1000653 | 3300015265 | Bacteria | 16514 |
| 147 | Ga0163161_10120631 | 3300017792 | Bacteria | 1970 |
| 148 | Ga0163161_10143068 | 3300017792 | Bacteria | 1812 |
| 149 | Ga0209148_1000227 | 3300025254 | Bacteria | 92428 |
| 150 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 151 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 152 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 153 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 154 | Ga0209256_1000235 | 3300025299 | Bacteria | 98834 |
| 155 | Ga0209051_1017508 | 3300025303 | Bacteria | 3200 |
| 156 | Ga0209257_1000190 | 3300025304 | Bacteria | 153686 |
| 157 | Ga0209257_1000467 | 3300025304 | Bacteria | 73784 |
| 158 | Ga0207656_10008505 | 3300025321 | Bacteria | 3780 |
| 159 | Ga0207696_1010931 | 3300025711 | Bacteria | 3301 |
| 160 | Ga0207655_1013477 | 3300025728 | Bacteria | 4691 |
| 161 | Ga0207713_1000492 | 3300025735 | Bacteria | 40745 |
| 162 | Ga0207713_1002098 | 3300025735 | Bacteria | 14868 |
| 163 | Ga0207713_1008187 | 3300025735 | Bacteria | 6050 |
| 164 | Ga0207710_10001776 | 3300025900 | Bacteria | 10419 |
| 165 | Ga0207680_10001300 | 3300025903 | Bacteria | 11819 |
| 166 | Ga0207680_10011897 | 3300025903 | Bacteria | 4416 |
| 167 | Ga0207680_10015898 | 3300025903 | Bacteria | 3938 |
| 168 | Ga0207647_10000500 | 3300025904 | Bacteria | 31386 |
| 169 | Ga0207647_10011593 | 3300025904 | Bacteria | 6173 |
| 170 | Ga0207654_10076195 | 3300025911 | Bacteria | 2007 |
| 171 | Ga0207654_10108026 | 3300025911 | Bacteria | 1726 |
| 172 | Ga0207707_10123394 | 3300025912 | Bacteria | 2265 |
| 173 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 174 | Ga0207695_10014078 | 3300025913 | Bacteria | 9499 |
| 175 | Ga0207695_10079689 | 3300025913 | Bacteria | 3318 |
| 176 | Ga0207671_10021376 | 3300025914 | Bacteria | 4909 |
| 177 | Ga0207671_10077048 | 3300025914 | Bacteria | 2496 |
| 178 | Ga0207660_10039700 | 3300025917 | Bacteria | 3292 |
| 179 | Ga0207662_10001211 | 3300025918 | Bacteria | 12334 |
| 180 | Ga0207681_10000630 | 3300025923 | Bacteria | 23561 |
| 181 | Ga0207681_10003919 | 3300025923 | Bacteria | 9228 |
| 182 | Ga0207681_10005572 | 3300025923 | Bacteria | 7734 |
| 183 | Ga0207681_10091493 | 3300025923 | Bacteria | 2173 |
| 184 | Ga0207694_10003986 | 3300025924 | Bacteria | 11641 |
| 185 | Ga0207694_10005080 | 3300025924 | Bacteria | 10170 |
| 186 | Ga0207650_10095707 | 3300025925 | Bacteria | 2276 |
| 187 | Ga0207650_10122363 | 3300025925 | Bacteria | 2027 |
| 188 | Ga0207650_10251191 | 3300025925 | Unclassified | 1432 |
| 189 | Ga0207659_10006777 | 3300025926 | Bacteria | 7040 |
| 190 | Ga0207644_10002093 | 3300025931 | Bacteria | 12926 |
| 191 | Ga0207644_10007470 | 3300025931 | Bacteria | 7128 |
| 192 | Ga0207644_10039125 | 3300025931 | Bacteria | 3346 |
| 193 | Ga0207706_10004925 | 3300025933 | Bacteria | 12483 |
| 194 | Ga0207706_10007815 | 3300025933 | Bacteria | 9870 |
| 195 | Ga0207686_10394569 | 3300025934 | Bacteria | 1052 |
| 196 | Ga0207670_10009198 | 3300025936 | Bacteria | 5623 |
| 197 | Ga0207669_10221806 | 3300025937 | Bacteria | 1388 |
| 198 | Ga0207669_10296729 | 3300025937 | Bacteria | 1226 |
| 199 | Ga0207704_10010945 | 3300025938 | Bacteria | 4446 |
| 200 | Ga0207691_10003092 | 3300025940 | Bacteria | 16238 |
| 201 | Ga0207711_10003285 | 3300025941 | Bacteria | 14057 |
| 202 | Ga0207711_10041672 | 3300025941 | Bacteria | 3910 |
| 203 | Ga0207711_10158375 | 3300025941 | Bacteria | 2048 |
| 204 | Ga0207689_10042532 | 3300025942 | Bacteria | 3758 |
| 205 | Ga0207679_10012714 | 3300025945 | Bacteria | 5497 |
| 206 | Ga0207667_10137182 | 3300025949 | Bacteria | 2519 |
| 207 | Ga0207651_10028775 | 3300025960 | Bacteria | 3510 |
| 208 | Ga0207712_10000169 | 3300025961 | Bacteria | 67461 |
| 209 | Ga0207712_10000174 | 3300025961 | Bacteria | 66500 |
| 210 | Ga0207712_10009969 | 3300025961 | Bacteria | 6021 |
| 211 | Ga0207712_10045977 | 3300025961 | Bacteria | 3024 |
| 212 | Ga0207712_10081715 | 3300025961 | Bacteria | 2354 |
| 213 | Ga0207668_10013971 | 3300025972 | Bacteria | 4960 |
| 214 | Ga0207668_10199429 | 3300025972 | Bacteria | 1592 |
| 215 | Ga0207668_10417531 | 3300025972 | Bacteria | 1138 |
| 216 | Ga0207640_10001595 | 3300025981 | Bacteria | 12185 |
| 217 | Ga0207658_10025917 | 3300025986 | Bacteria | 4107 |
| 218 | Ga0207658_10053665 | 3300025986 | Bacteria | 2979 |
| 219 | Ga0207658_10633928 | 3300025986 | Bacteria | 962 |
| 220 | Ga0207677_10081942 | 3300026023 | Bacteria | 2317 |
| 221 | Ga0207703_10001066 | 3300026035 | Bacteria | 26163 |
| 222 | Ga0207703_10039620 | 3300026035 | Bacteria | 3766 |
| 223 | Ga0207703_10168827 | 3300026035 | Bacteria | 1923 |
| 224 | Ga0207639_10001687 | 3300026041 | Bacteria | 14904 |
| 225 | Ga0207678_10009490 | 3300026067 | Bacteria | 8558 |
| 226 | Ga0207678_10117713 | 3300026067 | Bacteria | 2267 |
| 227 | Ga0207708_10019290 | 3300026075 | Bacteria | 5139 |
| 228 | Ga0207702_10261965 | 3300026078 | Bacteria | 1628 |
| 229 | Ga0207641_10000930 | 3300026088 | Bacteria | 30233 |
| 230 | Ga0207641_10001988 | 3300026088 | Bacteria | 19523 |
| 231 | Ga0207641_10005043 | 3300026088 | Bacteria | 11314 |
| 232 | Ga0207648_10027433 | 3300026089 | Bacteria | 5055 |
| 233 | Ga0207676_10001544 | 3300026095 | Bacteria | 16997 |
| 234 | Ga0207674_10008195 | 3300026116 | Bacteria | 12108 |
| 235 | Ga0207674_10023959 | 3300026116 | Bacteria | 6528 |
| 236 | Ga0207675_100001056 | 3300026118 | Bacteria | 27310 |
| 237 | Ga0207698_10002253 | 3300026142 | Bacteria | 11416 |
| 238 | Ga0207698_10056303 | 3300026142 | Bacteria | 3036 |
| 239 | Ga0207698_10463224 | 3300026142 | Bacteria | 1226 |
| 240 | Ga0209281_1006317 | 3300027111 | Bacteria | 3112 |
| 241 | Ga0209983_1024293 | 3300027665 | Bacteria | 1275 |
| 242 | Ga0209974_10017268 | 3300027876 | Bacteria | 2394 |
| 243 | Ga0207428_10012513 | 3300027907 | Bacteria | 7450 |
| 244 | Ga0207428_10018147 | 3300027907 | Bacteria | 6016 |
| 245 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 246 | Ga0268266_10001167 | 3300028379 | Bacteria | 32520 |
| 247 | Ga0268265_10000045 | 3300028380 | Bacteria | 180378 |
| 248 | Ga0268265_10001502 | 3300028380 | Bacteria | 19459 |
| 249 | Ga0268265_10009556 | 3300028380 | Bacteria | 6548 |
| 250 | Ga0268265_10079359 | 3300028380 | Bacteria | 2584 |
| 251 | Ga0268265_10084186 | 3300028380 | Bacteria | 2520 |
| 252 | Ga0268264_10000524 | 3300028381 | Bacteria | 48665 |
| 253 | Ga0268264_10014318 | 3300028381 | Bacteria | 6522 |
| 254 | Ga0268264_10060345 | 3300028381 | Bacteria | 3179 |
| 255 | Ga0268264_10063142 | 3300028381 | Bacteria | 3113 |
| 256 | Ga0307517_10000058 | 3300028786 | Bacteria | 148725 |
| 257 | Ga0307515_10000101 | 3300028794 | Bacteria | 199593 |
| 258 | Ga0307515_10038042 | 3300028794 | Bacteria | 7712 |
| 259 | Ga0307515_10069954 | 3300028794 | Bacteria | 4786 |
| 260 | Ga0307509_10001175 | 3300031507 | Bacteria | 44735 |
| 261 | Ga0307509_10002372 | 3300031507 | Bacteria | 30641 |
| 262 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 263 | Ga0307408_100001956 | 3300031548 | Bacteria | 14901 |
| 264 | Ga0307408_100003404 | 3300031548 | Bacteria | 10909 |
| 265 | Ga0307408_100020319 | 3300031548 | Bacteria | 4480 |
| 266 | Ga0307408_100051401 | 3300031548 | Bacteria | 2968 |
| 267 | Ga0307408_100070399 | 3300031548 | Bacteria | 2582 |
| 268 | Ga0307408_100125360 | 3300031548 | Bacteria | 1996 |
| 269 | Ga0307408_100172390 | 3300031548 | Bacteria | 1728 |
| 270 | Ga0307408_100399522 | 3300031548 | Bacteria | 1180 |
| 271 | Ga0307408_100493292 | 3300031548 | Bacteria | 1071 |
| 272 | Ga0307508_10002424 | 3300031616 | Bacteria | 19668 |
| 273 | Ga0307508_10017078 | 3300031616 | Bacteria | 6600 |
| 274 | Ga0307514_10000560 | 3300031649 | Bacteria | 71030 |
| 275 | Ga0307516_10000002 | 3300031730 | Bacteria | 467851 |
| 276 | Ga0307516_10092183 | 3300031730 | Bacteria | 2857 |
| 277 | Ga0307405_10000033 | 3300031731 | Bacteria | 96827 |
| 278 | Ga0307405_10003174 | 3300031731 | Bacteria | 7478 |
| 279 | Ga0307405_10076457 | 3300031731 | Bacteria | 2172 |
| 280 | Ga0307413_10049451 | 3300031824 | Bacteria | 2520 |
| 281 | Ga0307413_10332210 | 3300031824 | Bacteria | 1166 |
| 282 | Ga0307410_10201688 | 3300031852 | Bacteria | 1519 |
| 283 | Ga0307406_10013809 | 3300031901 | Bacteria | 4634 |
| 284 | Ga0307406_10049685 | 3300031901 | Bacteria | 2655 |
| 285 | Ga0307406_10096947 | 3300031901 | Bacteria | 1999 |
| 286 | Ga0307406_10233033 | 3300031901 | Bacteria | 1376 |
| 287 | Ga0307407_10396052 | 3300031903 | Bacteria | 989 |
| 288 | Ga0307412_10000192 | 3300031911 | Bacteria | 42797 |
| 289 | Ga0307412_10000366 | 3300031911 | Bacteria | 28099 |
| 290 | Ga0307412_10002880 | 3300031911 | Bacteria | 9537 |
| 291 | Ga0307412_10034550 | 3300031911 | Bacteria | 3222 |
| 292 | Ga0307412_10079894 | 3300031911 | Bacteria | 2257 |
| 293 | Ga0307409_100687550 | 3300031995 | Bacteria | 1021 |
| 294 | Ga0307409_100828299 | 3300031995 | Bacteria | 935 |
| 295 | Ga0307416_100098602 | 3300032002 | Bacteria | 2535 |
| 296 | Ga0307416_100284282 | 3300032002 | Bacteria | 1633 |
| 297 | Ga0307416_100327332 | 3300032002 | Bacteria | 1538 |
| 298 | Ga0307416_100582527 | 3300032002 | Bacteria | 1196 |
| 299 | Ga0307414_10000217 | 3300032004 | Bacteria | 37929 |
| 300 | Ga0307414_10092835 | 3300032004 | Bacteria | 2248 |
| 301 | Ga0307414_10113141 | 3300032004 | Bacteria | 2071 |
| 302 | Ga0307414_10121468 | 3300032004 | Bacteria | 2009 |
| 303 | Ga0307414_10338577 | 3300032004 | Bacteria | 1287 |
| 304 | Ga0307414_10425698 | 3300032004 | Bacteria | 1159 |
| 305 | Ga0307414_10537396 | 3300032004 | Bacteria | 1040 |
| 306 | Ga0307411_10002212 | 3300032005 | Bacteria | 8470 |
| 307 | Ga0307411_10059735 | 3300032005 | Bacteria | 2529 |
| 308 | Ga0307411_10120724 | 3300032005 | Bacteria | 1896 |
| 309 | Ga0307411_10421939 | 3300032005 | Bacteria | 1108 |
| 310 | Ga0307415_100429595 | 3300032126 | Bacteria | 1136 |
| 311 | Ga0307507_10059082 | 3300033179 | Bacteria | 3594 |
| 312 | Ga0373958_0013596 | 3300034819 | Bacteria | 1412 |
| 313 | Ga0373931_0021027 | 3300035691 | Bacteria | 3270 |
| 314 | Ga0395899_0176686 | 3300037312 | Bacteria | 1501 |
| 315 | Ga0395899_0442563 | 3300037312 | Bacteria | 852 |
| 316 | Ga0395900_0011596 | 3300037418 | Bacteria | 9019 |
| 317 | Ga0395900_0027038 | 3300037418 | Bacteria | 5873 |
| 318 | Ga0395898_0169252 | 3300037466 | Bacteria | 2088 |
| 319 | Ga0395905_0001243 | 3300037471 | Bacteria | 31598 |
| 320 | Ga0395901_0074514 | 3300038443 | Bacteria | 3541 |
| 321 | Ga0439447_001889 | 3300041407 | Bacteria | 7664 |
| 322 | Ga0439442_028700 | 3300042002 | Bacteria | 1160 |
| 323 | Ga0439432_001825 | 3300042006 | Bacteria | 7996 |
| 324 | Ga0439432_047920 | 3300042006 | Bacteria | 1339 |
| 325 | Ga0450906_000091 | 3300042145 | Bacteria | 15006 |
| 326 | Ga0439459_0028362 | 3300042438 | Bacteria | 1123 |
| 327 | Ga0439464_0026469 | 3300042439 | Bacteria | 1609 |
| 328 | Ga0451576_0026526 | 3300045051 | Bacteria | 6232 |
| 329 | Ga0495617_001818 | 3300046452 | Bacteria | 9086 |
| 330 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 331 | Ga0495627_001641 | 3300046453 | Bacteria | 12429 |
| 332 | Ga0495592_0030598 | 3300046454 | Bacteria | 4071 |
| 333 | Ga0495590_0000002 | 3300046457 | Bacteria | 485720 |
| 334 | Ga0495590_0020628 | 3300046457 | Bacteria | 2341 |
| 335 | Ga0495590_0060048 | 3300046457 | Bacteria | 1331 |
| 336 | Ga0495591_004660 | 3300046458 | Bacteria | 6597 |
| 337 | Ga0495638_0000126 | 3300046460 | Bacteria | 125113 |
| 338 | Ga0495638_0003311 | 3300046460 | Bacteria | 12710 |
| 339 | Ga0495638_0020048 | 3300046460 | Bacteria | 4419 |
| 340 | Ga0495638_0037189 | 3300046460 | Bacteria | 3097 |
| 341 | Ga0495651_0030812 | 3300046462 | Bacteria | 4182 |
| 342 | Ga0495651_0113652 | 3300046462 | Bacteria | 1998 |
| 343 | Ga0495653_0004514 | 3300046463 | Bacteria | 11242 |
| 344 | Ga0495653_0006369 | 3300046463 | Bacteria | 9678 |
| 345 | Ga0495650_0000291 | 3300046471 | Bacteria | 92452 |
| 346 | Ga0495650_0004572 | 3300046471 | Bacteria | 9421 |
| 347 | Ga0495605_0000116 | 3300046474 | Bacteria | 103357 |
| 348 | Ga0495605_0001567 | 3300046474 | Bacteria | 14863 |
| 349 | Ga0495605_0027386 | 3300046474 | Bacteria | 2954 |
| 350 | Ga0495605_0042178 | 3300046474 | Bacteria | 2270 |
| 351 | Ga0495605_0068552 | 3300046474 | Bacteria | 1681 |
| 352 | Ga0495639_0003529 | 3300046475 | Bacteria | 6754 |
| 353 | Ga0495584_0015154 | 3300046491 | Bacteria | 3926 |
| 354 | Ga0495584_0039067 | 3300046491 | Bacteria | 2398 |
| 355 | Ga0495584_0048457 | 3300046491 | Bacteria | 2142 |
| 356 | Ga0495585_0006286 | 3300046492 | Bacteria | 7380 |
| 357 | Ga0495596_0000139 | 3300046500 | Bacteria | 49660 |
| 358 | Ga0495607_0000057 | 3300046501 | Bacteria | 110023 |
| 359 | Ga0495607_0001363 | 3300046501 | Bacteria | 21775 |
| 360 | Ga0495607_0001449 | 3300046501 | Bacteria | 21112 |
| 361 | Ga0495607_0055832 | 3300046501 | Bacteria | 2270 |
| 362 | Ga0495583_0000048 | 3300046506 | Bacteria | 217130 |
| 363 | Ga0495583_0001854 | 3300046506 | Bacteria | 19698 |
| 364 | Ga0495583_0016551 | 3300046506 | Bacteria | 3957 |
| 365 | Ga0495606_0001736 | 3300046507 | Bacteria | 27992 |
| 366 | Ga0495606_0003774 | 3300046507 | Bacteria | 15743 |
| 367 | Ga0495606_0162465 | 3300046507 | Bacteria | 1302 |
| 368 | Ga0495608_0040901 | 3300046511 | Bacteria | 3104 |
| 369 | Ga0495610_0054249 | 3300046512 | Bacteria | 1937 |
| 370 | Ga0495610_0068750 | 3300046512 | Bacteria | 1659 |
| 371 | Ga0495616_0001690 | 3300046513 | Bacteria | 15055 |
| 372 | Ga0495616_0008872 | 3300046513 | Bacteria | 5916 |
| 373 | Ga0495616_0015263 | 3300046513 | Bacteria | 4272 |
| 374 | Ga0495616_0083376 | 3300046513 | Bacteria | 1525 |
| 375 | Ga0495628_0000797 | 3300046516 | Bacteria | 29081 |
| 376 | Ga0495631_0045134 | 3300046518 | Bacteria | 1941 |
| 377 | Ga0495632_0002572 | 3300046519 | Bacteria | 13709 |
| 378 | Ga0495632_0011453 | 3300046519 | Bacteria | 5173 |
| 379 | Ga0495632_0044748 | 3300046519 | Bacteria | 2208 |
| 380 | Ga0495632_0234926 | 3300046519 | Bacteria | 826 |
| 381 | Ga0495637_0000835 | 3300046520 | Bacteria | 20364 |
| 382 | Ga0495637_0006203 | 3300046520 | Bacteria | 6015 |
| 383 | Ga0495643_0000076 | 3300046522 | Bacteria | 166614 |
| 384 | Ga0495643_0000383 | 3300046522 | Bacteria | 58554 |
| 385 | Ga0495643_0000563 | 3300046522 | Bacteria | 45920 |
| 386 | Ga0495643_0009593 | 3300046522 | Bacteria | 6006 |
| 387 | Ga0495643_0160231 | 3300046522 | Bacteria | 1107 |
| 388 | Ga0495644_0000994 | 3300046523 | Bacteria | 11798 |
| 389 | Ga0495648_0000081 | 3300046524 | Bacteria | 125267 |
| 390 | Ga0495648_0008164 | 3300046524 | Bacteria | 8261 |
| 391 | Ga0495648_0129394 | 3300046524 | Bacteria | 1344 |
| 392 | Ga0495663_0031944 | 3300046525 | Bacteria | 1566 |
| 393 | Ga0495642_0000336 | 3300046528 | Bacteria | 25588 |
| 394 | Ga0495642_0004808 | 3300046528 | Bacteria | 5223 |
| 395 | Ga0495652_0003865 | 3300046529 | Bacteria | 14606 |
| 396 | Ga0495652_0252026 | 3300046529 | Bacteria | 1307 |
| 397 | Ga0495654_0000517 | 3300046530 | Bacteria | 31432 |
| 398 | Ga0495654_0003493 | 3300046530 | Bacteria | 9594 |
| 399 | Ga0495654_0007386 | 3300046530 | Bacteria | 6140 |
| 400 | Ga0495587_0031499 | 3300046536 | Bacteria | 3211 |
| 401 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 402 | Ga0495609_0000481 | 3300046538 | Bacteria | 32044 |
| 403 | Ga0495609_0000805 | 3300046538 | Bacteria | 23447 |
| 404 | Ga0495609_0001357 | 3300046538 | Bacteria | 16491 |
| 405 | Ga0495609_0194681 | 3300046538 | Bacteria | 849 |
| 406 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 407 | Ga0495597_0000657 | 3300046542 | Bacteria | 28084 |
| 408 | Ga0495645_0109995 | 3300046543 | Bacteria | 1951 |
| 409 | Ga0495622_0000250 | 3300046557 | Bacteria | 41868 |
| 410 | Ga0495622_0138764 | 3300046557 | Bacteria | 1104 |
| 411 | Ga0495633_0000182 | 3300046558 | Bacteria | 81881 |
| 412 | Ga0495633_0100349 | 3300046558 | Bacteria | 1344 |
| 413 | Ga0495656_0005296 | 3300046615 | Bacteria | 4444 |
| 414 | Ga0495656_0057167 | 3300046615 | Bacteria | 1688 |
| 415 | Ga0495656_0057738 | 3300046615 | Bacteria | 1681 |
| 416 | Ga0495668_0000081 | 3300046616 | Bacteria | 157245 |
| 417 | Ga0495668_0054982 | 3300046616 | Bacteria | 2198 |
| 418 | Ga0495668_0198896 | 3300046616 | Bacteria | 1097 |
| 419 | Ga0495625_0000075 | 3300046660 | Bacteria | 163672 |
| 420 | Ga0495625_0000085 | 3300046660 | Bacteria | 151877 |
| 421 | Ga0495625_0002309 | 3300046660 | Bacteria | 20852 |
| 422 | Ga0495625_0019647 | 3300046660 | Bacteria | 5232 |
| 423 | Ga0495625_0052942 | 3300046660 | Bacteria | 2905 |
| 424 | Ga0495625_0083107 | 3300046660 | Bacteria | 2226 |
| 425 | Ga0495625_0135114 | 3300046660 | Bacteria | 1668 |
| 426 | Ga0495659_0091845 | 3300046664 | Bacteria | 1166 |
| 427 | Ga0495661_0000032 | 3300046665 | Bacteria | 170076 |
| 428 | Ga0495661_0000296 | 3300046665 | Bacteria | 56421 |
| 429 | Ga0495661_0001556 | 3300046665 | Bacteria | 18911 |
| 430 | Ga0495661_0002595 | 3300046665 | Bacteria | 13854 |
| 431 | Ga0495661_0005929 | 3300046665 | Bacteria | 8635 |
| 432 | Ga0495661_0046303 | 3300046665 | Bacteria | 2656 |
| 433 | Ga0495661_0106028 | 3300046665 | Bacteria | 1573 |
| 434 | Ga0495661_0119979 | 3300046665 | Bacteria | 1454 |
| 435 | Ga0495661_0143402 | 3300046665 | Bacteria | 1297 |
| 436 | Ga0495588_0000062 | 3300046674 | Bacteria | 253674 |
| 437 | Ga0495657_0106721 | 3300046675 | Bacteria | 1778 |
| 438 | Ga0495599_0118850 | 3300046678 | Bacteria | 1643 |
| 439 | Ga0495623_0006238 | 3300046679 | Bacteria | 7756 |
| 440 | Ga0495646_0012579 | 3300046680 | Bacteria | 5378 |
| 441 | Ga0495646_0193574 | 3300046680 | Bacteria | 1110 |
| 442 | Ga0495669_0003442 | 3300046684 | Bacteria | 6520 |
| 443 | Ga0495669_0009489 | 3300046684 | Bacteria | 4104 |
| 444 | Ga0495624_0065500 | 3300046690 | Bacteria | 2270 |
| 445 | Ga0495670_0008160 | 3300046691 | Bacteria | 5148 |
| 446 | Ga0495670_0013252 | 3300046691 | Bacteria | 4055 |
| 447 | Ga0495670_0182532 | 3300046691 | Bacteria | 1108 |
| 448 | Ga0495671_0011479 | 3300046692 | Bacteria | 4869 |
| 449 | Ga0495649_0004303 | 3300046694 | Bacteria | 9342 |
| 450 | Ga0495649_0007543 | 3300046694 | Bacteria | 6622 |
| 451 | Ga0495649_0046939 | 3300046694 | Bacteria | 2350 |
| 452 | Ga0495649_0051552 | 3300046694 | Bacteria | 2231 |
| 453 | Ga0495589_0000022 | 3300046794 | Bacteria | 196021 |
| 454 | Ga0495589_0000262 | 3300046794 | Bacteria | 43085 |
| 455 | Ga0495600_0015479 | 3300046809 | Bacteria | 4821 |
| 456 | Ga0495660_0000044 | 3300046810 | Bacteria | 150926 |
| 457 | Ga0495660_0000885 | 3300046810 | Bacteria | 22126 |
| 458 | Ga0495660_0021618 | 3300046810 | Bacteria | 3682 |
| 459 | Ga0495660_0099572 | 3300046810 | Bacteria | 1498 |
| 460 | Ga0495660_0103970 | 3300046810 | Bacteria | 1458 |
| 461 | Ga0495660_0170272 | 3300046810 | Bacteria | 1061 |
| 462 | Ga0495636_0003729 | 3300047318 | Bacteria | 5933 |
| 463 | Ga0495636_0037815 | 3300047318 | Bacteria | 1994 |
| 464 | Ga0495636_0049374 | 3300047318 | Bacteria | 1759 |
| 465 | Ga0495672_0004947 | 3300047320 | Bacteria | 10700 |
| 466 | Ga0495672_0005111 | 3300047320 | Bacteria | 10475 |
| 467 | Ga0495672_0008750 | 3300047320 | Bacteria | 7420 |
| 468 | Ga0495672_0009727 | 3300047320 | Bacteria | 6932 |
| 469 | Ga0495672_0054831 | 3300047320 | Bacteria | 2328 |
| 470 | Ga0495680_0035839 | 3300047322 | Bacteria | 3990 |
| 471 | Ga0495683_0006780 | 3300047323 | Bacteria | 6226 |
| 472 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 473 | Ga0495687_000030 | 3300047443 | Bacteria | 279992 |
| 474 | Ga0495687_000036 | 3300047443 | Bacteria | 255427 |
| 475 | Ga0495687_000099 | 3300047443 | Bacteria | 132139 |
| 476 | Ga0495687_003585 | 3300047443 | Bacteria | 11130 |
| 477 | Ga0495687_004614 | 3300047443 | Bacteria | 9206 |
| 478 | Ga0495687_004678 | 3300047443 | Bacteria | 9119 |
| 479 | Ga0495687_013260 | 3300047443 | Bacteria | 4313 |
| 480 | Ga0495687_020999 | 3300047443 | Bacteria | 3171 |
| 481 | Ga0495677_0000018 | 3300047445 | Bacteria | 120412 |
| 482 | Ga0495677_0000180 | 3300047445 | Bacteria | 29724 |
| 483 | Ga0495677_0002528 | 3300047445 | Bacteria | 7152 |
| 484 | Ga0495677_0003843 | 3300047445 | Bacteria | 5814 |
| 485 | Ga0495677_0018519 | 3300047445 | Bacteria | 2524 |
| 486 | Ga0495677_0046428 | 3300047445 | Bacteria | 1594 |
| 487 | Ga0495679_010064 | 3300047446 | Bacteria | 3741 |
| 488 | Ga0495685_009501 | 3300047447 | Bacteria | 3251 |
| 489 | Ga0495673_0004005 | 3300047469 | Bacteria | 9406 |
| 490 | Ga0495673_0046905 | 3300047469 | Bacteria | 1912 |
| 491 | Ga0495681_0000470 | 3300047470 | Bacteria | 30938 |
| 492 | Ga0495681_0002740 | 3300047470 | Bacteria | 12472 |
| 493 | Ga0495681_0009448 | 3300047470 | Bacteria | 6009 |
| 494 | Ga0495686_0138949 | 3300047472 | Bacteria | 1434 |
| 495 | Ga0495602_0009630 | 3300048088 | Bacteria | 10041 |
| 496 | Ga0495602_0033932 | 3300048088 | Bacteria | 4780 |
| 497 | Ga0495626_0000021 | 3300048091 | Bacteria | 217213 |
| 498 | Ga0495626_0001492 | 3300048091 | Bacteria | 18472 |
| 499 | Ga0495626_0001909 | 3300048091 | Bacteria | 15532 |
| 500 | Ga0495626_0034766 | 3300048091 | Bacteria | 2409 |
| 501 | Ga0496101_0131929 | 3300048904 | Bacteria | 1897 |
| 502 | Ga0496101_0487975 | 3300048904 | Unclassified | 973 |
| 503 | Ga0496102_0000141 | 3300048905 | Bacteria | 97499 |
| 504 | Ga0496103_0000172 | 3300048906 | Bacteria | 67575 |
| 505 | Ga0496103_0000714 | 3300048906 | Bacteria | 24603 |
| 506 | Ga0496103_0029085 | 3300048906 | Bacteria | 3357 |
| 507 | Ga0496104_0000114 | 3300048907 | Bacteria | 75253 |
| 508 | Ga0496104_0096802 | 3300048907 | Bacteria | 2824 |
| 509 | Ga0496105_0000073 | 3300048908 | Bacteria | 76800 |
| 510 | Ga0496106_0090662 | 3300048909 | Bacteria | 2359 |
| 511 | Ga0496107_0189216 | 3300048910 | Bacteria | 1529 |
| 512 | Ga0496108_0002349 | 3300048911 | Bacteria | 15150 |
| 513 | Ga0496110_0178143 | 3300048913 | Bacteria | 1930 |
| 514 | Ga0496111_0108992 | 3300048914 | Bacteria | 2039 |
| 515 | Ga0496112_0131310 | 3300048915 | Bacteria | 2475 |
| 516 | Ga0496113_0001094 | 3300048916 | Bacteria | 14674 |
| 517 | Ga0496113_0166974 | 3300048916 | Bacteria | 1742 |
| 518 | Ga0496116_0027993 | 3300048919 | Bacteria | 4093 |
| 519 | Ga0496117_0000296 | 3300048920 | Bacteria | 88277 |
| 520 | Ga0496117_0028492 | 3300048920 | Bacteria | 4324 |
| 521 | Ga0496118_0000897 | 3300048921 | Bacteria | 46751 |
| 522 | Ga0496118_0009768 | 3300048921 | Bacteria | 9621 |
| 523 | Ga0496118_0017593 | 3300048921 | Bacteria | 6495 |
| 524 | Ga0496118_0034052 | 3300048921 | Bacteria | 4166 |
| 525 | Ga0496119_0000040 | 3300048922 | Bacteria | 208180 |
| 526 | Ga0496120_0001789 | 3300048923 | Bacteria | 24155 |
| 527 | Ga0496120_0066595 | 3300048923 | Bacteria | 1992 |
| 528 | Ga0496121_0000349 | 3300048924 | Bacteria | 96428 |
| 529 | Ga0496121_0001289 | 3300048924 | Bacteria | 43185 |
| 530 | Ga0496121_0021553 | 3300048924 | Bacteria | 6305 |
| 531 | Ga0496122_0000456 | 3300048925 | Bacteria | 84896 |
| 532 | Ga0496123_0000847 | 3300048926 | Bacteria | 48919 |
| 533 | Ga0496124_0001770 | 3300048927 | Bacteria | 30051 |
| 534 | Ga0496124_0091700 | 3300048927 | Bacteria | 2475 |
| 535 | Ga0496124_0094798 | 3300048927 | Bacteria | 2426 |
| 536 | Ga0496124_0173736 | 3300048927 | Bacteria | 1665 |
| 537 | Ga0496125_0000603 | 3300048928 | Bacteria | 61238 |
| 538 | Ga0496125_0004486 | 3300048928 | Bacteria | 16083 |
| 539 | Ga0496125_0027411 | 3300048928 | Bacteria | 5163 |
| 540 | Ga0496126_0000044 | 3300048929 | Bacteria | 335904 |
| 541 | Ga0496126_0027600 | 3300048929 | Bacteria | 5420 |
| 542 | Ga0496126_0051608 | 3300048929 | Bacteria | 3743 |
| 543 | Ga0495678_000615 | 3300049459 | Bacteria | 33335 |
| 544 | Ga0495678_001847 | 3300049459 | Bacteria | 15487 |
| 545 | Ga0495678_031817 | 3300049459 | Bacteria | 2195 |
| 546 | Ga0495682_0014455 | 3300049460 | Bacteria | 2993 |
| 547 | Ga0501314_000711 | 3300049530 | Bacteria | 2171 |
| 548 | Ga0501314_001936 | 3300049530 | Bacteria | 1558 |
| 549 | Ga0501337_001475 | 3300049553 | Bacteria | 1351 |
| 550 | Ga0501034_0034001 | 3300049571 | Bacteria | 5169 |
| 551 | Ga0501068_0011711 | 3300049584 | Bacteria | 4959 |
| 552 | Ga0501075_0091181 | 3300049591 | Bacteria | 2313 |
| 553 | Ga0501076_0113575 | 3300049592 | Bacteria | 2191 |
| 554 | Ga0501198_006436 | 3300049649 | Bacteria | 1673 |
| 555 | Ga0501217_019324 | 3300049661 | Bacteria | 1590 |
| 556 | Ga0501222_000088 | 3300049662 | Bacteria | 24766 |
| 557 | Ga0501223_000023 | 3300049663 | Bacteria | 64396 |
| 558 | Ga0501224_000001 | 3300049664 | Bacteria | 308131 |
| 559 | Ga0501227_000017 | 3300049665 | Bacteria | 25575 |
| 560 | Ga0501235_004663 | 3300049669 | Bacteria | 2964 |
| 561 | Ga0501235_012178 | 3300049669 | Bacteria | 1890 |
| 562 | Ga0501240_022192 | 3300049673 | Bacteria | 964 |
| 563 | Ga0501225_0000012 | 3300049705 | Bacteria | 73262 |
| 564 | Ga0501225_0051679 | 3300049705 | Bacteria | 1145 |
| 565 | Ga0501234_002530 | 3300049707 | Bacteria | 2876 |
| 566 | Ga0501241_017251 | 3300049758 | Bacteria | 1319 |
| 567 | Ga0501269_000062 | 3300049766 | Bacteria | 33601 |
| 568 | Ga0501212_033239 | 3300049851 | Bacteria | 837 |
| 569 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 570 | Ga0501226_000133 | 3300049853 | Bacteria | 14424 |
| 571 | Ga0501226_001644 | 3300049853 | Bacteria | 2829 |
| 572 | nmdc:mga03683_143629_c1 | 3300050489 | Bacteria | 1074 |
| 573 | nmdc:mga0k408_142875_c1 | 3300050493 | Bacteria | 1424 |
| 574 | nmdc:mga05p37_185292_c1 | 3300050507 | Bacteria | 2531 |
| 575 | nmdc:mga09592_3175_c1 | 3300050508 | Bacteria | 13343 |
| 576 | nmdc:mga0qj67_31712_c1 | 3300050509 | Bacteria | 4119 |
| 577 | nmdc:mga0qj67_90370_c1 | 3300050509 | Bacteria | 2460 |
| 578 | nmdc:mga06r32_304_c1 | 3300050510 | Bacteria | 40653 |
| 579 | nmdc:mga06r32_7531_c1 | 3300050510 | Bacteria | 9790 |
| 580 | nmdc:mga08y16_185997_c1 | 3300050511 | Bacteria | 2156 |
| 581 | nmdc:mga08y16_26669_c1 | 3300050511 | Bacteria | 6089 |
| 582 | nmdc:mga08y16_67_c1 | 3300050511 | Bacteria | 46512 |
| 583 | nmdc:mga0n895_419829_c1 | 3300050512 | Bacteria | 1352 |
| 584 | nmdc:mga0a205_184726_c1 | 3300050515 | Bacteria | 1978 |
| 585 | Ga0495601_0014913 | 3300053077 | Bacteria | 4691 |
| 586 | Ga0500578_0170688 | 3300053086 | Bacteria | 1345 |
| 587 | Ga0500647_0023348 | 3300053091 | Bacteria | 2901 |
| 588 | Ga0500651_0176328 | 3300053093 | Bacteria | 1271 |
| 589 | Ga0500641_0109166 | 3300053096 | Bacteria | 1190 |
| 590 | Ga0500555_001005 | 3300053103 | Bacteria | 9632 |
| 591 | Ga0500556_0036718 | 3300053104 | Bacteria | 1701 |
| 592 | Ga0500594_0095383 | 3300053118 | Bacteria | 909 |
| 593 | Ga0500595_000649 | 3300053119 | Bacteria | 20941 |
| 594 | Ga0500614_014410 | 3300053123 | Bacteria | 1750 |
| 595 | Ga0500642_0076847 | 3300053130 | Bacteria | 1527 |
| 596 | Ga0500655_000020 | 3300053133 | Bacteria | 44643 |
| 597 | Ga0500658_0097414 | 3300053134 | Bacteria | 1280 |
| 598 | Ga0500568_0005368 | 3300053139 | Bacteria | 6638 |
| 599 | Ga0500568_0011431 | 3300053139 | Bacteria | 4120 |
| 600 | Ga0500590_000179 | 3300053148 | Bacteria | 18932 |
| 601 | Ga0500590_018523 | 3300053148 | Bacteria | 3603 |
| 602 | Ga0500619_000597 | 3300053154 | Bacteria | 6164 |
| 603 | Ga0500622_0009642 | 3300053156 | Bacteria | 5336 |
| 604 | Ga0500622_0038508 | 3300053156 | Bacteria | 2493 |
| 605 | Ga0500622_0067288 | 3300053156 | Bacteria | 1817 |
| 606 | Ga0500639_021723 | 3300053163 | Bacteria | 3391 |
| 607 | Ga0500636_0037424 | 3300053177 | Bacteria | 2871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10001044 | Ga0105240_1000104432 | 196 |
| 2 | 3300009545 | Ga0105237_10066212 | Ga0105237_100662124 | 196 |
| 3 | 3300009551 | Ga0105238_10006969 | Ga0105238_100069695 | 196 |
| 4 | 3300010375 | Ga0105239_10310621 | Ga0105239_103106213 | 196 |
| 5 | 3300048921 | Ga0496118_0034052 | Ga0496118_0034052_852_1517 | 196 |
| 6 | 3300005548 | Ga0070665_100000927 | Ga0070665_10000092717 | 200 |
| 7 | 3300028379 | Ga0268266_10001167 | Ga0268266_1000116726 | 200 |
| 8 | 3300031901 | Ga0307406_10013809 | Ga0307406_100138092 | 200 |
| 9 | 3300048904 | Ga0496101_0487975 | Ga0496101_0487975_17_670 | 200 |
| 10 | 3300009093 | Ga0105240_10043932 | Ga0105240_100439325 | 201 |
| 11 | 3300009174 | Ga0105241_10063864 | Ga0105241_100638643 | 201 |
| 12 | 3300010375 | Ga0105239_10134079 | Ga0105239_101340793 | 201 |
| 13 | 3300025911 | Ga0207654_10076195 | Ga0207654_100761952 | 201 |
| 14 | 3300009098 | Ga0105245_10827443 | Ga0105245_108274431 | 203 |
| 15 | 3300009174 | Ga0105241_10250715 | Ga0105241_102507152 | 203 |
| 16 | 3300009177 | Ga0105248_10984768 | Ga0105248_109847682 | 203 |
| 17 | 3300009551 | Ga0105238_10031389 | Ga0105238_100313891 | 203 |
| 18 | 3300009553 | Ga0105249_10007119 | Ga0105249_1000711910 | 203 |
| 19 | 3300013104 | Ga0157370_10198314 | Ga0157370_101983142 | 203 |
| 20 | 3300013296 | Ga0157374_10052349 | Ga0157374_100523495 | 203 |
| 21 | 3300014325 | Ga0163163_10712689 | Ga0163163_107126891 | 203 |
| 22 | 3300031649 | Ga0307514_10000560 | Ga0307514_1000056068 | 203 |
| 23 | 3300037312 | Ga0395899_0442563 | Ga0395899_0442563_16_741 | 203 |
| 24 | 3300037418 | Ga0395900_0011596 | Ga0395900_0011596_6245_6970 | 203 |
| 25 | 3300037466 | Ga0395898_0169252 | Ga0395898_0169252_1348_2073 | 203 |
| 26 | 3300041407 | Ga0439447_001889 | Ga0439447_001889_6361_7083 | 203 |
| 27 | 3300046507 | Ga0495606_0003774 | Ga0495606_0003774_3942_4667 | 203 |
| 28 | 3300047443 | Ga0495687_000036 | Ga0495687_000036_187613_188338 | 203 |
| 29 | 3300005290 | Ga0065712_10074421 | Ga0065712_100744212 | 205 |
| 30 | 3300005293 | Ga0065715_10091000 | Ga0065715_100910007 | 205 |
| 31 | 3300005330 | Ga0070690_100012685 | Ga0070690_1000126855 | 205 |
| 32 | 3300005331 | Ga0070670_100011405 | Ga0070670_1000114053 | 205 |
| 33 | 3300005334 | Ga0068869_100001690 | Ga0068869_10000169012 | 205 |
| 34 | 3300005335 | Ga0070666_10031767 | Ga0070666_100317674 | 205 |
| 35 | 3300005340 | Ga0070689_100002431 | Ga0070689_1000024313 | 205 |
| 36 | 3300005343 | Ga0070687_100000745 | Ga0070687_10000074514 | 205 |
| 37 | 3300005347 | Ga0070668_100002999 | Ga0070668_10000299911 | 205 |
| 38 | 3300005347 | Ga0070668_100269788 | Ga0070668_1002697882 | 205 |
| 39 | 3300005353 | Ga0070669_100019080 | Ga0070669_1000190804 | 205 |
| 40 | 3300005353 | Ga0070669_100102806 | Ga0070669_1001028062 | 205 |
| 41 | 3300005354 | Ga0070675_100005984 | Ga0070675_1000059842 | 205 |
| 42 | 3300005355 | Ga0070671_100107557 | Ga0070671_1001075574 | 205 |
| 43 | 3300005356 | Ga0070674_100109976 | Ga0070674_1001099763 | 205 |
| 44 | 3300005364 | Ga0070673_100011869 | Ga0070673_1000118694 | 205 |
| 45 | 3300005366 | Ga0070659_100065043 | Ga0070659_1000650432 | 205 |
| 46 | 3300005440 | Ga0070705_100025518 | Ga0070705_1000255184 | 205 |
| 47 | 3300005457 | Ga0070662_100095391 | Ga0070662_1000953912 | 205 |
| 48 | 3300005459 | Ga0068867_100163601 | Ga0068867_1001636012 | 205 |
| 49 | 3300005530 | Ga0070679_100836392 | Ga0070679_1008363921 | 205 |
| 50 | 3300005543 | Ga0070672_100062494 | Ga0070672_1000624942 | 205 |
| 51 | 3300005544 | Ga0070686_100006153 | Ga0070686_1000061532 | 205 |
| 52 | 3300005564 | Ga0070664_100000407 | Ga0070664_1000004074 | 205 |
| 53 | 3300005577 | Ga0068857_100006474 | Ga0068857_10000647411 | 205 |
| 54 | 3300005615 | Ga0070702_100000337 | Ga0070702_10000033718 | 205 |
| 55 | 3300005615 | Ga0070702_100058102 | Ga0070702_1000581022 | 205 |
| 56 | 3300005616 | Ga0068852_100377511 | Ga0068852_1003775112 | 205 |
| 57 | 3300005617 | Ga0068859_100005511 | Ga0068859_1000055113 | 205 |
| 58 | 3300005618 | Ga0068864_100002840 | Ga0068864_1000028403 | 205 |
| 59 | 3300005718 | Ga0068866_10190291 | Ga0068866_101902912 | 205 |
| 60 | 3300005719 | Ga0068861_100002090 | Ga0068861_1000020902 | 205 |
| 61 | 3300005719 | Ga0068861_100017772 | Ga0068861_1000177723 | 205 |
| 62 | 3300005841 | Ga0068863_100004022 | Ga0068863_1000040222 | 205 |
| 63 | 3300005842 | Ga0068858_100053591 | Ga0068858_1000535914 | 205 |
| 64 | 3300005843 | Ga0068860_100023234 | Ga0068860_1000232343 | 205 |
| 65 | 3300005844 | Ga0068862_100000717 | Ga0068862_1000007172 | 205 |
| 66 | 3300005844 | Ga0068862_100007978 | Ga0068862_1000079784 | 205 |
| 67 | 3300005844 | Ga0068862_100533992 | Ga0068862_1005339922 | 205 |
| 68 | 3300006237 | Ga0097621_100014346 | Ga0097621_1000143463 | 205 |
| 69 | 3300006358 | Ga0068871_100085590 | Ga0068871_1000855902 | 205 |
| 70 | 3300006844 | Ga0075428_100000169 | Ga0075428_10000016920 | 205 |
| 71 | 3300006844 | Ga0075428_100032405 | Ga0075428_1000324055 | 205 |
| 72 | 3300006846 | Ga0075430_100065220 | Ga0075430_1000652202 | 205 |
| 73 | 3300006847 | Ga0075431_100001534 | Ga0075431_10000153417 | 205 |
| 74 | 3300006847 | Ga0075431_100115893 | Ga0075431_1001158932 | 205 |
| 75 | 3300006871 | Ga0075434_100143758 | Ga0075434_1001437583 | 205 |
| 76 | 3300006880 | Ga0075429_100010561 | Ga0075429_1000105618 | 205 |
| 77 | 3300006880 | Ga0075429_100133492 | Ga0075429_1001334923 | 205 |
| 78 | 3300006931 | Ga0097620_100005511 | Ga0097620_10000551117 | 205 |
| 79 | 3300007076 | Ga0075435_100135190 | Ga0075435_1001351902 | 205 |
| 80 | 3300009094 | Ga0111539_10000211 | Ga0111539_1000021140 | 205 |
| 81 | 3300009094 | Ga0111539_10036727 | Ga0111539_100367274 | 205 |
| 82 | 3300009094 | Ga0111539_10045457 | Ga0111539_100454576 | 205 |
| 83 | 3300009147 | Ga0114129_10005515 | Ga0114129_1000551519 | 205 |
| 84 | 3300009177 | Ga0105248_10000481 | Ga0105248_1000048125 | 205 |
| 85 | 3300009553 | Ga0105249_10010625 | Ga0105249_1001062510 | 205 |
| 86 | 3300009553 | Ga0105249_10059838 | Ga0105249_100598382 | 205 |
| 87 | 3300010375 | Ga0105239_10660568 | Ga0105239_106605682 | 205 |
| 88 | 3300011119 | Ga0105246_10083515 | Ga0105246_100835153 | 205 |
| 89 | 3300011119 | Ga0105246_10250212 | Ga0105246_102502122 | 205 |
| 90 | 3300013297 | Ga0157378_10409737 | Ga0157378_104097372 | 205 |
| 91 | 3300013306 | Ga0163162_10010863 | Ga0163162_100108638 | 205 |
| 92 | 3300013306 | Ga0163162_10206270 | Ga0163162_102062703 | 205 |
| 93 | 3300014325 | Ga0163163_10000701 | Ga0163163_100007013 | 205 |
| 94 | 3300014745 | Ga0157377_10004768 | Ga0157377_100047683 | 205 |
| 95 | 3300014968 | Ga0157379_10077036 | Ga0157379_100770364 | 205 |
| 96 | 3300014969 | Ga0157376_10030454 | Ga0157376_100304543 | 205 |
| 97 | 3300017792 | Ga0163161_10120631 | Ga0163161_101206312 | 205 |
| 98 | 3300025903 | Ga0207680_10015898 | Ga0207680_100158983 | 205 |
| 99 | 3300025912 | Ga0207707_10123394 | Ga0207707_101233942 | 205 |
| 100 | 3300025917 | Ga0207660_10039700 | Ga0207660_100397003 | 205 |
| 101 | 3300025918 | Ga0207662_10001211 | Ga0207662_100012114 | 205 |
| 102 | 3300025923 | Ga0207681_10005572 | Ga0207681_100055726 | 205 |
| 103 | 3300025923 | Ga0207681_10091493 | Ga0207681_100914932 | 205 |
| 104 | 3300025925 | Ga0207650_10122363 | Ga0207650_101223632 | 205 |
| 105 | 3300025926 | Ga0207659_10006777 | Ga0207659_100067772 | 205 |
| 106 | 3300025931 | Ga0207644_10039125 | Ga0207644_100391254 | 205 |
| 107 | 3300025933 | Ga0207706_10007815 | Ga0207706_100078159 | 205 |
| 108 | 3300025936 | Ga0207670_10009198 | Ga0207670_100091984 | 205 |
| 109 | 3300025937 | Ga0207669_10221806 | Ga0207669_102218062 | 205 |
| 110 | 3300025937 | Ga0207669_10296729 | Ga0207669_102967292 | 205 |
| 111 | 3300025938 | Ga0207704_10010945 | Ga0207704_100109452 | 205 |
| 112 | 3300025940 | Ga0207691_10003092 | Ga0207691_1000309217 | 205 |
| 113 | 3300025941 | Ga0207711_10041672 | Ga0207711_100416722 | 205 |
| 114 | 3300025942 | Ga0207689_10042532 | Ga0207689_100425324 | 205 |
| 115 | 3300025945 | Ga0207679_10012714 | Ga0207679_100127143 | 205 |
| 116 | 3300025960 | Ga0207651_10028775 | Ga0207651_100287752 | 205 |
| 117 | 3300025961 | Ga0207712_10009969 | Ga0207712_100099696 | 205 |
| 118 | 3300025961 | Ga0207712_10081715 | Ga0207712_100817153 | 205 |
| 119 | 3300025972 | Ga0207668_10013971 | Ga0207668_100139714 | 205 |
| 120 | 3300025972 | Ga0207668_10199429 | Ga0207668_101994293 | 205 |
| 121 | 3300026035 | Ga0207703_10039620 | Ga0207703_100396202 | 205 |
| 122 | 3300026075 | Ga0207708_10019290 | Ga0207708_100192904 | 205 |
| 123 | 3300026088 | Ga0207641_10001988 | Ga0207641_1000198821 | 205 |
| 124 | 3300026089 | Ga0207648_10027433 | Ga0207648_100274332 | 205 |
| 125 | 3300026095 | Ga0207676_10001544 | Ga0207676_100015448 | 205 |
| 126 | 3300026116 | Ga0207674_10008195 | Ga0207674_100081957 | 205 |
| 127 | 3300026116 | Ga0207674_10023959 | Ga0207674_100239596 | 205 |
| 128 | 3300026118 | Ga0207675_100001056 | Ga0207675_1000010569 | 205 |
| 129 | 3300027907 | Ga0207428_10012513 | Ga0207428_100125133 | 205 |
| 130 | 3300027907 | Ga0207428_10018147 | Ga0207428_100181475 | 205 |
| 131 | 3300028380 | Ga0268265_10001502 | Ga0268265_1000150218 | 205 |
| 132 | 3300028380 | Ga0268265_10009556 | Ga0268265_100095565 | 205 |
| 133 | 3300028381 | Ga0268264_10060345 | Ga0268264_100603452 | 205 |
| 134 | 3300031548 | Ga0307408_100125360 | Ga0307408_1001253601 | 205 |
| 135 | 3300031616 | Ga0307508_10017078 | Ga0307508_100170782 | 205 |
| 136 | 3300031730 | Ga0307516_10092183 | Ga0307516_100921834 | 205 |
| 137 | 3300032002 | Ga0307416_100284282 | Ga0307416_1002842822 | 205 |
| 138 | 3300032004 | Ga0307414_10113141 | Ga0307414_101131412 | 205 |
| 139 | 3300032005 | Ga0307411_10059735 | Ga0307411_100597353 | 205 |
| 140 | 3300033179 | Ga0307507_10059082 | Ga0307507_100590824 | 205 |
| 141 | 3300034819 | Ga0373958_0013596 | Ga0373958_0013596_153_842 | 205 |
| 142 | 3300035691 | Ga0373931_0021027 | Ga0373931_0021027_2140_2829 | 205 |
| 143 | 3300042438 | Ga0439459_0028362 | Ga0439459_0028362_245_934 | 205 |
| 144 | 3300042439 | Ga0439464_0026469 | Ga0439464_0026469_886_1575 | 205 |
| 145 | 3300045051 | Ga0451576_0026526 | Ga0451576_0026526_2653_3342 | 205 |
| 146 | 3300046453 | Ga0495627_000001 | Ga0495627_000001_99654_100400 | 205 |
| 147 | 3300046660 | Ga0495625_0083107 | Ga0495625_0083107_1111_1842 | 205 |
| 148 | 3300048907 | Ga0496104_0096802 | Ga0496104_0096802_1084_1773 | 205 |
| 149 | 3300048909 | Ga0496106_0090662 | Ga0496106_0090662_700_1389 | 205 |
| 150 | 3300048915 | Ga0496112_0131310 | Ga0496112_0131310_1089_1778 | 205 |
| 151 | 3300048916 | Ga0496113_0166974 | Ga0496113_0166974_120_809 | 205 |
| 152 | 3300049591 | Ga0501075_0091181 | Ga0501075_0091181_673_1362 | 205 |
| 153 | 3300049592 | Ga0501076_0113575 | Ga0501076_0113575_1432_2121 | 205 |
| 154 | 3300049661 | Ga0501217_019324 | Ga0501217_019324_436_1125 | 205 |
| 155 | 3300049705 | Ga0501225_0051679 | Ga0501225_0051679_148_837 | 205 |
| 156 | 3300049851 | Ga0501212_033239 | Ga0501212_033239_21_710 | 205 |
| 157 | 3300050507 | nmdc:mga05p37_185292_c1 | nmdc:mga05p37_185292_c1_1358_2047 | 205 |
| 158 | 3300050508 | nmdc:mga09592_3175_c1 | nmdc:mga09592_3175_c1_5847_6536 | 205 |
| 159 | 3300050509 | nmdc:mga0qj67_31712_c1 | nmdc:mga0qj67_31712_c1_2187_2876 | 205 |
| 160 | 3300050510 | nmdc:mga06r32_304_c1 | nmdc:mga06r32_304_c1_36613_37302 | 205 |
| 161 | 3300050510 | nmdc:mga06r32_7531_c1 | nmdc:mga06r32_7531_c1_4363_5052 | 205 |
| 162 | 3300050511 | nmdc:mga08y16_185997_c1 | nmdc:mga08y16_185997_c1_922_1611 | 205 |
| 163 | 3300050511 | nmdc:mga08y16_26669_c1 | nmdc:mga08y16_26669_c1_2325_3014 | 205 |
| 164 | 3300050511 | nmdc:mga08y16_67_c1 | nmdc:mga08y16_67_c1_9209_9898 | 205 |
| 165 | 3300050512 | nmdc:mga0n895_419829_c1 | nmdc:mga0n895_419829_c1_349_1038 | 205 |
| 166 | 3300050515 | nmdc:mga0a205_184726_c1 | nmdc:mga0a205_184726_c1_394_1083 | 205 |
| 167 | iso_pu_bacteria | 2961064222 | 2961067904 | 205 |
| 168 | 3300032005 | Ga0307411_10120724 | Ga0307411_101207242 | 206 |
| 169 | 3300046660 | Ga0495625_0000085 | Ga0495625_0000085_46073_46777 | 206 |
| 170 | iso_pu_bacteria | 2904479285 | 2904479732 | 206 |
| 171 | 3300005455 | Ga0070663_100060431 | Ga0070663_1000604314 | 207 |
| 172 | 3300005466 | Ga0070685_10001937 | Ga0070685_100019377 | 207 |
| 173 | 3300005616 | Ga0068852_100053366 | Ga0068852_1000533664 | 207 |
| 174 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007198 | 207 |
| 175 | 3300025914 | Ga0207671_10021376 | Ga0207671_100213766 | 207 |
| 176 | 3300025924 | Ga0207694_10005080 | Ga0207694_100050809 | 207 |
| 177 | 3300026067 | Ga0207678_10117713 | Ga0207678_101177133 | 207 |
| 178 | 3300026142 | Ga0207698_10056303 | Ga0207698_100563033 | 207 |
| 179 | 3300031852 | Ga0307410_10201688 | Ga0307410_102016881 | 207 |
| 180 | 3300049584 | Ga0501068_0011711 | Ga0501068_0011711_1342_2043 | 207 |
| 181 | iso_pu_bacteria | 2791355123 | 2792746111 | 207 |
| 182 | 3300028786 | Ga0307517_10000058 | Ga0307517_10000058110 | 208 |
| 183 | 3300031548 | Ga0307408_100493292 | Ga0307408_1004932922 | 208 |
| 184 | 3300053156 | Ga0500622_0009642 | Ga0500622_0009642_3178_3882 | 208 |
| 185 | 3300053156 | Ga0500622_0038508 | Ga0500622_0038508_688_1392 | 208 |
| 186 | iso_pu_bacteria | 2519899620 | 2520382074 | 208 |
| 187 | iso_pu_bacteria | 2857553236 | 2857555438 | 208 |
| 188 | iso_pu_bacteria | 2958122699 | 2958127027 | 208 |
| 189 | iso_pu_bacteria | 2977872689 | 2977878304 | 208 |
| 190 | 3300031507 | Ga0307509_10001175 | Ga0307509_1000117542 | 209 |
| 191 | 3300031507 | Ga0307509_10002372 | Ga0307509_1000237226 | 209 |
| 192 | 3300031548 | Ga0307408_100000004 | Ga0307408_100000004487 | 209 |
| 193 | 3300031548 | Ga0307408_100399522 | Ga0307408_1003995222 | 209 |
| 194 | 3300031901 | Ga0307406_10096947 | Ga0307406_100969472 | 209 |
| 195 | 3300031995 | Ga0307409_100687550 | Ga0307409_1006875502 | 209 |
| 196 | 3300032004 | Ga0307414_10425698 | Ga0307414_104256981 | 209 |
| 197 | 3300046491 | Ga0495584_0015154 | Ga0495584_0015154_1698_2405 | 209 |
| 198 | 3300046538 | Ga0495609_0194681 | Ga0495609_0194681_15_722 | 209 |
| 199 | 3300046542 | Ga0495597_0000657 | Ga0495597_0000657_2652_3359 | 209 |
| 200 | 3300046660 | Ga0495625_0052942 | Ga0495625_0052942_1332_2039 | 209 |
| 201 | 3300047318 | Ga0495636_0003729 | Ga0495636_0003729_1752_2459 | 209 |
| 202 | 3300047318 | Ga0495636_0037815 | Ga0495636_0037815_54_761 | 209 |
| 203 | 3300047320 | Ga0495672_0004947 | Ga0495672_0004947_8402_9109 | 209 |
| 204 | 3300047320 | Ga0495672_0009727 | Ga0495672_0009727_6223_6921 | 209 |
| 205 | 3300047443 | Ga0495687_013260 | Ga0495687_013260_1739_2446 | 209 |
| 206 | 3300047445 | Ga0495677_0003843 | Ga0495677_0003843_1855_2562 | 209 |
| 207 | 3300049460 | Ga0495682_0014455 | Ga0495682_0014455_1258_1965 | 209 |
| 208 | iso_pu_bacteria | 2585427591 | 2585828605 | 209 |
| 209 | iso_pu_bacteria | 2808606395 | 2809032502 | 209 |
| 210 | 2162886007 | SwRhRL2b_contig_3606524 | SwRhRL2b_0789.00004390 | 210 |
| 211 | 3300001989 | JGI24739J22299_10024580 | JGI24739J22299_100245803 | 210 |
| 212 | 3300005289 | Ga0065704_10000381 | Ga0065704_1000038111 | 210 |
| 213 | 3300005327 | Ga0070658_10452842 | Ga0070658_104528421 | 210 |
| 214 | 3300005331 | Ga0070670_100234080 | Ga0070670_1002340802 | 210 |
| 215 | 3300005335 | Ga0070666_10016408 | Ga0070666_100164085 | 210 |
| 216 | 3300005347 | Ga0070668_100008625 | Ga0070668_1000086255 | 210 |
| 217 | 3300005347 | Ga0070668_100008723 | Ga0070668_1000087232 | 210 |
| 218 | 3300005353 | Ga0070669_100000081 | Ga0070669_10000008148 | 210 |
| 219 | 3300005353 | Ga0070669_100000510 | Ga0070669_1000005103 | 210 |
| 220 | 3300005355 | Ga0070671_100005749 | Ga0070671_1000057498 | 210 |
| 221 | 3300005355 | Ga0070671_100009303 | Ga0070671_1000093036 | 210 |
| 222 | 3300005367 | Ga0070667_100221948 | Ga0070667_1002219482 | 210 |
| 223 | 3300005841 | Ga0068863_100013953 | Ga0068863_1000139539 | 210 |
| 224 | 3300005842 | Ga0068858_100007537 | Ga0068858_1000075378 | 210 |
| 225 | 3300005842 | Ga0068858_100943901 | Ga0068858_1009439011 | 210 |
| 226 | 3300005843 | Ga0068860_100027388 | Ga0068860_1000273883 | 210 |
| 227 | 3300005843 | Ga0068860_100030476 | Ga0068860_1000304765 | 210 |
| 228 | 3300005844 | Ga0068862_100018471 | Ga0068862_1000184717 | 210 |
| 229 | 3300005844 | Ga0068862_100321379 | Ga0068862_1003213792 | 210 |
| 230 | 3300006058 | Ga0075432_10003497 | Ga0075432_100034975 | 210 |
| 231 | 3300009101 | Ga0105247_10024848 | Ga0105247_100248483 | 210 |
| 232 | 3300009177 | Ga0105248_10027224 | Ga0105248_100272245 | 210 |
| 233 | 3300009553 | Ga0105249_10026864 | Ga0105249_100268643 | 210 |
| 234 | 3300011119 | Ga0105246_10085753 | Ga0105246_100857532 | 210 |
| 235 | 3300013306 | Ga0163162_10005070 | Ga0163162_1000507010 | 210 |
| 236 | 3300015262 | Ga0182007_10000611 | Ga0182007_100006113 | 210 |
| 237 | 3300017792 | Ga0163161_10143068 | Ga0163161_101430683 | 210 |
| 238 | 3300025254 | Ga0209148_1000227 | Ga0209148_100022759 | 210 |
| 239 | 3300025303 | Ga0209051_1017508 | Ga0209051_10175082 | 210 |
| 240 | 3300025711 | Ga0207696_1010931 | Ga0207696_10109315 | 210 |
| 241 | 3300025735 | Ga0207713_1000492 | Ga0207713_100049230 | 210 |
| 242 | 3300025735 | Ga0207713_1002098 | Ga0207713_100209810 | 210 |
| 243 | 3300025735 | Ga0207713_1008187 | Ga0207713_10081877 | 210 |
| 244 | 3300025903 | Ga0207680_10011897 | Ga0207680_100118973 | 210 |
| 245 | 3300025904 | Ga0207647_10011593 | Ga0207647_100115934 | 210 |
| 246 | 3300025923 | Ga0207681_10000630 | Ga0207681_1000063017 | 210 |
| 247 | 3300025923 | Ga0207681_10003919 | Ga0207681_100039193 | 210 |
| 248 | 3300025925 | Ga0207650_10251191 | Ga0207650_102511911 | 210 |
| 249 | 3300025931 | Ga0207644_10002093 | Ga0207644_1000209310 | 210 |
| 250 | 3300025931 | Ga0207644_10007470 | Ga0207644_100074705 | 210 |
| 251 | 3300025941 | Ga0207711_10003285 | Ga0207711_100032855 | 210 |
| 252 | 3300025941 | Ga0207711_10158375 | Ga0207711_101583752 | 210 |
| 253 | 3300025961 | Ga0207712_10045977 | Ga0207712_100459774 | 210 |
| 254 | 3300025972 | Ga0207668_10417531 | Ga0207668_104175312 | 210 |
| 255 | 3300025986 | Ga0207658_10025917 | Ga0207658_100259174 | 210 |
| 256 | 3300026035 | Ga0207703_10168827 | Ga0207703_101688272 | 210 |
| 257 | 3300026088 | Ga0207641_10000930 | Ga0207641_1000093012 | 210 |
| 258 | 3300027111 | Ga0209281_1006317 | Ga0209281_10063174 | 210 |
| 259 | 3300028380 | Ga0268265_10079359 | Ga0268265_100793594 | 210 |
| 260 | 3300028380 | Ga0268265_10084186 | Ga0268265_100841863 | 210 |
| 261 | 3300028381 | Ga0268264_10014318 | Ga0268264_100143187 | 210 |
| 262 | 3300028381 | Ga0268264_10063142 | Ga0268264_100631425 | 210 |
| 263 | 3300028794 | Ga0307515_10069954 | Ga0307515_100699546 | 210 |
| 264 | 3300031548 | Ga0307408_100001956 | Ga0307408_1000019568 | 210 |
| 265 | 3300031548 | Ga0307408_100003404 | Ga0307408_10000340413 | 210 |
| 266 | 3300031548 | Ga0307408_100020319 | Ga0307408_1000203196 | 210 |
| 267 | 3300031548 | Ga0307408_100070399 | Ga0307408_1000703993 | 210 |
| 268 | 3300031548 | Ga0307408_100172390 | Ga0307408_1001723902 | 210 |
| 269 | 3300031731 | Ga0307405_10000033 | Ga0307405_1000003312 | 210 |
| 270 | 3300031731 | Ga0307405_10003174 | Ga0307405_100031745 | 210 |
| 271 | 3300031731 | Ga0307405_10076457 | Ga0307405_100764573 | 210 |
| 272 | 3300031824 | Ga0307413_10332210 | Ga0307413_103322102 | 210 |
| 273 | 3300031901 | Ga0307406_10233033 | Ga0307406_102330332 | 210 |
| 274 | 3300031903 | Ga0307407_10396052 | Ga0307407_103960521 | 210 |
| 275 | 3300031911 | Ga0307412_10000192 | Ga0307412_1000019218 | 210 |
| 276 | 3300031911 | Ga0307412_10000366 | Ga0307412_1000036618 | 210 |
| 277 | 3300031911 | Ga0307412_10034550 | Ga0307412_100345503 | 210 |
| 278 | 3300031911 | Ga0307412_10079894 | Ga0307412_100798944 | 210 |
| 279 | 3300032002 | Ga0307416_100327332 | Ga0307416_1003273322 | 210 |
| 280 | 3300032002 | Ga0307416_100582527 | Ga0307416_1005825272 | 210 |
| 281 | 3300032004 | Ga0307414_10092835 | Ga0307414_100928351 | 210 |
| 282 | 3300032005 | Ga0307411_10002212 | Ga0307411_100022126 | 210 |
| 283 | 3300032005 | Ga0307411_10421939 | Ga0307411_104219392 | 210 |
| 284 | 3300042002 | Ga0439442_028700 | Ga0439442_028700_212_934 | 210 |
| 285 | 3300042006 | Ga0439432_001825 | Ga0439432_001825_6615_7337 | 210 |
| 286 | 3300042006 | Ga0439432_047920 | Ga0439432_047920_51_773 | 210 |
| 287 | 3300042145 | Ga0450906_000091 | Ga0450906_000091_6650_7372 | 210 |
| 288 | 3300046452 | Ga0495617_001818 | Ga0495617_001818_7984_8706 | 210 |
| 289 | 3300046453 | Ga0495627_001641 | Ga0495627_001641_5072_5794 | 210 |
| 290 | 3300046457 | Ga0495590_0000002 | Ga0495590_0000002_176231_176947 | 210 |
| 291 | 3300046457 | Ga0495590_0060048 | Ga0495590_0060048_340_1062 | 210 |
| 292 | 3300046458 | Ga0495591_004660 | Ga0495591_004660_2458_3180 | 210 |
| 293 | 3300046460 | Ga0495638_0000126 | Ga0495638_0000126_21407_22123 | 210 |
| 294 | 3300046460 | Ga0495638_0003311 | Ga0495638_0003311_708_1430 | 210 |
| 295 | 3300046460 | Ga0495638_0037189 | Ga0495638_0037189_2138_2860 | 210 |
| 296 | 3300046471 | Ga0495650_0000291 | Ga0495650_0000291_21691_22407 | 210 |
| 297 | 3300046471 | Ga0495650_0004572 | Ga0495650_0004572_1567_2283 | 210 |
| 298 | 3300046474 | Ga0495605_0000116 | Ga0495605_0000116_10200_10901 | 210 |
| 299 | 3300046474 | Ga0495605_0042178 | Ga0495605_0042178_534_1256 | 210 |
| 300 | 3300046474 | Ga0495605_0068552 | Ga0495605_0068552_122_859 | 210 |
| 301 | 3300046475 | Ga0495639_0003529 | Ga0495639_0003529_3359_4075 | 210 |
| 302 | 3300046491 | Ga0495584_0048457 | Ga0495584_0048457_986_1708 | 210 |
| 303 | 3300046492 | Ga0495585_0006286 | Ga0495585_0006286_655_1377 | 210 |
| 304 | 3300046501 | Ga0495607_0000057 | Ga0495607_0000057_5226_5927 | 210 |
| 305 | 3300046501 | Ga0495607_0055832 | Ga0495607_0055832_173_895 | 210 |
| 306 | 3300046506 | Ga0495583_0000048 | Ga0495583_0000048_102994_103710 | 210 |
| 307 | 3300046506 | Ga0495583_0001854 | Ga0495583_0001854_15771_16493 | 210 |
| 308 | 3300046507 | Ga0495606_0001736 | Ga0495606_0001736_19192_19908 | 210 |
| 309 | 3300046507 | Ga0495606_0162465 | Ga0495606_0162465_497_1219 | 210 |
| 310 | 3300046512 | Ga0495610_0054249 | Ga0495610_0054249_422_1144 | 210 |
| 311 | 3300046512 | Ga0495610_0068750 | Ga0495610_0068750_906_1628 | 210 |
| 312 | 3300046513 | Ga0495616_0001690 | Ga0495616_0001690_9282_10004 | 210 |
| 313 | 3300046513 | Ga0495616_0083376 | Ga0495616_0083376_604_1326 | 210 |
| 314 | 3300046519 | Ga0495632_0011453 | Ga0495632_0011453_2798_3520 | 210 |
| 315 | 3300046519 | Ga0495632_0044748 | Ga0495632_0044748_756_1478 | 210 |
| 316 | 3300046519 | Ga0495632_0234926 | Ga0495632_0234926_79_801 | 210 |
| 317 | 3300046520 | Ga0495637_0000835 | Ga0495637_0000835_3962_4684 | 210 |
| 318 | 3300046520 | Ga0495637_0006203 | Ga0495637_0006203_3225_3947 | 210 |
| 319 | 3300046522 | Ga0495643_0000076 | Ga0495643_0000076_70625_71341 | 210 |
| 320 | 3300046522 | Ga0495643_0000383 | Ga0495643_0000383_18029_18730 | 210 |
| 321 | 3300046523 | Ga0495644_0000994 | Ga0495644_0000994_1866_2588 | 210 |
| 322 | 3300046524 | Ga0495648_0000081 | Ga0495648_0000081_21428_22144 | 210 |
| 323 | 3300046524 | Ga0495648_0008164 | Ga0495648_0008164_6707_7429 | 210 |
| 324 | 3300046524 | Ga0495648_0129394 | Ga0495648_0129394_225_947 | 210 |
| 325 | 3300046528 | Ga0495642_0000336 | Ga0495642_0000336_14180_14905 | 210 |
| 326 | 3300046528 | Ga0495642_0004808 | Ga0495642_0004808_3383_4099 | 210 |
| 327 | 3300046530 | Ga0495654_0000517 | Ga0495654_0000517_29105_29827 | 210 |
| 328 | 3300046530 | Ga0495654_0003493 | Ga0495654_0003493_4538_5260 | 210 |
| 329 | 3300046530 | Ga0495654_0007386 | Ga0495654_0007386_2317_3039 | 210 |
| 330 | 3300046538 | Ga0495609_0000805 | Ga0495609_0000805_9995_10711 | 210 |
| 331 | 3300046542 | Ga0495597_0000005 | Ga0495597_0000005_38319_39056 | 210 |
| 332 | 3300046557 | Ga0495622_0000250 | Ga0495622_0000250_20292_21008 | 210 |
| 333 | 3300046558 | Ga0495633_0000182 | Ga0495633_0000182_21362_22078 | 210 |
| 334 | 3300046558 | Ga0495633_0100349 | Ga0495633_0100349_269_976 | 210 |
| 335 | 3300046615 | Ga0495656_0057167 | Ga0495656_0057167_230_952 | 210 |
| 336 | 3300046615 | Ga0495656_0057738 | Ga0495656_0057738_763_1464 | 210 |
| 337 | 3300046616 | Ga0495668_0000081 | Ga0495668_0000081_63685_64401 | 210 |
| 338 | 3300046616 | Ga0495668_0198896 | Ga0495668_0198896_20_730 | 210 |
| 339 | 3300046660 | Ga0495625_0000075 | Ga0495625_0000075_60006_60722 | 210 |
| 340 | 3300046660 | Ga0495625_0002309 | Ga0495625_0002309_13281_14003 | 210 |
| 341 | 3300046665 | Ga0495661_0000296 | Ga0495661_0000296_17161_17862 | 210 |
| 342 | 3300046665 | Ga0495661_0001556 | Ga0495661_0001556_7733_8458 | 210 |
| 343 | 3300046665 | Ga0495661_0046303 | Ga0495661_0046303_979_1680 | 210 |
| 344 | 3300046665 | Ga0495661_0143402 | Ga0495661_0143402_337_1059 | 210 |
| 345 | 3300046674 | Ga0495588_0000062 | Ga0495588_0000062_106378_107103 | 210 |
| 346 | 3300046691 | Ga0495670_0013252 | Ga0495670_0013252_442_1164 | 210 |
| 347 | 3300046691 | Ga0495670_0182532 | Ga0495670_0182532_138_854 | 210 |
| 348 | 3300046692 | Ga0495671_0011479 | Ga0495671_0011479_2442_3164 | 210 |
| 349 | 3300046694 | Ga0495649_0004303 | Ga0495649_0004303_4861_5583 | 210 |
| 350 | 3300046694 | Ga0495649_0051552 | Ga0495649_0051552_149_850 | 210 |
| 351 | 3300046794 | Ga0495589_0000022 | Ga0495589_0000022_73853_74554 | 210 |
| 352 | 3300046810 | Ga0495660_0000044 | Ga0495660_0000044_42228_42929 | 210 |
| 353 | 3300046810 | Ga0495660_0000885 | Ga0495660_0000885_21037_21774 | 210 |
| 354 | 3300046810 | Ga0495660_0021618 | Ga0495660_0021618_1379_2101 | 210 |
| 355 | 3300046810 | Ga0495660_0170272 | Ga0495660_0170272_189_905 | 210 |
| 356 | 3300047320 | Ga0495672_0005111 | Ga0495672_0005111_1022_1723 | 210 |
| 357 | 3300047320 | Ga0495672_0008750 | Ga0495672_0008750_1701_2423 | 210 |
| 358 | 3300047322 | Ga0495680_0035839 | Ga0495680_0035839_1754_2476 | 210 |
| 359 | 3300047323 | Ga0495683_0006780 | Ga0495683_0006780_2795_3517 | 210 |
| 360 | 3300047443 | Ga0495687_000099 | Ga0495687_000099_32454_33155 | 210 |
| 361 | 3300047443 | Ga0495687_004614 | Ga0495687_004614_5614_6330 | 210 |
| 362 | 3300047443 | Ga0495687_004678 | Ga0495687_004678_5614_6330 | 210 |
| 363 | 3300047445 | Ga0495677_0000180 | Ga0495677_0000180_26076_26777 | 210 |
| 364 | 3300047469 | Ga0495673_0004005 | Ga0495673_0004005_6846_7568 | 210 |
| 365 | 3300047470 | Ga0495681_0000470 | Ga0495681_0000470_13980_14702 | 210 |
| 366 | 3300047470 | Ga0495681_0002740 | Ga0495681_0002740_6628_7350 | 210 |
| 367 | 3300047470 | Ga0495681_0009448 | Ga0495681_0009448_4833_5555 | 210 |
| 368 | 3300048091 | Ga0495626_0000021 | Ga0495626_0000021_139102_139803 | 210 |
| 369 | 3300048091 | Ga0495626_0001492 | Ga0495626_0001492_7842_8567 | 210 |
| 370 | 3300048904 | Ga0496101_0131929 | Ga0496101_0131929_616_1338 | 210 |
| 371 | 3300048905 | Ga0496102_0000141 | Ga0496102_0000141_55983_56705 | 210 |
| 372 | 3300048906 | Ga0496103_0000172 | Ga0496103_0000172_55208_55930 | 210 |
| 373 | 3300048906 | Ga0496103_0000714 | Ga0496103_0000714_17517_18209 | 210 |
| 374 | 3300048906 | Ga0496103_0029085 | Ga0496103_0029085_67_783 | 210 |
| 375 | 3300048907 | Ga0496104_0000114 | Ga0496104_0000114_20587_21309 | 210 |
| 376 | 3300048908 | Ga0496105_0000073 | Ga0496105_0000073_47282_48004 | 210 |
| 377 | 3300048910 | Ga0496107_0189216 | Ga0496107_0189216_72_794 | 210 |
| 378 | 3300048916 | Ga0496113_0001094 | Ga0496113_0001094_5015_5737 | 210 |
| 379 | 3300048920 | Ga0496117_0000296 | Ga0496117_0000296_2768_3490 | 210 |
| 380 | 3300048920 | Ga0496117_0028492 | Ga0496117_0028492_589_1404 | 210 |
| 381 | 3300048921 | Ga0496118_0000897 | Ga0496118_0000897_41965_42696 | 210 |
| 382 | 3300048921 | Ga0496118_0009768 | Ga0496118_0009768_8221_8943 | 210 |
| 383 | 3300048921 | Ga0496118_0017593 | Ga0496118_0017593_3004_3720 | 210 |
| 384 | 3300048922 | Ga0496119_0000040 | Ga0496119_0000040_48620_49342 | 210 |
| 385 | 3300048923 | Ga0496120_0001789 | Ga0496120_0001789_18419_19141 | 210 |
| 386 | 3300048923 | Ga0496120_0066595 | Ga0496120_0066595_602_1318 | 210 |
| 387 | 3300048924 | Ga0496121_0001289 | Ga0496121_0001289_36204_36926 | 210 |
| 388 | 3300048924 | Ga0496121_0021553 | Ga0496121_0021553_1457_2173 | 210 |
| 389 | 3300048925 | Ga0496122_0000456 | Ga0496122_0000456_55209_55931 | 210 |
| 390 | 3300048926 | Ga0496123_0000847 | Ga0496123_0000847_28797_29519 | 210 |
| 391 | 3300048927 | Ga0496124_0001770 | Ga0496124_0001770_6279_7001 | 210 |
| 392 | 3300048927 | Ga0496124_0091700 | Ga0496124_0091700_46_762 | 210 |
| 393 | 3300048927 | Ga0496124_0173736 | Ga0496124_0173736_431_1147 | 210 |
| 394 | 3300048928 | Ga0496125_0000603 | Ga0496125_0000603_41116_41838 | 210 |
| 395 | 3300048928 | Ga0496125_0004486 | Ga0496125_0004486_13953_14669 | 210 |
| 396 | 3300048929 | Ga0496126_0000044 | Ga0496126_0000044_278934_279656 | 210 |
| 397 | 3300048929 | Ga0496126_0027600 | Ga0496126_0027600_314_1030 | 210 |
| 398 | 3300049459 | Ga0495678_000615 | Ga0495678_000615_17849_18565 | 210 |
| 399 | 3300049459 | Ga0495678_001847 | Ga0495678_001847_682_1404 | 210 |
| 400 | 3300049530 | Ga0501314_000711 | Ga0501314_000711_957_1679 | 210 |
| 401 | 3300049530 | Ga0501314_001936 | Ga0501314_001936_479_1201 | 210 |
| 402 | 3300049553 | Ga0501337_001475 | Ga0501337_001475_153_875 | 210 |
| 403 | 3300049662 | Ga0501222_000088 | Ga0501222_000088_316_1038 | 210 |
| 404 | 3300049665 | Ga0501227_000017 | Ga0501227_000017_10434_11156 | 210 |
| 405 | 3300049669 | Ga0501235_004663 | Ga0501235_004663_2123_2845 | 210 |
| 406 | 3300049673 | Ga0501240_022192 | Ga0501240_022192_113_835 | 210 |
| 407 | 3300049758 | Ga0501241_017251 | Ga0501241_017251_440_1162 | 210 |
| 408 | 3300049766 | Ga0501269_000062 | Ga0501269_000062_21558_22280 | 210 |
| 409 | 3300049853 | Ga0501226_000009 | Ga0501226_000009_160948_161670 | 210 |
| 410 | 3300049853 | Ga0501226_001644 | Ga0501226_001644_1198_1920 | 210 |
| 411 | 3300053091 | Ga0500647_0023348 | Ga0500647_0023348_412_1122 | 210 |
| 412 | 3300053093 | Ga0500651_0176328 | Ga0500651_0176328_150_857 | 210 |
| 413 | 3300053096 | Ga0500641_0109166 | Ga0500641_0109166_138_845 | 210 |
| 414 | 3300053123 | Ga0500614_014410 | Ga0500614_014410_510_1220 | 210 |
| 415 | 3300053130 | Ga0500642_0076847 | Ga0500642_0076847_83_793 | 210 |
| 416 | 3300053133 | Ga0500655_000020 | Ga0500655_000020_41165_41872 | 210 |
| 417 | 3300053134 | Ga0500658_0097414 | Ga0500658_0097414_325_1047 | 210 |
| 418 | 3300053148 | Ga0500590_000179 | Ga0500590_000179_11750_12457 | 210 |
| 419 | 3300053156 | Ga0500622_0067288 | Ga0500622_0067288_1072_1779 | 210 |
| 420 | 3300053163 | Ga0500639_021723 | Ga0500639_021723_91_801 | 210 |
| 421 | 3300053177 | Ga0500636_0037424 | Ga0500636_0037424_498_1205 | 210 |
| 422 | iso_pu_bacteria | 2582581305 | 2585263095 | 210 |
| 423 | iso_pu_bacteria | 2643221650 | 2644280945 | 210 |
| 424 | iso_pu_bacteria | 2826581358 | 2826586318 | 210 |
| 425 | iso_pu_bacteria | 2842849001 | 2842852725 | 210 |
| 426 | iso_pu_bacteria | 2929144301 | 2929146727 | 210 |
| 427 | iso_pu_bacteria | 3007855910 | 3007860410 | 210 |
| 428 | iso_pu_bacteria | 3007866637 | 3007868693 | 210 |
| 429 | iso_pu_bacteria | 651053060 | 651177918 | 210 |
| 430 | iso_pu_bacteria | 8047673197 | 8047674194 | 210 |
| 431 | iso_pu_bacteria | 8054285046 | 8054289942 | 210 |
| 432 | iso_pu_bacteria | 8056125926 | 8056128869 | 210 |
| 433 | iso_pu_bacteria | 8056177738 | 8056182385 | 210 |
| 434 | 3300003771 | Ga0055526_1000140 | Ga0055526_100014012 | 211 |
| 435 | 3300003773 | Ga0055537_1000113 | Ga0055537_100011361 | 211 |
| 436 | 3300003775 | Ga0055524_1017491 | Ga0055524_10174912 | 211 |
| 437 | 3300003784 | Ga0055534_1000023 | Ga0055534_100002352 | 211 |
| 438 | 3300003790 | Ga0055528_1000030 | Ga0055528_100003052 | 211 |
| 439 | 3300025263 | Ga0209565_1000003 | Ga0209565_1000003162 | 211 |
| 440 | 3300025273 | Ga0209673_1000003 | Ga0209673_100000348 | 211 |
| 441 | 3300025291 | Ga0209675_1000003 | Ga0209675_1000003876 | 211 |
| 442 | 3300025295 | Ga0209564_1000012 | Ga0209564_1000012685 | 211 |
| 443 | 3300025299 | Ga0209256_1000235 | Ga0209256_100023540 | 211 |
| 444 | 3300031824 | Ga0307413_10049451 | Ga0307413_100494512 | 211 |
| 445 | 3300032004 | Ga0307414_10000217 | Ga0307414_1000021721 | 211 |
| 446 | 3300032004 | Ga0307414_10121468 | Ga0307414_101214682 | 211 |
| 447 | 3300032004 | Ga0307414_10338577 | Ga0307414_103385772 | 211 |
| 448 | 3300032004 | Ga0307414_10537396 | Ga0307414_105373962 | 211 |
| 449 | 3300037312 | Ga0395899_0176686 | Ga0395899_0176686_306_1028 | 211 |
| 450 | 3300037418 | Ga0395900_0027038 | Ga0395900_0027038_717_1439 | 211 |
| 451 | 3300037471 | Ga0395905_0001243 | Ga0395905_0001243_4712_5434 | 211 |
| 452 | 3300038443 | Ga0395901_0074514 | Ga0395901_0074514_2283_3005 | 211 |
| 453 | 3300046463 | Ga0495653_0006369 | Ga0495653_0006369_5873_6598 | 211 |
| 454 | 3300046474 | Ga0495605_0001567 | Ga0495605_0001567_7014_7727 | 211 |
| 455 | 3300046474 | Ga0495605_0027386 | Ga0495605_0027386_32_733 | 211 |
| 456 | 3300046500 | Ga0495596_0000139 | Ga0495596_0000139_14005_14706 | 211 |
| 457 | 3300046501 | Ga0495607_0001449 | Ga0495607_0001449_15363_16076 | 211 |
| 458 | 3300046513 | Ga0495616_0015263 | Ga0495616_0015263_361_1074 | 211 |
| 459 | 3300046522 | Ga0495643_0000563 | Ga0495643_0000563_14413_15114 | 211 |
| 460 | 3300046522 | Ga0495643_0160231 | Ga0495643_0160231_99_812 | 211 |
| 461 | 3300046536 | Ga0495587_0031499 | Ga0495587_0031499_1068_1793 | 211 |
| 462 | 3300046538 | Ga0495609_0000009 | Ga0495609_0000009_115152_115865 | 211 |
| 463 | 3300046538 | Ga0495609_0001357 | Ga0495609_0001357_10029_10730 | 211 |
| 464 | 3300046615 | Ga0495656_0005296 | Ga0495656_0005296_1827_2540 | 211 |
| 465 | 3300046660 | Ga0495625_0135114 | Ga0495625_0135114_769_1470 | 211 |
| 466 | 3300046665 | Ga0495661_0000032 | Ga0495661_0000032_38531_39244 | 211 |
| 467 | 3300046665 | Ga0495661_0002595 | Ga0495661_0002595_5762_6463 | 211 |
| 468 | 3300046665 | Ga0495661_0005929 | Ga0495661_0005929_526_1227 | 211 |
| 469 | 3300046665 | Ga0495661_0119979 | Ga0495661_0119979_113_826 | 211 |
| 470 | 3300046680 | Ga0495646_0193574 | Ga0495646_0193574_68_778 | 211 |
| 471 | 3300046684 | Ga0495669_0003442 | Ga0495669_0003442_4852_5553 | 211 |
| 472 | 3300046691 | Ga0495670_0008160 | Ga0495670_0008160_1420_2133 | 211 |
| 473 | 3300046794 | Ga0495589_0000262 | Ga0495589_0000262_3768_4481 | 211 |
| 474 | 3300047320 | Ga0495672_0054831 | Ga0495672_0054831_346_1047 | 211 |
| 475 | 3300047443 | Ga0495687_000024 | Ga0495687_000024_202203_202916 | 211 |
| 476 | 3300047443 | Ga0495687_000030 | Ga0495687_000030_187742_188443 | 211 |
| 477 | 3300047445 | Ga0495677_0000018 | Ga0495677_0000018_38585_39298 | 211 |
| 478 | 3300047445 | Ga0495677_0018519 | Ga0495677_0018519_1657_2358 | 211 |
| 479 | 3300047445 | Ga0495677_0046428 | Ga0495677_0046428_127_840 | 211 |
| 480 | 3300047472 | Ga0495686_0138949 | Ga0495686_0138949_305_1027 | 211 |
| 481 | 3300048091 | Ga0495626_0001909 | Ga0495626_0001909_13208_13909 | 211 |
| 482 | 3300048091 | Ga0495626_0034766 | Ga0495626_0034766_1220_1921 | 211 |
| 483 | 3300050493 | nmdc:mga0k408_142875_c1 | nmdc:mga0k408_142875_c1_498_1211 | 211 |
| 484 | 3300053118 | Ga0500594_0095383 | Ga0500594_0095383_24_746 | 211 |
| 485 | 3300053139 | Ga0500568_0005368 | Ga0500568_0005368_1101_1823 | 211 |
| 486 | 3300053148 | Ga0500590_018523 | Ga0500590_018523_1531_2259 | 211 |
| 487 | iso_pu_bacteria | 2894232714 | 2894240060 | 211 |
| 488 | 3300005616 | Ga0068852_100005603 | Ga0068852_10000560312 | 212 |
| 489 | 3300006048 | Ga0075363_100078589 | Ga0075363_1000785892 | 212 |
| 490 | 3300025304 | Ga0209257_1000190 | Ga0209257_1000190152 | 212 |
| 491 | 3300025304 | Ga0209257_1000467 | Ga0209257_100046743 | 212 |
| 492 | 3300026142 | Ga0207698_10002253 | Ga0207698_1000225310 | 212 |
| 493 | 3300027665 | Ga0209983_1024293 | Ga0209983_10242932 | 212 |
| 494 | 3300027876 | Ga0209974_10017268 | Ga0209974_100172684 | 212 |
| 495 | 3300031995 | Ga0307409_100828299 | Ga0307409_1008282991 | 212 |
| 496 | 3300046460 | Ga0495638_0020048 | Ga0495638_0020048_2606_3298 | 212 |
| 497 | 3300046491 | Ga0495584_0039067 | Ga0495584_0039067_822_1514 | 212 |
| 498 | 3300046501 | Ga0495607_0001363 | Ga0495607_0001363_17139_17831 | 212 |
| 499 | 3300046506 | Ga0495583_0016551 | Ga0495583_0016551_2728_3420 | 212 |
| 500 | 3300046513 | Ga0495616_0008872 | Ga0495616_0008872_956_1648 | 212 |
| 501 | 3300046525 | Ga0495663_0031944 | Ga0495663_0031944_225_917 | 212 |
| 502 | 3300046538 | Ga0495609_0000481 | Ga0495609_0000481_12164_12856 | 212 |
| 503 | 3300046616 | Ga0495668_0054982 | Ga0495668_0054982_826_1518 | 212 |
| 504 | 3300046660 | Ga0495625_0019647 | Ga0495625_0019647_1830_2522 | 212 |
| 505 | 3300046664 | Ga0495659_0091845 | Ga0495659_0091845_414_1106 | 212 |
| 506 | 3300046665 | Ga0495661_0106028 | Ga0495661_0106028_439_1131 | 212 |
| 507 | 3300046684 | Ga0495669_0009489 | Ga0495669_0009489_2430_3122 | 212 |
| 508 | 3300046694 | Ga0495649_0046939 | Ga0495649_0046939_1577_2269 | 212 |
| 509 | 3300046810 | Ga0495660_0103970 | Ga0495660_0103970_694_1386 | 212 |
| 510 | 3300047318 | Ga0495636_0049374 | Ga0495636_0049374_897_1589 | 212 |
| 511 | 3300047443 | Ga0495687_020999 | Ga0495687_020999_505_1197 | 212 |
| 512 | 3300047445 | Ga0495677_0002528 | Ga0495677_0002528_6023_6715 | 212 |
| 513 | 3300047446 | Ga0495679_010064 | Ga0495679_010064_1169_1861 | 212 |
| 514 | 3300047447 | Ga0495685_009501 | Ga0495685_009501_421_1113 | 212 |
| 515 | 3300047469 | Ga0495673_0046905 | Ga0495673_0046905_234_965 | 212 |
| 516 | 3300050489 | nmdc:mga03683_143629_c1 | nmdc:mga03683_143629_c1_301_1020 | 212 |
| 517 | iso_pu_bacteria | 2738541280 | 2738737668 | 212 |
| 518 | iso_pu_bacteria | 2738543018 | 2739272732 | 212 |
| 519 | iso_pu_bacteria | 2738543030 | 2739341776 | 212 |
| 520 | iso_pu_bacteria | 2818991450 | 2819622449 | 212 |
| 521 | iso_pu_bacteria | 2835312727 | 2835319642 | 212 |
| 522 | iso_pu_bacteria | 2928108538 | 2928111874 | 212 |
| 523 | iso_pu_bacteria | 2928135762 | 2928139113 | 212 |
| 524 | iso_pu_bacteria | 2928503688 | 2928508811 | 212 |
| 525 | 3300015261 | Ga0182006_1029609 | Ga0182006_10296092 | 213 |
| 526 | 3300015262 | Ga0182007_10001540 | Ga0182007_100015407 | 213 |
| 527 | 3300015265 | Ga0182005_1000653 | Ga0182005_10006536 | 213 |
| 528 | 3300025913 | Ga0207695_10014078 | Ga0207695_100140789 | 213 |
| 529 | 3300025986 | Ga0207658_10633928 | Ga0207658_106339282 | 213 |
| 530 | 3300028794 | Ga0307515_10000101 | Ga0307515_1000010160 | 213 |
| 531 | 3300046454 | Ga0495592_0030598 | Ga0495592_0030598_238_981 | 213 |
| 532 | 3300046462 | Ga0495651_0030812 | Ga0495651_0030812_75_935 | 213 |
| 533 | 3300046462 | Ga0495651_0113652 | Ga0495651_0113652_897_1640 | 213 |
| 534 | 3300046463 | Ga0495653_0004514 | Ga0495653_0004514_5606_6349 | 213 |
| 535 | 3300046511 | Ga0495608_0040901 | Ga0495608_0040901_505_1248 | 213 |
| 536 | 3300046516 | Ga0495628_0000797 | Ga0495628_0000797_13510_14253 | 213 |
| 537 | 3300046522 | Ga0495643_0009593 | Ga0495643_0009593_5269_5976 | 213 |
| 538 | 3300046529 | Ga0495652_0003865 | Ga0495652_0003865_13403_14146 | 213 |
| 539 | 3300046529 | Ga0495652_0252026 | Ga0495652_0252026_512_1255 | 213 |
| 540 | 3300046543 | Ga0495645_0109995 | Ga0495645_0109995_905_1648 | 213 |
| 541 | 3300046557 | Ga0495622_0138764 | Ga0495622_0138764_148_891 | 213 |
| 542 | 3300046675 | Ga0495657_0106721 | Ga0495657_0106721_288_1031 | 213 |
| 543 | 3300046678 | Ga0495599_0118850 | Ga0495599_0118850_651_1394 | 213 |
| 544 | 3300046679 | Ga0495623_0006238 | Ga0495623_0006238_1782_2525 | 213 |
| 545 | 3300046680 | Ga0495646_0012579 | Ga0495646_0012579_4478_5221 | 213 |
| 546 | 3300046690 | Ga0495624_0065500 | Ga0495624_0065500_1168_1911 | 213 |
| 547 | 3300046809 | Ga0495600_0015479 | Ga0495600_0015479_3404_4147 | 213 |
| 548 | 3300048088 | Ga0495602_0009630 | Ga0495602_0009630_389_1249 | 213 |
| 549 | 3300048088 | Ga0495602_0033932 | Ga0495602_0033932_3404_4147 | 213 |
| 550 | 3300053077 | Ga0495601_0014913 | Ga0495601_0014913_1923_2666 | 213 |
| 551 | 3300053119 | Ga0500595_000649 | Ga0500595_000649_7293_8036 | 213 |
| 552 | 3300053154 | Ga0500619_000597 | Ga0500619_000597_5227_5970 | 213 |
| 553 | iso_pu_bacteria | 2818991436 | 2819542652 | 213 |
| 554 | 2162886007 | SwRhRL2b_contig_2810169 | SwRhRL2b_0512.00002360 | 214 |
| 555 | 3300005289 | Ga0065704_10000743 | Ga0065704_100007432 | 214 |
| 556 | 3300005331 | Ga0070670_100056444 | Ga0070670_1000564442 | 214 |
| 557 | 3300005335 | Ga0070666_10009275 | Ga0070666_100092754 | 214 |
| 558 | 3300005344 | Ga0070661_100057859 | Ga0070661_1000578592 | 214 |
| 559 | 3300005367 | Ga0070667_100289517 | Ga0070667_1002895172 | 214 |
| 560 | 3300005457 | Ga0070662_100024086 | Ga0070662_1000240865 | 214 |
| 561 | 3300005539 | Ga0068853_100047780 | Ga0068853_1000477803 | 214 |
| 562 | 3300005548 | Ga0070665_100000227 | Ga0070665_10000022773 | 214 |
| 563 | 3300005548 | Ga0070665_100211516 | Ga0070665_1002115162 | 214 |
| 564 | 3300005563 | Ga0068855_100245956 | Ga0068855_1002459562 | 214 |
| 565 | 3300005564 | Ga0070664_100280141 | Ga0070664_1002801413 | 214 |
| 566 | 3300005577 | Ga0068857_100176604 | Ga0068857_1001766043 | 214 |
| 567 | 3300005578 | Ga0068854_100007020 | Ga0068854_1000070204 | 214 |
| 568 | 3300005616 | Ga0068852_100340086 | Ga0068852_1003400862 | 214 |
| 569 | 3300005834 | Ga0068851_10006290 | Ga0068851_100062906 | 214 |
| 570 | 3300005842 | Ga0068858_100000386 | Ga0068858_10000038639 | 214 |
| 571 | 3300005843 | Ga0068860_100000719 | Ga0068860_10000071913 | 214 |
| 572 | 3300005844 | Ga0068862_100000044 | Ga0068862_100000044134 | 214 |
| 573 | 3300009101 | Ga0105247_10001669 | Ga0105247_100016696 | 214 |
| 574 | 3300009553 | Ga0105249_10000045 | Ga0105249_1000004558 | 214 |
| 575 | 3300014326 | Ga0157380_10014944 | Ga0157380_100149444 | 214 |
| 576 | 3300025321 | Ga0207656_10008505 | Ga0207656_100085054 | 214 |
| 577 | 3300025728 | Ga0207655_1013477 | Ga0207655_10134771 | 214 |
| 578 | 3300025900 | Ga0207710_10001776 | Ga0207710_100017766 | 214 |
| 579 | 3300025903 | Ga0207680_10001300 | Ga0207680_100013009 | 214 |
| 580 | 3300025904 | Ga0207647_10000500 | Ga0207647_1000050015 | 214 |
| 581 | 3300025911 | Ga0207654_10108026 | Ga0207654_101080262 | 214 |
| 582 | 3300025913 | Ga0207695_10079689 | Ga0207695_100796894 | 214 |
| 583 | 3300025914 | Ga0207671_10077048 | Ga0207671_100770483 | 214 |
| 584 | 3300025924 | Ga0207694_10003986 | Ga0207694_100039867 | 214 |
| 585 | 3300025925 | Ga0207650_10095707 | Ga0207650_100957072 | 214 |
| 586 | 3300025933 | Ga0207706_10004925 | Ga0207706_100049255 | 214 |
| 587 | 3300025934 | Ga0207686_10394569 | Ga0207686_103945692 | 214 |
| 588 | 3300025949 | Ga0207667_10137182 | Ga0207667_101371823 | 214 |
| 589 | 3300025961 | Ga0207712_10000169 | Ga0207712_100001698 | 214 |
| 590 | 3300025961 | Ga0207712_10000174 | Ga0207712_1000017458 | 214 |
| 591 | 3300025981 | Ga0207640_10001595 | Ga0207640_1000159510 | 214 |
| 592 | 3300025986 | Ga0207658_10053665 | Ga0207658_100536653 | 214 |
| 593 | 3300026023 | Ga0207677_10081942 | Ga0207677_100819423 | 214 |
| 594 | 3300026035 | Ga0207703_10001066 | Ga0207703_1000106610 | 214 |
| 595 | 3300026041 | Ga0207639_10001687 | Ga0207639_100016878 | 214 |
| 596 | 3300026067 | Ga0207678_10009490 | Ga0207678_100094908 | 214 |
| 597 | 3300026078 | Ga0207702_10261965 | Ga0207702_102619652 | 214 |
| 598 | 3300026088 | Ga0207641_10005043 | Ga0207641_100050436 | 214 |
| 599 | 3300026142 | Ga0207698_10463224 | Ga0207698_104632242 | 214 |
| 600 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006629 | 214 |
| 601 | 3300028380 | Ga0268265_10000045 | Ga0268265_1000004552 | 214 |
| 602 | 3300028381 | Ga0268264_10000524 | Ga0268264_100005249 | 214 |
| 603 | 3300028794 | Ga0307515_10038042 | Ga0307515_100380425 | 214 |
| 604 | 3300031548 | Ga0307408_100051401 | Ga0307408_1000514014 | 214 |
| 605 | 3300031616 | Ga0307508_10002424 | Ga0307508_1000242417 | 214 |
| 606 | 3300031730 | Ga0307516_10000002 | Ga0307516_10000002400 | 214 |
| 607 | 3300031901 | Ga0307406_10049685 | Ga0307406_100496853 | 214 |
| 608 | 3300031911 | Ga0307412_10002880 | Ga0307412_100028803 | 214 |
| 609 | 3300032002 | Ga0307416_100098602 | Ga0307416_1000986024 | 214 |
| 610 | 3300032126 | Ga0307415_100429595 | Ga0307415_1004295952 | 214 |
| 611 | 3300046457 | Ga0495590_0020628 | Ga0495590_0020628_331_1068 | 214 |
| 612 | 3300046518 | Ga0495631_0045134 | Ga0495631_0045134_556_1281 | 214 |
| 613 | 3300046519 | Ga0495632_0002572 | Ga0495632_0002572_7034_7771 | 214 |
| 614 | 3300046694 | Ga0495649_0007543 | Ga0495649_0007543_98_835 | 214 |
| 615 | 3300046810 | Ga0495660_0099572 | Ga0495660_0099572_370_1107 | 214 |
| 616 | 3300047443 | Ga0495687_003585 | Ga0495687_003585_8717_9454 | 214 |
| 617 | 3300048911 | Ga0496108_0002349 | Ga0496108_0002349_4223_4951 | 214 |
| 618 | 3300048913 | Ga0496110_0178143 | Ga0496110_0178143_241_933 | 214 |
| 619 | 3300048914 | Ga0496111_0108992 | Ga0496111_0108992_73_765 | 214 |
| 620 | 3300048919 | Ga0496116_0027993 | Ga0496116_0027993_1874_2566 | 214 |
| 621 | 3300048924 | Ga0496121_0000349 | Ga0496121_0000349_30162_30854 | 214 |
| 622 | 3300048927 | Ga0496124_0094798 | Ga0496124_0094798_54_746 | 214 |
| 623 | 3300048928 | Ga0496125_0027411 | Ga0496125_0027411_1446_2138 | 214 |
| 624 | 3300048929 | Ga0496126_0051608 | Ga0496126_0051608_2169_2861 | 214 |
| 625 | 3300049459 | Ga0495678_031817 | Ga0495678_031817_90_827 | 214 |
| 626 | 3300049571 | Ga0501034_0034001 | Ga0501034_0034001_4429_5151 | 214 |
| 627 | 3300049649 | Ga0501198_006436 | Ga0501198_006436_828_1550 | 214 |
| 628 | 3300049663 | Ga0501223_000023 | Ga0501223_000023_51796_52518 | 214 |
| 629 | 3300049664 | Ga0501224_000001 | Ga0501224_000001_134241_134963 | 214 |
| 630 | 3300049669 | Ga0501235_012178 | Ga0501235_012178_32_754 | 214 |
| 631 | 3300049705 | Ga0501225_0000012 | Ga0501225_0000012_27664_28386 | 214 |
| 632 | 3300049707 | Ga0501234_002530 | Ga0501234_002530_301_1023 | 214 |
| 633 | 3300049853 | Ga0501226_000133 | Ga0501226_000133_13488_14210 | 214 |
| 634 | 3300050509 | nmdc:mga0qj67_90370_c1 | nmdc:mga0qj67_90370_c1_646_1371 | 214 |
| 635 | 3300053086 | Ga0500578_0170688 | Ga0500578_0170688_277_1014 | 214 |
| 636 | 3300053103 | Ga0500555_001005 | Ga0500555_001005_2889_3614 | 214 |
| 637 | 3300053104 | Ga0500556_0036718 | Ga0500556_0036718_771_1496 | 214 |
| 638 | 3300053139 | Ga0500568_0011431 | Ga0500568_0011431_2730_3491 | 214 |
| 639 | iso_pu_bacteria | 2808606404 | 2809081494 | 214 |
| 640 | iso_pu_bacteria | 2808606405 | 2809085849 | 214 |
| 641 | iso_pu_bacteria | 2880518877 | 2880522652 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wn1-assembly1.cif.gz_A | structure of pfnt1(y190a) in complex with nanobody 48 and inosine | 0.4308 | 26 | 189 |
| 1pw4-assembly1.cif.gz_A | crystal structure of the glycerol-3-phosphate transporter from e.coli | 0.3761 | 26 | 210 |
| 1pw4-assembly1.cif.gz_A | crystal structure of the glycerol-3-phosphate transporter from e.coli | 0.3412 | 26 | 210 |
| 7wn1-assembly1.cif.gz_A | structure of pfnt1(y190a) in complex with nanobody 48 and inosine | 0.3234 | 26 | 189 |
| 8t6b-assembly1.cif.gz_A | human vmat2 in complex with serotonin | 0.3193 | 45 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HVP9_281_498_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4725 | 31 | 190 | 1.20.1250.20 |
| af_Q4CZV9_1_129_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4725 | 73 | 191 | 1.20.1250.20 |
| af_H2KZQ1_21_234_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4717 | 45 | 185 | 1.20.1250.20 |
| af_P47040_222_404_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4694 | 68 | 199 | 1.20.1250.20 |
| af_Q8IBB7_261_466_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4635 | 45 | 185 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A380SYY3-F1-model_v4 | Plasmid pTOM9 ORF1-like protein | 0.9271 | 24 | 164 |
GO:0016020
|
| AF-A0A3D1IK34-F1-model_v4 | HupE/UreJ family protein | 0.9241 | 55 | 149 |
GO:0016020
|
| AF-A0A6B1GTY5-F1-model_v4 | HupE/UreJ family protein | 0.9154 | 47 | 153 |
GO:0016020
|
| AF-A0A2E8A8S5-F1-model_v4 | HupE/UreJ family protein | 0.9024 | 23 | 169 |
GO:0016020
|
| AF-A0A3D1IK34-F1-model_v4 | HupE/UreJ family protein | 0.8975 | 55 | 149 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar