F471705

General Info

Members Datasets Scaffolds Average Seq Length
640 312 1280 118

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0682958|Ga0316574_0682958_36_455
Length 139
Sequence MIRVVCIEPAFYPRGPYNPAQVMDSILIRELRVEVLIGIHKRERHVPQIVSIDLDIGIPGTAVFASDKVADTIDYEQVALRIRDIASSGHFRLVETFAERIAQLIVGDFGAPWVRVSAAKIGILGNARFVGVSIERRKA

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
198 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
201 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
202 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
203 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
204 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
286 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
287 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
288 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
289 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.16
Rhizosphere 99.06
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0682958 3300035398 Bacteria 630
2 rootH1_10103351 3300003323 Bacteria 1190
3 Ga0065704_10478448 3300005289 Bacteria 683
4 Ga0065707_10056190 3300005295 Bacteria 643
5 Ga0065707_10297899 3300005295 Bacteria 1010
6 Ga0065707_10551470 3300005295 Bacteria 711
7 Ga0065707_10920070 3300005295 Bacteria 561
8 Ga0070676_10118151 3300005328 Bacteria 1660
9 Ga0070676_11182838 3300005328 Bacteria 580
10 Ga0070683_100028749 3300005329 Bacteria 5027
11 Ga0070683_100161378 3300005329 Bacteria 2127
12 Ga0070690_100013534 3300005330 Bacteria 4823
13 Ga0070690_100297286 3300005330 Bacteria 1157
14 Ga0070690_100879268 3300005330 Bacteria 700
15 Ga0068869_100021879 3300005334 Bacteria 4401
16 Ga0070680_100172298 3300005336 Bacteria 1821
17 Ga0070680_100350211 3300005336 Bacteria 1256
18 Ga0070680_100783124 3300005336 Bacteria 821
19 Ga0070680_100862458 3300005336 Bacteria 781
20 Ga0068868_100691333 3300005338 Bacteria 912
21 Ga0070689_100138030 3300005340 Bacteria 1959
22 Ga0070691_10070481 3300005341 Bacteria 1696
23 Ga0070691_10151068 3300005341 Bacteria 1191
24 Ga0070687_100324120 3300005343 Bacteria 985
25 Ga0070687_100340162 3300005343 Bacteria 965
26 Ga0070687_100425795 3300005343 Bacteria 877
27 Ga0070687_101055564 3300005343 Bacteria 592
28 Ga0070692_10019466 3300005345 Bacteria 3275
29 Ga0070692_10030016 3300005345 Bacteria 2715
30 Ga0070692_10114208 3300005345 Bacteria 1497
31 Ga0070692_10215525 3300005345 Bacteria 1132
32 Ga0070692_10329574 3300005345 Bacteria 942
33 Ga0070668_100266591 3300005347 Bacteria 1426
34 Ga0070669_100038713 3300005353 Bacteria 3462
35 Ga0070675_100018880 3300005354 Bacteria 5490
36 Ga0070671_100111857 3300005355 Bacteria 2294
37 Ga0070674_100794742 3300005356 Bacteria 816
38 Ga0070673_100276443 3300005364 Bacteria 1471
39 Ga0070673_100440853 3300005364 Bacteria 1170
40 Ga0070673_101281014 3300005364 Bacteria 688
41 Ga0070688_100267124 3300005365 Bacteria 1224
42 Ga0070688_100473318 3300005365 Bacteria 940
43 Ga0070703_10290372 3300005406 Bacteria 678
44 Ga0070709_10845521 3300005434 Bacteria 721
45 Ga0070709_11196074 3300005434 Bacteria 611
46 Ga0070714_100977272 3300005435 Bacteria 823
47 Ga0070713_101850126 3300005436 Bacteria 586
48 Ga0070710_10157361 3300005437 Bacteria 1406
49 Ga0070710_10475983 3300005437 Bacteria 851
50 Ga0070701_10847767 3300005438 Bacteria 627
51 Ga0070705_100014665 3300005440 Bacteria 4037
52 Ga0070705_100062555 3300005440 Bacteria 2217
53 Ga0070705_100117546 3300005440 Bacteria 1711
54 Ga0070705_100993611 3300005440 Bacteria 681
55 Ga0070705_101285892 3300005440 Bacteria 606
56 Ga0070700_100008805 3300005441 Bacteria 5512
57 Ga0070700_100359575 3300005441 Bacteria 1082
58 Ga0070700_100623832 3300005441 Bacteria 848
59 Ga0070694_100011182 3300005444 Bacteria 5559
60 Ga0070694_100084175 3300005444 Bacteria 2218
61 Ga0070694_100205570 3300005444 Bacteria 1470
62 Ga0070694_100221573 3300005444 Bacteria 1419
63 Ga0070694_100370316 3300005444 Bacteria 1115
64 Ga0070694_100440846 3300005444 Bacteria 1026
65 Ga0070694_100915448 3300005444 Bacteria 724
66 Ga0070694_101173189 3300005444 Bacteria 643
67 Ga0070678_100527077 3300005456 Bacteria 1046
68 Ga0070681_10000270 3300005458 Bacteria 41405
69 Ga0070681_10353421 3300005458 Bacteria 1380
70 Ga0068867_100013837 3300005459 Bacteria 5711
71 Ga0068867_100142868 3300005459 Bacteria 1872
72 Ga0068867_100340168 3300005459 Bacteria 1249
73 Ga0068867_101156446 3300005459 Bacteria 709
74 Ga0070685_10465021 3300005466 Bacteria 889
75 Ga0070706_100569861 3300005467 Bacteria 1053
76 Ga0070706_100660783 3300005467 Bacteria 970
77 Ga0070707_100329718 3300005468 Bacteria 1483
78 Ga0070707_100686410 3300005468 Bacteria 987
79 Ga0070707_101728718 3300005468 Bacteria 593
80 Ga0070698_100254665 3300005471 Bacteria 1688
81 Ga0070698_100382841 3300005471 Bacteria 1339
82 Ga0070699_100005151 3300005518 Bacteria 11496
83 Ga0070699_100097462 3300005518 Bacteria 2576
84 Ga0070699_100129600 3300005518 Bacteria 2223
85 Ga0070699_101431816 3300005518 Unclassified 634
86 Ga0070679_100021353 3300005530 Bacteria 6319
87 Ga0070679_101919570 3300005530 Bacteria 541
88 Ga0070684_100077123 3300005535 Bacteria 2943
89 Ga0070697_100012581 3300005536 Bacteria 6628
90 Ga0070697_100019988 3300005536 Bacteria 5292
91 Ga0070672_101952125 3300005543 Bacteria 528
92 Ga0070686_100056754 3300005544 Bacteria 2512
93 Ga0070686_100111996 3300005544 Bacteria 1861
94 Ga0070686_100402271 3300005544 Bacteria 1042
95 Ga0070695_100000897 3300005545 Bacteria 16062
96 Ga0070695_100062960 3300005545 Bacteria 2410
97 Ga0070695_100391725 3300005545 Bacteria 1051
98 Ga0070695_100672030 3300005545 Bacteria 820
99 Ga0070695_100724733 3300005545 Bacteria 791
100 Ga0070696_100062200 3300005546 Bacteria 2613
101 Ga0070696_100146513 3300005546 Bacteria 1730
102 Ga0070696_100148289 3300005546 Bacteria 1720
103 Ga0070696_100580920 3300005546 Bacteria 901
104 Ga0070696_100633884 3300005546 Bacteria 865
105 Ga0070696_101303607 3300005546 Bacteria 616
106 Ga0070693_100205333 3300005547 Bacteria 1282
107 Ga0070693_100240829 3300005547 Bacteria 1195
108 Ga0070693_100634382 3300005547 Bacteria 775
109 Ga0070704_100010603 3300005549 Bacteria 5611
110 Ga0070704_100024777 3300005549 Bacteria 3941
111 Ga0070704_100144404 3300005549 Bacteria 1863
112 Ga0070704_100215827 3300005549 Bacteria 1557
113 Ga0070704_100264336 3300005549 Bacteria 1419
114 Ga0070704_100537419 3300005549 Bacteria 1020
115 Ga0070704_101516460 3300005549 Bacteria 617
116 Ga0070704_101731662 3300005549 Bacteria 578
117 Ga0070702_101236549 3300005615 Bacteria 604
118 Ga0068859_100199553 3300005617 Bacteria 2085
119 Ga0068859_100786265 3300005617 Bacteria 1040
120 Ga0068859_101506083 3300005617 Bacteria 743
121 Ga0068864_100300921 3300005618 Bacteria 1502
122 Ga0068866_10026293 3300005718 Bacteria 2746
123 Ga0068861_100012489 3300005719 Bacteria 5927
124 Ga0068861_100545750 3300005719 Bacteria 1055
125 Ga0068861_101766041 3300005719 Bacteria 613
126 Ga0068870_10037587 3300005840 Bacteria 2496
127 Ga0068870_10361258 3300005840 Bacteria 934
128 Ga0068860_100824054 3300005843 Bacteria 942
129 Ga0068860_101651655 3300005843 Bacteria 663
130 Ga0068862_100003677 3300005844 Bacteria 13117
131 Ga0068862_100349895 3300005844 Bacteria 1371
132 Ga0081539_10000226 3300005985 Bacteria 132618
133 Ga0075432_10246596 3300006058 Bacteria 723
134 Ga0070715_10008322 3300006163 Bacteria 3611
135 Ga0070716_100170393 3300006173 Bacteria 1420
136 Ga0070716_100437423 3300006173 Bacteria 950
137 Ga0070716_100452954 3300006173 Bacteria 936
138 Ga0097621_100006125 3300006237 Bacteria 8517
139 Ga0097621_101427423 3300006237 Bacteria 656
140 Ga0068871_100023710 3300006358 Bacteria 4751
141 Ga0075428_100013313 3300006844 Bacteria 9151
142 Ga0075428_100019983 3300006844 Bacteria 7417
143 Ga0075428_100144220 3300006844 Bacteria 2588
144 Ga0075430_100018473 3300006846 Bacteria 5933
145 Ga0075430_100021015 3300006846 Bacteria 5548
146 Ga0075430_100091886 3300006846 Bacteria 2538
147 Ga0075430_100481589 3300006846 Bacteria 1024
148 Ga0075430_100726963 3300006846 Bacteria 818
149 Ga0075431_100043121 3300006847 Bacteria 4655
150 Ga0075431_100086436 3300006847 Bacteria 3236
151 Ga0075431_100125262 3300006847 Bacteria 2651
152 Ga0075431_100270517 3300006847 Bacteria 1722
153 Ga0075431_100345652 3300006847 Bacteria 1496
154 Ga0075431_100633125 3300006847 Bacteria 1051
155 Ga0075431_100867311 3300006847 Bacteria 873
156 Ga0075433_10017867 3300006852 Bacteria 5885
157 Ga0075433_10048095 3300006852 Bacteria 3709
158 Ga0075433_10579325 3300006852 Bacteria 986
159 Ga0075433_10777500 3300006852 Bacteria 837
160 Ga0075433_11429667 3300006852 Bacteria 598
161 Ga0075434_100000358 3300006871 Bacteria 33110
162 Ga0075434_100017180 3300006871 Bacteria 6965
163 Ga0075434_100091374 3300006871 Bacteria 3046
164 Ga0075434_102205165 3300006871 Bacteria 555
165 Ga0075429_100000646 3300006880 Bacteria 26951
166 Ga0075429_100125559 3300006880 Bacteria 2244
167 Ga0075429_100153768 3300006880 Bacteria 2014
168 Ga0075429_100314174 3300006880 Bacteria 1371
169 Ga0075429_100511924 3300006880 Bacteria 1052
170 Ga0075429_100934005 3300006880 Bacteria 759
171 Ga0068865_100006486 3300006881 Bacteria 7142
172 Ga0075436_100000499 3300006914 Bacteria 25388
173 Ga0075436_100131444 3300006914 Bacteria 1756
174 Ga0075436_100153356 3300006914 Bacteria 1622
175 Ga0075436_100302986 3300006914 Bacteria 1146
176 Ga0097620_100199545 3300006931 Bacteria 2085
177 Ga0097620_100786221 3300006931 Bacteria 1040
178 Ga0097620_101505994 3300006931 Bacteria 743
179 Ga0075435_100000614 3300007076 Bacteria 21898
180 Ga0075435_100114060 3300007076 Bacteria 2250
181 Ga0075435_100323197 3300007076 Bacteria 1321
182 Ga0075435_101333850 3300007076 Bacteria 628
183 Ga0099794_10019591 3300007265 Bacteria 3052
184 Ga0099794_10033394 3300007265 Bacteria 2419
185 Ga0099794_10093686 3300007265 Bacteria 1493
186 Ga0099794_10550418 3300007265 Bacteria 609
187 Ga0111539_10023233 3300009094 Bacteria 7617
188 Ga0111539_10033055 3300009094 Bacteria 6280
189 Ga0111539_10264444 3300009094 Bacteria 2002
190 Ga0111539_12024392 3300009094 Bacteria 668
191 Ga0105245_10061527 3300009098 Bacteria 3385
192 Ga0114129_10082625 3300009147 Bacteria 4463
193 Ga0114129_10089197 3300009147 Bacteria 4275
194 Ga0114129_10164161 3300009147 Bacteria 3032
195 Ga0114129_10679670 3300009147 Bacteria 1325
196 Ga0114129_10719421 3300009147 Bacteria 1281
197 Ga0114129_10907741 3300009147 Bacteria 1116
198 Ga0114129_12100550 3300009147 Unclassified 681
199 Ga0114129_12540627 3300009147 Bacteria 612
200 Ga0114129_13086499 3300009147 Bacteria 545
201 Ga0105243_10076766 3300009148 Bacteria 2716
202 Ga0105243_10126161 3300009148 Bacteria 2165
203 Ga0105243_11361953 3300009148 Bacteria 729
204 Ga0105242_10007522 3300009176 Bacteria 8382
205 Ga0105242_11025514 3300009176 Bacteria 834
206 Ga0105242_12809459 3300009176 Bacteria 537
207 Ga0105248_10064618 3300009177 Bacteria 4108
208 Ga0105249_10008606 3300009553 Bacteria 8894
209 Ga0105249_10675502 3300009553 Bacteria 1092
210 Ga0105249_12589153 3300009553 Bacteria 580
211 Ga0157369_10250975 3300013105 Bacteria 1847
212 Ga0157378_10672188 3300013297 Bacteria 1053
213 Ga0163162_10751881 3300013306 Bacteria 1094
214 Ga0157372_10121290 3300013307 Bacteria 3003
215 Ga0157372_11227824 3300013307 Bacteria 866
216 Ga0157375_11456865 3300013308 Bacteria 807
217 Ga0157380_10033583 3300014326 Bacteria 3952
218 Ga0157376_10505857 3300014969 Bacteria 1188
219 Ga0213871_10037293 3300021441 Bacteria 1293
220 Ga0207653_10129181 3300025885 Bacteria 916
221 Ga0207692_10214855 3300025898 Bacteria 1137
222 Ga0207642_10034242 3300025899 Bacteria 2158
223 Ga0207685_10045476 3300025905 Bacteria 1665
224 Ga0207645_10112948 3300025907 Bacteria 1760
225 Ga0207643_10393015 3300025908 Bacteria 876
226 Ga0207643_10409126 3300025908 Bacteria 859
227 Ga0207684_10478298 3300025910 Bacteria 1068
228 Ga0207684_11080816 3300025910 Bacteria 668
229 Ga0207707_10009641 3300025912 Bacteria 8377
230 Ga0207707_10290094 3300025912 Bacteria 1416
231 Ga0207707_10673478 3300025912 Bacteria 870
232 Ga0207660_10027511 3300025917 Bacteria 3882
233 Ga0207660_10075763 3300025917 Bacteria 2459
234 Ga0207660_10791971 3300025917 Bacteria 774
235 Ga0207660_10890243 3300025917 Bacteria 726
236 Ga0207662_10029353 3300025918 Bacteria 3186
237 Ga0207662_10047661 3300025918 Bacteria 2538
238 Ga0207662_10152748 3300025918 Bacteria 1470
239 Ga0207662_10266503 3300025918 Bacteria 1129
240 Ga0207662_10405580 3300025918 Bacteria 925
241 Ga0207662_10523222 3300025918 Bacteria 819
242 Ga0207652_10028250 3300025921 Bacteria 4679
243 Ga0207646_11071457 3300025922 Bacteria 710
244 Ga0207681_10016684 3300025923 Bacteria 4600
245 Ga0207650_10875097 3300025925 Bacteria 762
246 Ga0207659_10015323 3300025926 Bacteria 4962
247 Ga0207659_10228360 3300025926 Bacteria 1500
248 Ga0207687_10186451 3300025927 Bacteria 1611
249 Ga0207700_10651629 3300025928 Bacteria 939
250 Ga0207686_10057422 3300025934 Bacteria 2450
251 Ga0207686_10652511 3300025934 Bacteria 833
252 Ga0207709_10030619 3300025935 Bacteria 3132
253 Ga0207670_10111361 3300025936 Bacteria 1973
254 Ga0207670_10263574 3300025936 Bacteria 1337
255 Ga0207670_10292655 3300025936 Bacteria 1272
256 Ga0207670_10450786 3300025936 Bacteria 1037
257 Ga0207669_10227818 3300025937 Bacteria 1373
258 Ga0207704_10065397 3300025938 Bacteria 2276
259 Ga0207704_11989949 3300025938 Unclassified 500
260 Ga0207665_10308301 3300025939 Bacteria 1185
261 Ga0207691_10090715 3300025940 Bacteria 2739
262 Ga0207711_10269042 3300025941 Bacteria 1568
263 Ga0207689_10011976 3300025942 Bacteria 7434
264 Ga0207689_10441048 3300025942 Unclassified 1088
265 Ga0207661_10028277 3300025944 Bacteria 4292
266 Ga0207661_10271317 3300025944 Bacteria 1514
267 Ga0207651_10927836 3300025960 Bacteria 776
268 Ga0207712_10004779 3300025961 Bacteria 8554
269 Ga0207712_11769777 3300025961 Bacteria 554
270 Ga0207668_10062992 3300025972 Bacteria 2614
271 Ga0207640_11437361 3300025981 Bacteria 618
272 Ga0207658_10123861 3300025986 Bacteria 2066
273 Ga0207658_11034217 3300025986 Bacteria 750
274 Ga0207677_10462105 3300026023 Bacteria 1090
275 Ga0207677_10895848 3300026023 Bacteria 799
276 Ga0207703_10356467 3300026035 Bacteria 1348
277 Ga0207703_11351325 3300026035 Bacteria 685
278 Ga0207708_10686670 3300026075 Bacteria 874
279 Ga0207641_11737250 3300026088 Unclassified 626
280 Ga0207648_10024077 3300026089 Bacteria 5440
281 Ga0207676_11832289 3300026095 Bacteria 605
282 Ga0207674_10265547 3300026116 Bacteria 1664
283 Ga0207674_10928349 3300026116 Bacteria 839
284 Ga0207674_11111908 3300026116 Bacteria 760
285 Ga0207675_100010044 3300026118 Bacteria 8874
286 Ga0207675_100304353 3300026118 Bacteria 1553
287 Ga0207675_102671510 3300026118 Bacteria 508
288 Ga0207683_10424655 3300026121 Bacteria 1224
289 Ga0209969_1002518 3300027360 Bacteria 2535
290 Ga0209969_1065507 3300027360 Bacteria 576
291 Ga0209967_1002770 3300027364 Bacteria 2282
292 Ga0209967_1014761 3300027364 Bacteria 1114
293 Ga0209981_1002535 3300027378 Bacteria 2330
294 Ga0209996_1014779 3300027395 Bacteria 1062
295 Ga0209996_1024737 3300027395 Bacteria 857
296 Ga0209996_1074437 3300027395 Bacteria 530
297 Ga0210000_1000834 3300027462 Bacteria 4269
298 Ga0210000_1015336 3300027462 Bacteria 1153
299 Ga0209995_1000938 3300027471 Bacteria 4532
300 Ga0209995_1010881 3300027471 Bacteria 1478
301 Ga0209995_1032875 3300027471 Bacteria 871
302 Ga0209995_1048007 3300027471 Bacteria 723
303 Ga0209968_1019236 3300027526 Bacteria 1099
304 Ga0209968_1089850 3300027526 Unclassified 556
305 Ga0209999_1004154 3300027543 Bacteria 2607
306 Ga0209970_1002765 3300027614 Bacteria 2967
307 Ga0209983_1004835 3300027665 Bacteria 2812
308 Ga0209983_1009397 3300027665 Bacteria 2000
309 Ga0209588_1063537 3300027671 Bacteria 1193
310 Ga0209588_1168120 3300027671 Unclassified 691
311 Ga0209971_1012532 3300027682 Bacteria 2006
312 Ga0209971_1049492 3300027682 Bacteria 1015
313 Ga0209966_1002334 3300027695 Bacteria 3166
314 Ga0209974_10063429 3300027876 Unclassified 1253
315 Ga0209974_10330600 3300027876 Bacteria 588
316 Ga0207428_10171161 3300027907 Bacteria 1645
317 Ga0268265_10001937 3300028380 Bacteria 16419
318 Ga0268265_10604390 3300028380 Bacteria 1048
319 Ga0268265_11547363 3300028380 Bacteria 667
320 Ga0265320_10317168 3300031240 Bacteria 689
321 Ga0307408_100048376 3300031548 Bacteria 3050
322 Ga0307408_100228150 3300031548 Bacteria 1523
323 Ga0307408_100535669 3300031548 Bacteria 1031
324 Ga0307408_100743439 3300031548 Bacteria 885
325 Ga0307408_100768492 3300031548 Bacteria 872
326 Ga0316575_10010029 3300031665 Bacteria 3474
327 Ga0316579_10026452 3300031691 Bacteria 2627
328 Ga0316578_10029558 3300031728 Bacteria 3110
329 Ga0307405_10263899 3300031731 Bacteria 1288
330 Ga0307405_10388072 3300031731 Bacteria 1089
331 Ga0307405_10711555 3300031731 Bacteria 833
332 Ga0307413_10280642 3300031824 Bacteria 1253
333 Ga0307413_10428711 3300031824 Bacteria 1044
334 Ga0307406_11316335 3300031901 Bacteria 631
335 Ga0307407_10620284 3300031903 Bacteria 807
336 Ga0307412_10320468 3300031911 Bacteria 1233
337 Ga0307412_10451798 3300031911 Bacteria 1059
338 Ga0307412_10601832 3300031911 Bacteria 931
339 Ga0307409_100254084 3300031995 Bacteria 1609
340 Ga0307409_100655777 3300031995 Bacteria 1044
341 Ga0307409_102236824 3300031995 Bacteria 576
342 Ga0307416_100022471 3300032002 Bacteria 4554
343 Ga0307416_100027522 3300032002 Bacteria 4212
344 Ga0307416_100350449 3300032002 Bacteria 1494
345 Ga0307416_101050268 3300032002 Bacteria 918
346 Ga0307416_101419576 3300032002 Bacteria 800
347 Ga0307416_103294229 3300032002 Unclassified 540
348 Ga0307411_10144614 3300032005 Bacteria 1758
349 Ga0307411_10553952 3300032005 Bacteria 981
350 Ga0307411_11255217 3300032005 Bacteria 673
351 Ga0307411_12119056 3300032005 Unclassified 526
352 Ga0307415_101573539 3300032126 Bacteria 631
353 Ga0316583_10028308 3300032133 Bacteria 1998
354 Ga0373930_0085815 3300034816 Bacteria 733
355 Ga0373950_0111715 3300034818 Bacteria 597
356 Ga0373958_0165682 3300034819 Bacteria 561
357 Ga0373938_0072108 3300034957 Bacteria 827
358 Ga0373929_0221352 3300035085 Unclassified 538
359 Ga0373934_0017629 3300035086 Bacteria 2728
360 Ga0373940_0042192 3300035088 Bacteria 1257
361 Ga0373952_0013562 3300035092 Bacteria 1619
362 Ga0373923_0272920 3300035111 Bacteria 796
363 Ga0373936_0266967 3300035113 Bacteria 767
364 Ga0373939_0129060 3300035114 Bacteria 900
365 Ga0373941_0135892 3300035115 Bacteria 890
366 Ga0373953_0087914 3300035117 Bacteria 1298
367 Ga0373953_0141110 3300035117 Bacteria 1030
368 Ga0373954_0000055 3300035118 Bacteria 40229
369 Ga0373956_0148906 3300035119 Bacteria 1101
370 Ga0373956_0517980 3300035119 Bacteria 569
371 Ga0373957_0005549 3300035120 Bacteria 3914
372 Ga0373955_0000731 3300035172 Bacteria 14077
373 Ga0373955_0178911 3300035172 Bacteria 1258
374 Ga0373955_0197689 3300035172 Bacteria 1196
375 Ga0373942_0002470 3300035207 Bacteria 4483
376 Ga0373942_0144659 3300035207 Bacteria 759
377 Ga0373942_0161505 3300035207 Bacteria 725
378 Ga0373961_0009521 3300035241 Bacteria 2379
379 Ga0373961_0129043 3300035241 Bacteria 845
380 Ga0373961_0168321 3300035241 Bacteria 757
381 Ga0373962_0273099 3300035242 Unclassified 593
382 Ga0373924_0085947 3300035410 Bacteria 1341
383 Ga0373931_0015441 3300035691 Bacteria 3746
384 Ga0373931_0049776 3300035691 Bacteria 2227
385 Ga0373931_1272490 3300035691 Unclassified 505
386 Ga0373935_0008593 3300035692 Bacteria 6110
387 Ga0373935_0926474 3300035692 Bacteria 646
388 Ga0373927_0150266 3300035695 Bacteria 1525
389 Ga0373927_0327055 3300035695 Bacteria 1010
390 Ga0373933_0004744 3300035724 Bacteria 7433
391 Ga0373933_0067797 3300035724 Bacteria 2166
392 Ga0373933_0069434 3300035724 Bacteria 2141
393 Ga0373933_0389136 3300035724 Bacteria 909
394 Ga0373947_0364462 3300035725 Bacteria 971
395 Ga0373947_0702339 3300035725 Bacteria 690
396 Ga0373937_0000131 3300036401 Bacteria 72767
397 Ga0373937_0003520 3300036401 Bacteria 13176
398 Ga0373937_0072100 3300036401 Bacteria 3185
399 Ga0373937_0143935 3300036401 Bacteria 2231
400 Ga0373937_0287560 3300036401 Bacteria 1553
401 Ga0373937_0585400 3300036401 Bacteria 1059
402 Ga0373937_1361489 3300036401 Bacteria 658
403 Ga0316582_0002625 3300036647 Bacteria 8514
404 Ga0373925_0026437 3300037068 Bacteria 4246
405 Ga0373925_0657418 3300037068 Bacteria 864
406 Ga0373925_1467188 3300037068 Bacteria 558
407 Ga0395905_0577839 3300037471 Bacteria 1025
408 Ga0316581_0010446 3300037588 Bacteria 2574
409 Ga0436360_0608163 3300039438 Bacteria 1687
410 Ga0439436_0164391 3300041404 Bacteria 628
411 Ga0439453_0000441 3300041408 Bacteria 4520
412 Ga0439461_0003417 3300041410 Bacteria 2614
413 Ga0451807_2436605 3300041486 Bacteria 884
414 Ga0451839_0385018 3300041496 Bacteria 1123
415 Ga0451849_0794106 3300041505 Unclassified 502
416 Ga0451851_1093402 3300041507 Bacteria 698
417 Ga0439431_0226509 3300041997 Bacteria 550
418 Ga0439441_012520 3300042001 Bacteria 1457
419 Ga0439441_022679 3300042001 Bacteria 1168
420 Ga0439441_036033 3300042001 Bacteria 977
421 Ga0439441_074889 3300042001 Bacteria 730
422 Ga0439443_000785 3300042003 Bacteria 3143
423 Ga0450913_009054 3300042117 Bacteria 776
424 Ga0450923_187389 3300042125 Bacteria 511
425 Ga0450910_068328 3300042147 Bacteria 608
426 Ga0439446_0023875 3300042156 Bacteria 1742
427 Ga0439446_0044819 3300042156 Bacteria 1310
428 Ga0439458_0082962 3300042157 Bacteria 819
429 Ga0439434_0004987 3300042435 Bacteria 3880
430 Ga0439434_0019513 3300042435 Bacteria 2034
431 Ga0439434_0244440 3300042435 Bacteria 613
432 Ga0439435_0000013 3300042436 Bacteria 19405
433 Ga0439435_0008638 3300042436 Bacteria 2366
434 Ga0439444_0079757 3300042437 Bacteria 714
435 Ga0439459_0052719 3300042438 Bacteria 898
436 Ga0439459_0230774 3300042438 Bacteria 516
437 Ga0439464_0220828 3300042439 Bacteria 608
438 Ga0439460_0055750 3300042461 Bacteria 1195
439 Ga0451577_1459273 3300042876 Bacteria 606
440 Ga0453683_0744399 3300044673 Bacteria 644
441 Ga0466964_0052400 3300044706 Bacteria 1677
442 Ga0453684_2174305 3300044712 Unclassified 555
443 Ga0466960_0387641 3300044901 Bacteria 803
444 Ga0451576_0022948 3300045051 Bacteria 6762
445 Ga0451576_0127617 3300045051 Bacteria 2650
446 Ga0451576_0380952 3300045051 Bacteria 1478
447 Ga0451576_0693317 3300045051 Bacteria 1070
448 Ga0451576_0817411 3300045051 Bacteria 978
449 Ga0451576_1288699 3300045051 Bacteria 762
450 Ga0466958_0274864 3300045836 Bacteria 1079
451 Ga0466967_0007982 3300045976 Bacteria 7704
452 Ga0495592_0701292 3300046454 Bacteria 609
453 Ga0495629_0658931 3300046459 Bacteria 697
454 Ga0495641_0075700 3300046461 Bacteria 1509
455 Ga0495651_0080330 3300046462 Bacteria 2464
456 Ga0495662_0040235 3300046476 Bacteria 2257
457 Ga0495664_0202758 3300046477 Bacteria 1202
458 Ga0495608_0027505 3300046511 Bacteria 3869
459 Ga0495608_0387581 3300046511 Bacteria 856
460 Ga0495618_0022504 3300046514 Bacteria 3893
461 Ga0495618_0870783 3300046514 Bacteria 521
462 Ga0495628_0083822 3300046516 Bacteria 2474
463 Ga0495628_0626027 3300046516 Bacteria 766
464 Ga0495666_0090531 3300046526 Bacteria 1444
465 Ga0495642_0259657 3300046528 Bacteria 760
466 Ga0495642_0527445 3300046528 Unclassified 523
467 Ga0495652_0145762 3300046529 Bacteria 1856
468 Ga0495652_0717486 3300046529 Unclassified 671
469 Ga0495652_1085180 3300046529 Bacteria 520
470 Ga0495640_0019880 3300046533 Bacteria 4953
471 Ga0495640_0024984 3300046533 Bacteria 4340
472 Ga0495586_0014573 3300046535 Bacteria 4177
473 Ga0495586_0100269 3300046535 Bacteria 1606
474 Ga0495587_0266561 3300046536 Bacteria 961
475 Ga0495587_0430626 3300046536 Bacteria 732
476 Ga0495598_0043562 3300046537 Bacteria 1322
477 Ga0495598_0193944 3300046537 Bacteria 731
478 Ga0495598_0334308 3300046537 Bacteria 580
479 Ga0495621_0142280 3300046539 Bacteria 939
480 Ga0495645_0304454 3300046543 Bacteria 1040
481 Ga0495667_0034202 3300046559 Bacteria 3398
482 Ga0495667_0054686 3300046559 Bacteria 2626
483 Ga0495667_0248962 3300046559 Bacteria 1131
484 Ga0495656_0441147 3300046615 Bacteria 685
485 Ga0495634_0030050 3300046642 Bacteria 3756
486 Ga0495635_0025308 3300046663 Bacteria 4134
487 Ga0495635_0177139 3300046663 Bacteria 1450
488 Ga0495635_0255647 3300046663 Bacteria 1180
489 Ga0495657_0890222 3300046675 Bacteria 506
490 Ga0495599_0896441 3300046678 Bacteria 503
491 Ga0495623_0482863 3300046679 Bacteria 656
492 Ga0495658_0044201 3300046683 Bacteria 2495
493 Ga0495658_1093409 3300046683 Bacteria 508
494 Ga0495669_0016911 3300046684 Bacteria 3128
495 Ga0495669_0084926 3300046684 Bacteria 1456
496 Ga0495669_0384676 3300046684 Bacteria 679
497 Ga0495613_0052482 3300046689 Bacteria 3003
498 Ga0495624_0047197 3300046690 Bacteria 2737
499 Ga0495624_0322381 3300046690 Bacteria 930
500 Ga0495670_0559178 3300046691 Bacteria 623
501 Ga0495600_0084400 3300046809 Bacteria 2073
502 Ga0495581_0275174 3300047315 Bacteria 984
503 Ga0495581_0470570 3300047315 Bacteria 731
504 Ga0495604_0022663 3300047317 Bacteria 5014
505 Ga0495604_0314912 3300047317 Bacteria 1047
506 Ga0495636_0028364 3300047318 Bacteria 2283
507 Ga0495636_0286433 3300047318 Bacteria 768
508 Ga0495680_0001327 3300047322 Bacteria 26985
509 Ga0495680_0073628 3300047322 Bacteria 2595
510 Ga0495675_0107280 3300047444 Bacteria 1745
511 Ga0495677_0320508 3300047445 Bacteria 610
512 Ga0495684_0011273 3300047471 Bacteria 6906
513 Ga0495602_0295384 3300048088 Bacteria 1188
514 Ga0495602_1055122 3300048088 Bacteria 534
515 Ga0501296_037508 3300049519 Bacteria 673
516 Ga0501299_166193 3300049522 Bacteria 567
517 Ga0501301_032468 3300049524 Bacteria 560
518 Ga0501031_0190108 3300049568 Bacteria 1341
519 Ga0501033_0472923 3300049570 Bacteria 869
520 Ga0501033_0643146 3300049570 Bacteria 725
521 Ga0501036_0080670 3300049572 Bacteria 2750
522 Ga0501036_0699446 3300049572 Bacteria 838
523 Ga0501037_1069696 3300049573 Bacteria 523
524 Ga0501038_0090845 3300049574 Bacteria 2559
525 Ga0501038_0172497 3300049574 Bacteria 1750
526 Ga0501039_0027225 3300049575 Bacteria 4396
527 Ga0501039_0210811 3300049575 Bacteria 1528
528 Ga0501039_1483603 3300049575 Bacteria 521
529 Ga0501040_0008686 3300049576 Bacteria 6598
530 Ga0501040_0015767 3300049576 Bacteria 4996
531 Ga0501040_0736409 3300049576 Unclassified 713
532 Ga0501041_0004330 3300049577 Bacteria 8207
533 Ga0501041_0114760 3300049577 Bacteria 1672
534 Ga0501041_0264113 3300049577 Bacteria 1083
535 Ga0501041_0767125 3300049577 Bacteria 618
536 Ga0501042_0098215 3300049578 Bacteria 2106
537 Ga0501042_0792707 3300049578 Bacteria 689
538 Ga0501046_0054285 3300049580 Bacteria 3153
539 Ga0501048_0008923 3300049582 Bacteria 7549
540 Ga0501048_0061873 3300049582 Bacteria 2650
541 Ga0501048_0559662 3300049582 Bacteria 820
542 Ga0501048_0779681 3300049582 Bacteria 687
543 Ga0501067_0451128 3300049583 Bacteria 718
544 Ga0501068_0035844 3300049584 Bacteria 2963
545 Ga0501068_1159373 3300049584 Bacteria 512
546 Ga0501069_0174441 3300049585 Bacteria 1241
547 Ga0501071_0004638 3300049587 Bacteria 8724
548 Ga0501071_0046193 3300049587 Bacteria 3128
549 Ga0501071_0508970 3300049587 Bacteria 924
550 Ga0501071_0724294 3300049587 Bacteria 766
551 Ga0501072_0004342 3300049588 Bacteria 10759
552 Ga0501072_0369370 3300049588 Bacteria 1139
553 Ga0501072_0445333 3300049588 Bacteria 1026
554 Ga0501072_0453233 3300049588 Bacteria 1016
555 Ga0501072_1323756 3300049588 Bacteria 558
556 Ga0501073_0161332 3300049589 Bacteria 1553
557 Ga0501074_0161208 3300049590 Bacteria 1602
558 Ga0501075_0002475 3300049591 Bacteria 12319
559 Ga0501075_0045801 3300049591 Bacteria 3284
560 Ga0501076_0001408 3300049592 Bacteria 16105
561 Ga0501076_0093956 3300049592 Bacteria 2414
562 Ga0501077_0038847 3300049593 Bacteria 3031
563 Ga0501077_0431705 3300049593 Bacteria 843
564 Ga0501217_110842 3300049661 Bacteria 789
565 Ga0501223_103004 3300049663 Bacteria 590
566 Ga0501230_094648 3300049667 Bacteria 638
567 Ga0501233_111919 3300049668 Bacteria 731
568 Ga0501233_131575 3300049668 Bacteria 684
569 Ga0501236_024604 3300049670 Bacteria 915
570 Ga0501236_135741 3300049670 Bacteria 511
571 Ga0501221_208977 3300049704 Bacteria 546
572 Ga0501079_0007587 3300049741 Bacteria 8218
573 Ga0501079_0136070 3300049741 Bacteria 1913
574 Ga0501079_0541910 3300049741 Bacteria 915
575 Ga0501080_0003790 3300049742 Bacteria 13348
576 Ga0501080_0542268 3300049742 Bacteria 1037
577 Ga0501080_1008286 3300049742 Bacteria 722
578 Ga0501081_0003604 3300049743 Bacteria 9904
579 Ga0501081_0217729 3300049743 Bacteria 1388
580 Ga0501081_0803026 3300049743 Bacteria 708
581 Ga0501083_0063656 3300049744 Bacteria 2460
582 Ga0501283_056246 3300049779 Bacteria 704
583 Ga0501035_0124992 3300049822 Bacteria 2246
584 Ga0501035_0862645 3300049822 Bacteria 719
585 Ga0501035_0940153 3300049822 Bacteria 683
586 Ga0501044_1143824 3300049823 Bacteria 647
587 Ga0501045_0015134 3300049824 Bacteria 5475
588 Ga0501045_0327595 3300049824 Bacteria 1140
589 nmdc:mga05p37_1622771_c1 3300050507 Bacteria 636
590 nmdc:mga05p37_2000239_c1 3300050507 Bacteria 548
591 nmdc:mga05p37_229182_c1 3300050507 Bacteria 2239
592 nmdc:mga05p37_653397_c1 3300050507 Bacteria 1177
593 nmdc:mga05p37_9357_c1 3300050507 Bacteria 11596
594 nmdc:mga05p37_996603_c1 3300050507 Bacteria 890
595 nmdc:mga09592_1053252_c1 3300050508 Bacteria 678
596 nmdc:mga09592_1256619_c1 3300050508 Bacteria 610
597 nmdc:mga09592_169255_c1 3300050508 Bacteria 1889
598 nmdc:mga09592_21320_c1 3300050508 Bacteria 5341
599 nmdc:mga09592_315_c1 3300050508 Bacteria 35276
600 nmdc:mga09592_623430_c1 3300050508 Bacteria 923
601 nmdc:mga0qj67_11994_c1 3300050509 Bacteria 6512
602 nmdc:mga0qj67_39720_c1 3300050509 Bacteria 3697
603 nmdc:mga0qj67_59903_c1 3300050509 Bacteria 3020
604 nmdc:mga06r32_10212_c1 3300050510 Bacteria 8474
605 nmdc:mga06r32_19839_c1 3300050510 Bacteria 6178
606 nmdc:mga06r32_216921_c1 3300050510 Bacteria 1901
607 nmdc:mga06r32_275866_c1 3300050510 Bacteria 1669
608 nmdc:mga06r32_376974_c1 3300050510 Bacteria 1402
609 nmdc:mga06r32_659519_c1 3300050510 Bacteria 1014
610 nmdc:mga06r32_660157_c1 3300050510 Bacteria 1013
611 nmdc:mga08y16_14446_c1 3300050511 Bacteria 8305
612 nmdc:mga08y16_1730777_c1 3300050511 Bacteria 580
613 nmdc:mga08y16_250597_c1 3300050511 Bacteria 1830
614 nmdc:mga08y16_295278_c1 3300050511 Bacteria 1671
615 nmdc:mga08y16_76782_c1 3300050511 Bacteria 3482
616 nmdc:mga0n895_11520_c1 3300050512 Bacteria 7895
617 nmdc:mga0n895_190564_c1 3300050512 Bacteria 2082
618 nmdc:mga0n895_5209_c1 3300050512 Bacteria 10825
619 nmdc:mga0rr50_1570665_c1 3300050513 Bacteria 556
620 nmdc:mga0rr50_482213_c1 3300050513 Bacteria 1053
621 nmdc:mga0rr50_48384_c1 3300050513 Bacteria 3143
622 nmdc:mga0rr50_491055_c1 3300050513 Bacteria 1043
623 nmdc:mga08x19_1081799_c1 3300050514 Bacteria 569
624 nmdc:mga08x19_1182_c1 3300050514 Bacteria 16367
625 nmdc:mga08x19_27614_c1 3300050514 Bacteria 3550
626 nmdc:mga08x19_38172_c1 3300050514 Bacteria 3050
627 nmdc:mga08x19_91248_c1 3300050514 Bacteria 2011
628 nmdc:mga0a205_1121832_c1 3300050515 Bacteria 634
629 nmdc:mga0a205_15396_c1 3300050515 Bacteria 7148
630 nmdc:mga0a205_3868_c1 3300050515 Bacteria 13412
631 nmdc:mga0a205_465006_c1 3300050515 Bacteria 1124
632 nmdc:mga0a205_573927_c1 3300050515 Bacteria 982
633 Ga0495601_0007663 3300053077 Bacteria 6344
634 Ga0495601_0104644 3300053077 Bacteria 1830
635 Ga0495619_0073794 3300053085 Bacteria 2287
636 Ga0500566_0214412 3300053094 Bacteria 962
637 Ga0501084_0032289 3300054114 Bacteria 4379
638 Ga0501082_0014909 3300060353 Bacteria 6696
639 Ga0501082_0199439 3300060353 Bacteria 1741
640 Ga0530510_0003476 3300061734 Bacteria 10827
641 Ga0316574_0682958
642 rootH1_10103351
643 Ga0065704_10478448
644 Ga0065707_10056190
645 Ga0065707_10297899
646 Ga0065707_10551470
647 Ga0065707_10920070
648 Ga0070676_10118151
649 Ga0070676_11182838
650 Ga0070683_100028749
651 Ga0070683_100161378
652 Ga0070690_100013534
653 Ga0070690_100297286
654 Ga0070690_100879268
655 Ga0068869_100021879
656 Ga0070680_100172298
657 Ga0070680_100350211
658 Ga0070680_100783124
659 Ga0070680_100862458
660 Ga0068868_100691333
661 Ga0070689_100138030
662 Ga0070691_10070481
663 Ga0070691_10151068
664 Ga0070687_100324120
665 Ga0070687_100340162
666 Ga0070687_100425795
667 Ga0070687_101055564
668 Ga0070692_10019466
669 Ga0070692_10030016
670 Ga0070692_10114208
671 Ga0070692_10215525
672 Ga0070692_10329574
673 Ga0070668_100266591
674 Ga0070669_100038713
675 Ga0070675_100018880
676 Ga0070671_100111857
677 Ga0070674_100794742
678 Ga0070673_100276443
679 Ga0070673_100440853
680 Ga0070673_101281014
681 Ga0070688_100267124
682 Ga0070688_100473318
683 Ga0070703_10290372
684 Ga0070709_10845521
685 Ga0070709_11196074
686 Ga0070714_100977272
687 Ga0070713_101850126
688 Ga0070710_10157361
689 Ga0070710_10475983
690 Ga0070701_10847767
691 Ga0070705_100014665
692 Ga0070705_100062555
693 Ga0070705_100117546
694 Ga0070705_100993611
695 Ga0070705_101285892
696 Ga0070700_100008805
697 Ga0070700_100359575
698 Ga0070700_100623832
699 Ga0070694_100011182
700 Ga0070694_100084175
701 Ga0070694_100205570
702 Ga0070694_100221573
703 Ga0070694_100370316
704 Ga0070694_100440846
705 Ga0070694_100915448
706 Ga0070694_101173189
707 Ga0070678_100527077
708 Ga0070681_10000270
709 Ga0070681_10353421
710 Ga0068867_100013837
711 Ga0068867_100142868
712 Ga0068867_100340168
713 Ga0068867_101156446
714 Ga0070685_10465021
715 Ga0070706_100569861
716 Ga0070706_100660783
717 Ga0070707_100329718
718 Ga0070707_100686410
719 Ga0070707_101728718
720 Ga0070698_100254665
721 Ga0070698_100382841
722 Ga0070699_100005151
723 Ga0070699_100097462
724 Ga0070699_100129600
725 Ga0070699_101431816
726 Ga0070679_100021353
727 Ga0070679_101919570
728 Ga0070684_100077123
729 Ga0070697_100012581
730 Ga0070697_100019988
731 Ga0070672_101952125
732 Ga0070686_100056754
733 Ga0070686_100111996
734 Ga0070686_100402271
735 Ga0070695_100000897
736 Ga0070695_100062960
737 Ga0070695_100391725
738 Ga0070695_100672030
739 Ga0070695_100724733
740 Ga0070696_100062200
741 Ga0070696_100146513
742 Ga0070696_100148289
743 Ga0070696_100580920
744 Ga0070696_100633884
745 Ga0070696_101303607
746 Ga0070693_100205333
747 Ga0070693_100240829
748 Ga0070693_100634382
749 Ga0070704_100010603
750 Ga0070704_100024777
751 Ga0070704_100144404
752 Ga0070704_100215827
753 Ga0070704_100264336
754 Ga0070704_100537419
755 Ga0070704_101516460
756 Ga0070704_101731662
757 Ga0070702_101236549
758 Ga0068859_100199553
759 Ga0068859_100786265
760 Ga0068859_101506083
761 Ga0068864_100300921
762 Ga0068866_10026293
763 Ga0068861_100012489
764 Ga0068861_100545750
765 Ga0068861_101766041
766 Ga0068870_10037587
767 Ga0068870_10361258
768 Ga0068860_100824054
769 Ga0068860_101651655
770 Ga0068862_100003677
771 Ga0068862_100349895
772 Ga0081539_10000226
773 Ga0075432_10246596
774 Ga0070715_10008322
775 Ga0070716_100170393
776 Ga0070716_100437423
777 Ga0070716_100452954
778 Ga0097621_100006125
779 Ga0097621_101427423
780 Ga0068871_100023710
781 Ga0075428_100013313
782 Ga0075428_100019983
783 Ga0075428_100144220
784 Ga0075430_100018473
785 Ga0075430_100021015
786 Ga0075430_100091886
787 Ga0075430_100481589
788 Ga0075430_100726963
789 Ga0075431_100043121
790 Ga0075431_100086436
791 Ga0075431_100125262
792 Ga0075431_100270517
793 Ga0075431_100345652
794 Ga0075431_100633125
795 Ga0075431_100867311
796 Ga0075433_10017867
797 Ga0075433_10048095
798 Ga0075433_10579325
799 Ga0075433_10777500
800 Ga0075433_11429667
801 Ga0075434_100000358
802 Ga0075434_100017180
803 Ga0075434_100091374
804 Ga0075434_102205165
805 Ga0075429_100000646
806 Ga0075429_100125559
807 Ga0075429_100153768
808 Ga0075429_100314174
809 Ga0075429_100511924
810 Ga0075429_100934005
811 Ga0068865_100006486
812 Ga0075436_100000499
813 Ga0075436_100131444
814 Ga0075436_100153356
815 Ga0075436_100302986
816 Ga0097620_100199545
817 Ga0097620_100786221
818 Ga0097620_101505994
819 Ga0075435_100000614
820 Ga0075435_100114060
821 Ga0075435_100323197
822 Ga0075435_101333850
823 Ga0099794_10019591
824 Ga0099794_10033394
825 Ga0099794_10093686
826 Ga0099794_10550418
827 Ga0111539_10023233
828 Ga0111539_10033055
829 Ga0111539_10264444
830 Ga0111539_12024392
831 Ga0105245_10061527
832 Ga0114129_10082625
833 Ga0114129_10089197
834 Ga0114129_10164161
835 Ga0114129_10679670
836 Ga0114129_10719421
837 Ga0114129_10907741
838 Ga0114129_12100550
839 Ga0114129_12540627
840 Ga0114129_13086499
841 Ga0105243_10076766
842 Ga0105243_10126161
843 Ga0105243_11361953
844 Ga0105242_10007522
845 Ga0105242_11025514
846 Ga0105242_12809459
847 Ga0105248_10064618
848 Ga0105249_10008606
849 Ga0105249_10675502
850 Ga0105249_12589153
851 Ga0157369_10250975
852 Ga0157378_10672188
853 Ga0163162_10751881
854 Ga0157372_10121290
855 Ga0157372_11227824
856 Ga0157375_11456865
857 Ga0157380_10033583
858 Ga0157376_10505857
859 Ga0213871_10037293
860 Ga0207653_10129181
861 Ga0207692_10214855
862 Ga0207642_10034242
863 Ga0207685_10045476
864 Ga0207645_10112948
865 Ga0207643_10393015
866 Ga0207643_10409126
867 Ga0207684_10478298
868 Ga0207684_11080816
869 Ga0207707_10009641
870 Ga0207707_10290094
871 Ga0207707_10673478
872 Ga0207660_10027511
873 Ga0207660_10075763
874 Ga0207660_10791971
875 Ga0207660_10890243
876 Ga0207662_10029353
877 Ga0207662_10047661
878 Ga0207662_10152748
879 Ga0207662_10266503
880 Ga0207662_10405580
881 Ga0207662_10523222
882 Ga0207652_10028250
883 Ga0207646_11071457
884 Ga0207681_10016684
885 Ga0207650_10875097
886 Ga0207659_10015323
887 Ga0207659_10228360
888 Ga0207687_10186451
889 Ga0207700_10651629
890 Ga0207686_10057422
891 Ga0207686_10652511
892 Ga0207709_10030619
893 Ga0207670_10111361
894 Ga0207670_10263574
895 Ga0207670_10292655
896 Ga0207670_10450786
897 Ga0207669_10227818
898 Ga0207704_10065397
899 Ga0207704_11989949
900 Ga0207665_10308301
901 Ga0207691_10090715
902 Ga0207711_10269042
903 Ga0207689_10011976
904 Ga0207689_10441048
905 Ga0207661_10028277
906 Ga0207661_10271317
907 Ga0207651_10927836
908 Ga0207712_10004779
909 Ga0207712_11769777
910 Ga0207668_10062992
911 Ga0207640_11437361
912 Ga0207658_10123861
913 Ga0207658_11034217
914 Ga0207677_10462105
915 Ga0207677_10895848
916 Ga0207703_10356467
917 Ga0207703_11351325
918 Ga0207708_10686670
919 Ga0207641_11737250
920 Ga0207648_10024077
921 Ga0207676_11832289
922 Ga0207674_10265547
923 Ga0207674_10928349
924 Ga0207674_11111908
925 Ga0207675_100010044
926 Ga0207675_100304353
927 Ga0207675_102671510
928 Ga0207683_10424655
929 Ga0209969_1002518
930 Ga0209969_1065507
931 Ga0209967_1002770
932 Ga0209967_1014761
933 Ga0209981_1002535
934 Ga0209996_1014779
935 Ga0209996_1024737
936 Ga0209996_1074437
937 Ga0210000_1000834
938 Ga0210000_1015336
939 Ga0209995_1000938
940 Ga0209995_1010881
941 Ga0209995_1032875
942 Ga0209995_1048007
943 Ga0209968_1019236
944 Ga0209968_1089850
945 Ga0209999_1004154
946 Ga0209970_1002765
947 Ga0209983_1004835
948 Ga0209983_1009397
949 Ga0209588_1063537
950 Ga0209588_1168120
951 Ga0209971_1012532
952 Ga0209971_1049492
953 Ga0209966_1002334
954 Ga0209974_10063429
955 Ga0209974_10330600
956 Ga0207428_10171161
957 Ga0268265_10001937
958 Ga0268265_10604390
959 Ga0268265_11547363
960 Ga0265320_10317168
961 Ga0307408_100048376
962 Ga0307408_100228150
963 Ga0307408_100535669
964 Ga0307408_100743439
965 Ga0307408_100768492
966 Ga0316575_10010029
967 Ga0316579_10026452
968 Ga0316578_10029558
969 Ga0307405_10263899
970 Ga0307405_10388072
971 Ga0307405_10711555
972 Ga0307413_10280642
973 Ga0307413_10428711
974 Ga0307406_11316335
975 Ga0307407_10620284
976 Ga0307412_10320468
977 Ga0307412_10451798
978 Ga0307412_10601832
979 Ga0307409_100254084
980 Ga0307409_100655777
981 Ga0307409_102236824
982 Ga0307416_100022471
983 Ga0307416_100027522
984 Ga0307416_100350449
985 Ga0307416_101050268
986 Ga0307416_101419576
987 Ga0307416_103294229
988 Ga0307411_10144614
989 Ga0307411_10553952
990 Ga0307411_11255217
991 Ga0307411_12119056
992 Ga0307415_101573539
993 Ga0316583_10028308
994 Ga0373930_0085815
995 Ga0373950_0111715
996 Ga0373958_0165682
997 Ga0373938_0072108
998 Ga0373929_0221352
999 Ga0373934_0017629
1000 Ga0373940_0042192
1001 Ga0373952_0013562
1002 Ga0373923_0272920
1003 Ga0373936_0266967
1004 Ga0373939_0129060
1005 Ga0373941_0135892
1006 Ga0373953_0087914
1007 Ga0373953_0141110
1008 Ga0373954_0000055
1009 Ga0373956_0148906
1010 Ga0373956_0517980
1011 Ga0373957_0005549
1012 Ga0373955_0000731
1013 Ga0373955_0178911
1014 Ga0373955_0197689
1015 Ga0373942_0002470
1016 Ga0373942_0144659
1017 Ga0373942_0161505
1018 Ga0373961_0009521
1019 Ga0373961_0129043
1020 Ga0373961_0168321
1021 Ga0373962_0273099
1022 Ga0373924_0085947
1023 Ga0373931_0015441
1024 Ga0373931_0049776
1025 Ga0373931_1272490
1026 Ga0373935_0008593
1027 Ga0373935_0926474
1028 Ga0373927_0150266
1029 Ga0373927_0327055
1030 Ga0373933_0004744
1031 Ga0373933_0067797
1032 Ga0373933_0069434
1033 Ga0373933_0389136
1034 Ga0373947_0364462
1035 Ga0373947_0702339
1036 Ga0373937_0000131
1037 Ga0373937_0003520
1038 Ga0373937_0072100
1039 Ga0373937_0143935
1040 Ga0373937_0287560
1041 Ga0373937_0585400
1042 Ga0373937_1361489
1043 Ga0316582_0002625
1044 Ga0373925_0026437
1045 Ga0373925_0657418
1046 Ga0373925_1467188
1047 Ga0395905_0577839
1048 Ga0316581_0010446
1049 Ga0436360_0608163
1050 Ga0439436_0164391
1051 Ga0439453_0000441
1052 Ga0439461_0003417
1053 Ga0451807_2436605
1054 Ga0451839_0385018
1055 Ga0451849_0794106
1056 Ga0451851_1093402
1057 Ga0439431_0226509
1058 Ga0439441_012520
1059 Ga0439441_022679
1060 Ga0439441_036033
1061 Ga0439441_074889
1062 Ga0439443_000785
1063 Ga0450913_009054
1064 Ga0450923_187389
1065 Ga0450910_068328
1066 Ga0439446_0023875
1067 Ga0439446_0044819
1068 Ga0439458_0082962
1069 Ga0439434_0004987
1070 Ga0439434_0019513
1071 Ga0439434_0244440
1072 Ga0439435_0000013
1073 Ga0439435_0008638
1074 Ga0439444_0079757
1075 Ga0439459_0052719
1076 Ga0439459_0230774
1077 Ga0439464_0220828
1078 Ga0439460_0055750
1079 Ga0451577_1459273
1080 Ga0453683_0744399
1081 Ga0466964_0052400
1082 Ga0453684_2174305
1083 Ga0466960_0387641
1084 Ga0451576_0022948
1085 Ga0451576_0127617
1086 Ga0451576_0380952
1087 Ga0451576_0693317
1088 Ga0451576_0817411
1089 Ga0451576_1288699
1090 Ga0466958_0274864
1091 Ga0466967_0007982
1092 Ga0495592_0701292
1093 Ga0495629_0658931
1094 Ga0495641_0075700
1095 Ga0495651_0080330
1096 Ga0495662_0040235
1097 Ga0495664_0202758
1098 Ga0495608_0027505
1099 Ga0495608_0387581
1100 Ga0495618_0022504
1101 Ga0495618_0870783
1102 Ga0495628_0083822
1103 Ga0495628_0626027
1104 Ga0495666_0090531
1105 Ga0495642_0259657
1106 Ga0495642_0527445
1107 Ga0495652_0145762
1108 Ga0495652_0717486
1109 Ga0495652_1085180
1110 Ga0495640_0019880
1111 Ga0495640_0024984
1112 Ga0495586_0014573
1113 Ga0495586_0100269
1114 Ga0495587_0266561
1115 Ga0495587_0430626
1116 Ga0495598_0043562
1117 Ga0495598_0193944
1118 Ga0495598_0334308
1119 Ga0495621_0142280
1120 Ga0495645_0304454
1121 Ga0495667_0034202
1122 Ga0495667_0054686
1123 Ga0495667_0248962
1124 Ga0495656_0441147
1125 Ga0495634_0030050
1126 Ga0495635_0025308
1127 Ga0495635_0177139
1128 Ga0495635_0255647
1129 Ga0495657_0890222
1130 Ga0495599_0896441
1131 Ga0495623_0482863
1132 Ga0495658_0044201
1133 Ga0495658_1093409
1134 Ga0495669_0016911
1135 Ga0495669_0084926
1136 Ga0495669_0384676
1137 Ga0495613_0052482
1138 Ga0495624_0047197
1139 Ga0495624_0322381
1140 Ga0495670_0559178
1141 Ga0495600_0084400
1142 Ga0495581_0275174
1143 Ga0495581_0470570
1144 Ga0495604_0022663
1145 Ga0495604_0314912
1146 Ga0495636_0028364
1147 Ga0495636_0286433
1148 Ga0495680_0001327
1149 Ga0495680_0073628
1150 Ga0495675_0107280
1151 Ga0495677_0320508
1152 Ga0495684_0011273
1153 Ga0495602_0295384
1154 Ga0495602_1055122
1155 Ga0501296_037508
1156 Ga0501299_166193
1157 Ga0501301_032468
1158 Ga0501031_0190108
1159 Ga0501033_0472923
1160 Ga0501033_0643146
1161 Ga0501036_0080670
1162 Ga0501036_0699446
1163 Ga0501037_1069696
1164 Ga0501038_0090845
1165 Ga0501038_0172497
1166 Ga0501039_0027225
1167 Ga0501039_0210811
1168 Ga0501039_1483603
1169 Ga0501040_0008686
1170 Ga0501040_0015767
1171 Ga0501040_0736409
1172 Ga0501041_0004330
1173 Ga0501041_0114760
1174 Ga0501041_0264113
1175 Ga0501041_0767125
1176 Ga0501042_0098215
1177 Ga0501042_0792707
1178 Ga0501046_0054285
1179 Ga0501048_0008923
1180 Ga0501048_0061873
1181 Ga0501048_0559662
1182 Ga0501048_0779681
1183 Ga0501067_0451128
1184 Ga0501068_0035844
1185 Ga0501068_1159373
1186 Ga0501069_0174441
1187 Ga0501071_0004638
1188 Ga0501071_0046193
1189 Ga0501071_0508970
1190 Ga0501071_0724294
1191 Ga0501072_0004342
1192 Ga0501072_0369370
1193 Ga0501072_0445333
1194 Ga0501072_0453233
1195 Ga0501072_1323756
1196 Ga0501073_0161332
1197 Ga0501074_0161208
1198 Ga0501075_0002475
1199 Ga0501075_0045801
1200 Ga0501076_0001408
1201 Ga0501076_0093956
1202 Ga0501077_0038847
1203 Ga0501077_0431705
1204 Ga0501217_110842
1205 Ga0501223_103004
1206 Ga0501230_094648
1207 Ga0501233_111919
1208 Ga0501233_131575
1209 Ga0501236_024604
1210 Ga0501236_135741
1211 Ga0501221_208977
1212 Ga0501079_0007587
1213 Ga0501079_0136070
1214 Ga0501079_0541910
1215 Ga0501080_0003790
1216 Ga0501080_0542268
1217 Ga0501080_1008286
1218 Ga0501081_0003604
1219 Ga0501081_0217729
1220 Ga0501081_0803026
1221 Ga0501083_0063656
1222 Ga0501283_056246
1223 Ga0501035_0124992
1224 Ga0501035_0862645
1225 Ga0501035_0940153
1226 Ga0501044_1143824
1227 Ga0501045_0015134
1228 Ga0501045_0327595
1229 nmdc:mga05p37_1622771_c1
1230 nmdc:mga05p37_2000239_c1
1231 nmdc:mga05p37_229182_c1
1232 nmdc:mga05p37_653397_c1
1233 nmdc:mga05p37_9357_c1
1234 nmdc:mga05p37_996603_c1
1235 nmdc:mga09592_1053252_c1
1236 nmdc:mga09592_1256619_c1
1237 nmdc:mga09592_169255_c1
1238 nmdc:mga09592_21320_c1
1239 nmdc:mga09592_315_c1
1240 nmdc:mga09592_623430_c1
1241 nmdc:mga0qj67_11994_c1
1242 nmdc:mga0qj67_39720_c1
1243 nmdc:mga0qj67_59903_c1
1244 nmdc:mga06r32_10212_c1
1245 nmdc:mga06r32_19839_c1
1246 nmdc:mga06r32_216921_c1
1247 nmdc:mga06r32_275866_c1
1248 nmdc:mga06r32_376974_c1
1249 nmdc:mga06r32_659519_c1
1250 nmdc:mga06r32_660157_c1
1251 nmdc:mga08y16_14446_c1
1252 nmdc:mga08y16_1730777_c1
1253 nmdc:mga08y16_250597_c1
1254 nmdc:mga08y16_295278_c1
1255 nmdc:mga08y16_76782_c1
1256 nmdc:mga0n895_11520_c1
1257 nmdc:mga0n895_190564_c1
1258 nmdc:mga0n895_5209_c1
1259 nmdc:mga0rr50_1570665_c1
1260 nmdc:mga0rr50_482213_c1
1261 nmdc:mga0rr50_48384_c1
1262 nmdc:mga0rr50_491055_c1
1263 nmdc:mga08x19_1081799_c1
1264 nmdc:mga08x19_1182_c1
1265 nmdc:mga08x19_27614_c1
1266 nmdc:mga08x19_38172_c1
1267 nmdc:mga08x19_91248_c1
1268 nmdc:mga0a205_1121832_c1
1269 nmdc:mga0a205_15396_c1
1270 nmdc:mga0a205_3868_c1
1271 nmdc:mga0a205_465006_c1
1272 nmdc:mga0a205_573927_c1
1273 Ga0495601_0007663
1274 Ga0495601_0104644
1275 Ga0495619_0073794
1276 Ga0500566_0214412
1277 Ga0501084_0032289
1278 Ga0501082_0014909
1279 Ga0501082_0199439
1280 Ga0530510_0003476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

26

135

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7su8-assembly1.cif.gz_A-5 dihydroneopterin aldolase (dhna) from yersinia pestis with alkylated cys50 co-crystallized with 7,8-dihydroneopterin 0.8701 1 114
7su8-assembly1.cif.gz_B dihydroneopterin aldolase (dhna) from yersinia pestis with alkylated cys50 co-crystallized with 7,8-dihydroneopterin 0.8612 1 116
7su6-assembly1.cif.gz_B-2 dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.8592 1 117
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.859 1 115
7su7-assembly1.cif.gz_D dihydroneopterin aldolase (dhna) from yersinia pestis co-crystallized with product 0.8574 1 116
ID Description Score Start End Superfamily
af_Q54YD9_1_116_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8771 1 116 3.30.1130.10
af_Q54YD9_1_116_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8702 1 116 3.30.1130.10
af_A0A1D8PN03_132_240_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.853 2 115 3.30.1130.10
af_P53848_20_135_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.851 2 112 3.30.1130.10
2o9mC00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8468 1 115 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A2E9Z822-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8732 1 115 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A521TTT9-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8723 2 117 GO:0004150
GO:0016491
GO:0046654
GO:0046656
AF-A0A525JQX7-F1-model_v4 dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) 0.8722 2 115 GO:0004150
GO:0005737
GO:0046656
AF-A0A2A2Y0V8-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8709 1 117 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A2E7BU23-F1-model_v4 dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) 0.8704 2 117 GO:0004150
GO:0005737
GO:0046656

Map