F471692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 276 | 640 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300025922|Ga0207646_11097359|Ga0207646_110973592 |
| Length | 114 |
| Sequence | MKEIAGFDAALPQFEAAGAQVVGVSADHQKTLEAFAKQTGTKHLLLSDFRSPRQMLPQYDAMVTDEKSPIFRYAKRAYFIIDKQGTVRYVKIMDNPLNLLDANEVLAELKKVTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 210 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 211 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 212 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 213 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 214 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 215 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 216 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 217 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.78 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 98.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1045726 | 3300001915 | Bacteria | 644 |
| 2 | rootL2_10186341 | 3300003322 | Bacteria | 1987 |
| 3 | JGI25407J50210_10146549 | 3300003373 | Bacteria | 581 |
| 4 | JGI25405J52794_10018580 | 3300003911 | Unclassified | 1388 |
| 5 | Ga0058863_11697093 | 3300004799 | Unclassified | 593 |
| 6 | Ga0058862_12575548 | 3300004803 | Bacteria | 1357 |
| 7 | Ga0065712_10311569 | 3300005290 | Bacteria | 843 |
| 8 | Ga0065715_10308892 | 3300005293 | Bacteria | 1025 |
| 9 | Ga0065707_10817523 | 3300005295 | Bacteria | 593 |
| 10 | Ga0070676_10000771 | 3300005328 | Bacteria | 15771 |
| 11 | Ga0070683_100101507 | 3300005329 | Bacteria | 2709 |
| 12 | Ga0070690_100436828 | 3300005330 | Bacteria | 968 |
| 13 | Ga0068869_100000503 | 3300005334 | Bacteria | 21804 |
| 14 | Ga0070666_10135337 | 3300005335 | Bacteria | 1714 |
| 15 | Ga0070666_11412568 | 3300005335 | Bacteria | 520 |
| 16 | Ga0070680_100002337 | 3300005336 | Bacteria | 14007 |
| 17 | Ga0070680_100107633 | 3300005336 | Bacteria | 2319 |
| 18 | Ga0070680_100302435 | 3300005336 | Unclassified | 1357 |
| 19 | Ga0070682_100000182 | 3300005337 | Bacteria | 47152 |
| 20 | Ga0068868_100009025 | 3300005338 | Bacteria | 7156 |
| 21 | Ga0070660_100002694 | 3300005339 | Bacteria | 12201 |
| 22 | Ga0070689_100017569 | 3300005340 | Bacteria | 5258 |
| 23 | Ga0070689_100091848 | 3300005340 | Bacteria | 2394 |
| 24 | Ga0070689_100615708 | 3300005340 | Bacteria | 942 |
| 25 | Ga0070691_10003395 | 3300005341 | Bacteria | 7162 |
| 26 | Ga0070691_10011353 | 3300005341 | Bacteria | 4067 |
| 27 | Ga0070691_10014611 | 3300005341 | Bacteria | 3604 |
| 28 | Ga0070691_10656923 | 3300005341 | Archaea | 625 |
| 29 | Ga0070687_100322871 | 3300005343 | Bacteria | 987 |
| 30 | Ga0070661_100000280 | 3300005344 | Bacteria | 41161 |
| 31 | Ga0070692_10001685 | 3300005345 | Bacteria | 8184 |
| 32 | Ga0070668_100400242 | 3300005347 | Bacteria | 1172 |
| 33 | Ga0070668_100668191 | 3300005347 | Bacteria | 914 |
| 34 | Ga0070669_100011809 | 3300005353 | Bacteria | 6196 |
| 35 | Ga0070669_100187063 | 3300005353 | Unclassified | 1623 |
| 36 | Ga0070669_101521708 | 3300005353 | Bacteria | 582 |
| 37 | Ga0070674_101545962 | 3300005356 | Unclassified | 597 |
| 38 | Ga0070659_100000500 | 3300005366 | Bacteria | 28860 |
| 39 | Ga0070667_100184281 | 3300005367 | Bacteria | 1847 |
| 40 | Ga0070703_10002816 | 3300005406 | Bacteria | 4982 |
| 41 | Ga0070703_10038737 | 3300005406 | Bacteria | 1475 |
| 42 | Ga0070709_10027601 | 3300005434 | Bacteria | 3377 |
| 43 | Ga0070713_100935715 | 3300005436 | Unclassified | 834 |
| 44 | Ga0070701_10084605 | 3300005438 | Bacteria | 1725 |
| 45 | Ga0070701_10138385 | 3300005438 | Bacteria | 1390 |
| 46 | Ga0070701_11010048 | 3300005438 | Bacteria | 581 |
| 47 | Ga0070705_100001910 | 3300005440 | Bacteria | 10703 |
| 48 | Ga0070705_100321719 | 3300005440 | Unclassified | 1117 |
| 49 | Ga0070705_100344756 | 3300005440 | Unclassified | 1084 |
| 50 | Ga0070705_100840538 | 3300005440 | Bacteria | 734 |
| 51 | Ga0070700_100264836 | 3300005441 | Bacteria | 1239 |
| 52 | Ga0070694_100002581 | 3300005444 | Bacteria | 10702 |
| 53 | Ga0070694_100010952 | 3300005444 | Bacteria | 5609 |
| 54 | Ga0070694_100034533 | 3300005444 | Bacteria | 3336 |
| 55 | Ga0070694_100064642 | 3300005444 | Bacteria | 2505 |
| 56 | Ga0070694_100170521 | 3300005444 | Bacteria | 1603 |
| 57 | Ga0070694_100289714 | 3300005444 | Unclassified | 1251 |
| 58 | Ga0070694_101589304 | 3300005444 | Archaea | 555 |
| 59 | Ga0070708_100175955 | 3300005445 | Bacteria | 1999 |
| 60 | Ga0070708_100245107 | 3300005445 | Bacteria | 1683 |
| 61 | Ga0070708_100300784 | 3300005445 | Bacteria | 1511 |
| 62 | Ga0070708_100340385 | 3300005445 | Bacteria | 1414 |
| 63 | Ga0070708_100360436 | 3300005445 | Bacteria | 1370 |
| 64 | Ga0070708_101214336 | 3300005445 | Unclassified | 705 |
| 65 | Ga0070708_101318679 | 3300005445 | Unclassified | 674 |
| 66 | Ga0070663_100001673 | 3300005455 | Bacteria | 12284 |
| 67 | Ga0070663_100295907 | 3300005455 | Unclassified | 1294 |
| 68 | Ga0070662_100001013 | 3300005457 | Bacteria | 17181 |
| 69 | Ga0070662_100025074 | 3300005457 | Unclassified | 4115 |
| 70 | Ga0070662_100213792 | 3300005457 | Bacteria | 1536 |
| 71 | Ga0070681_10027811 | 3300005458 | Bacteria | 5686 |
| 72 | Ga0070681_10161622 | 3300005458 | Bacteria | 2164 |
| 73 | Ga0070681_10675929 | 3300005458 | Bacteria | 948 |
| 74 | Ga0068867_100045002 | 3300005459 | Bacteria | 3235 |
| 75 | Ga0068867_100197973 | 3300005459 | Bacteria | 1607 |
| 76 | Ga0070706_100005525 | 3300005467 | Bacteria | 12032 |
| 77 | Ga0070706_100080671 | 3300005467 | Bacteria | 3013 |
| 78 | Ga0070706_100242845 | 3300005467 | Bacteria | 1681 |
| 79 | Ga0070706_100902339 | 3300005467 | Bacteria | 816 |
| 80 | Ga0070707_100023916 | 3300005468 | Bacteria | 5779 |
| 81 | Ga0070707_100112317 | 3300005468 | Bacteria | 2643 |
| 82 | Ga0070707_100327546 | 3300005468 | Bacteria | 1488 |
| 83 | Ga0070707_100365081 | 3300005468 | Bacteria | 1403 |
| 84 | Ga0070707_100890467 | 3300005468 | Bacteria | 854 |
| 85 | Ga0070698_100011493 | 3300005471 | Bacteria | 9394 |
| 86 | Ga0070698_100058520 | 3300005471 | Bacteria | 3896 |
| 87 | Ga0070698_100079769 | 3300005471 | Bacteria | 3269 |
| 88 | Ga0070698_100479027 | 3300005471 | Bacteria | 1181 |
| 89 | Ga0070698_100982987 | 3300005471 | Unclassified | 791 |
| 90 | Ga0070698_101864560 | 3300005471 | Bacteria | 554 |
| 91 | Ga0070699_100007156 | 3300005518 | Bacteria | 9695 |
| 92 | Ga0070699_100011450 | 3300005518 | Bacteria | 7659 |
| 93 | Ga0070699_100018159 | 3300005518 | Bacteria | 6043 |
| 94 | Ga0070699_100051526 | 3300005518 | Plasmid | 3563 |
| 95 | Ga0070699_100130602 | 3300005518 | Bacteria | 2214 |
| 96 | Ga0070679_100014766 | 3300005530 | Bacteria | 7505 |
| 97 | Ga0070679_101873072 | 3300005530 | Archaea | 548 |
| 98 | Ga0070684_100441758 | 3300005535 | Bacteria | 1202 |
| 99 | Ga0070697_100004998 | 3300005536 | Bacteria | 10183 |
| 100 | Ga0070697_100090247 | 3300005536 | Bacteria | 2532 |
| 101 | Ga0070697_100232861 | 3300005536 | Bacteria | 1571 |
| 102 | Ga0070697_100542108 | 3300005536 | Bacteria | 1020 |
| 103 | Ga0070697_100782531 | 3300005536 | Unclassified | 844 |
| 104 | Ga0068853_100000088 | 3300005539 | Bacteria | 63120 |
| 105 | Ga0070672_100042006 | 3300005543 | Bacteria | 3519 |
| 106 | Ga0070672_100368512 | 3300005543 | Bacteria | 1227 |
| 107 | Ga0070686_100333331 | 3300005544 | Unclassified | 1135 |
| 108 | Ga0070686_101703159 | 3300005544 | Bacteria | 535 |
| 109 | Ga0070695_100000261 | 3300005545 | Bacteria | 26461 |
| 110 | Ga0070695_100000723 | 3300005545 | Bacteria | 17621 |
| 111 | Ga0070695_100022342 | 3300005545 | Bacteria | 3880 |
| 112 | Ga0070695_100050654 | 3300005545 | Bacteria | 2662 |
| 113 | Ga0070695_100191756 | 3300005545 | Bacteria | 1455 |
| 114 | Ga0070696_100052049 | 3300005546 | Bacteria | 2848 |
| 115 | Ga0070696_100347062 | 3300005546 | Bacteria | 1149 |
| 116 | Ga0070696_100400310 | 3300005546 | Bacteria | 1074 |
| 117 | Ga0070696_100987532 | 3300005546 | Unclassified | 703 |
| 118 | Ga0070693_100000207 | 3300005547 | Bacteria | 27302 |
| 119 | Ga0070693_100216313 | 3300005547 | Unclassified | 1253 |
| 120 | Ga0070704_100000505 | 3300005549 | Bacteria | 18545 |
| 121 | Ga0070704_100022237 | 3300005549 | Bacteria | 4124 |
| 122 | Ga0070704_100066790 | 3300005549 | Bacteria | 2595 |
| 123 | Ga0070704_100220530 | 3300005549 | Bacteria | 1542 |
| 124 | Ga0068855_100001473 | 3300005563 | Bacteria | 29428 |
| 125 | Ga0068855_102526520 | 3300005563 | Unclassified | 511 |
| 126 | Ga0070664_100018282 | 3300005564 | Bacteria | 5754 |
| 127 | Ga0068857_100098711 | 3300005577 | Bacteria | 2619 |
| 128 | Ga0068854_100020336 | 3300005578 | Bacteria | 4489 |
| 129 | Ga0068854_100696799 | 3300005578 | Unclassified | 876 |
| 130 | Ga0068856_100000796 | 3300005614 | Bacteria | 33989 |
| 131 | Ga0070702_100001713 | 3300005615 | Bacteria | 9107 |
| 132 | Ga0070702_100111610 | 3300005615 | Bacteria | 1696 |
| 133 | Ga0068859_100000533 | 3300005617 | Bacteria | 37712 |
| 134 | Ga0068859_100296622 | 3300005617 | Bacteria | 1710 |
| 135 | Ga0068864_100008591 | 3300005618 | Bacteria | 8428 |
| 136 | Ga0068866_10105550 | 3300005718 | Bacteria | 1562 |
| 137 | Ga0068861_100041115 | 3300005719 | Bacteria | 3462 |
| 138 | Ga0068861_100129209 | 3300005719 | Bacteria | 2049 |
| 139 | Ga0068861_100269298 | 3300005719 | Unclassified | 1462 |
| 140 | Ga0068851_10806425 | 3300005834 | Unclassified | 583 |
| 141 | Ga0068870_10000609 | 3300005840 | Bacteria | 13615 |
| 142 | Ga0068863_100031766 | 3300005841 | Bacteria | 5038 |
| 143 | Ga0068863_100273000 | 3300005841 | Bacteria | 1637 |
| 144 | Ga0068858_100037627 | 3300005842 | Bacteria | 4488 |
| 145 | Ga0068860_100011455 | 3300005843 | Bacteria | 8737 |
| 146 | Ga0068860_100050252 | 3300005843 | Bacteria | 3969 |
| 147 | Ga0068862_100000415 | 3300005844 | Bacteria | 46252 |
| 148 | Ga0068862_100039297 | 3300005844 | Bacteria | 4018 |
| 149 | Ga0068862_100677874 | 3300005844 | Bacteria | 997 |
| 150 | Ga0081455_10000749 | 3300005937 | Bacteria | 42221 |
| 151 | Ga0081455_10910639 | 3300005937 | Unclassified | 547 |
| 152 | Ga0081538_10008698 | 3300005981 | Bacteria | 8575 |
| 153 | Ga0081539_10169170 | 3300005985 | Bacteria | 1035 |
| 154 | Ga0075432_10008791 | 3300006058 | Bacteria | 3447 |
| 155 | Ga0070716_100017412 | 3300006173 | Bacteria | 3725 |
| 156 | Ga0097621_100731401 | 3300006237 | Bacteria | 913 |
| 157 | Ga0068871_100307538 | 3300006358 | Bacteria | 1393 |
| 158 | Ga0075428_100023993 | 3300006844 | Bacteria | 6750 |
| 159 | Ga0075428_100050379 | 3300006844 | Bacteria | 4567 |
| 160 | Ga0075428_100258161 | 3300006844 | Bacteria | 1877 |
| 161 | Ga0075430_100000250 | 3300006846 | Bacteria | 37273 |
| 162 | Ga0075430_100014450 | 3300006846 | Bacteria | 6724 |
| 163 | Ga0075430_100102207 | 3300006846 | Bacteria | 2393 |
| 164 | Ga0075430_100286412 | 3300006846 | Bacteria | 1363 |
| 165 | Ga0075431_100011427 | 3300006847 | Bacteria | 8948 |
| 166 | Ga0075431_100049431 | 3300006847 | Bacteria | 4335 |
| 167 | Ga0075431_101438124 | 3300006847 | Bacteria | 649 |
| 168 | Ga0075433_10006756 | 3300006852 | Bacteria | 9092 |
| 169 | Ga0075433_10008839 | 3300006852 | Bacteria | 8037 |
| 170 | Ga0075433_10023064 | 3300006852 | Bacteria | 5234 |
| 171 | Ga0075433_10023417 | 3300006852 | Bacteria | 5198 |
| 172 | Ga0075433_10043963 | 3300006852 | Bacteria | 3879 |
| 173 | Ga0075433_10122590 | 3300006852 | Bacteria | 2308 |
| 174 | Ga0075433_10141181 | 3300006852 | Unclassified | 2141 |
| 175 | Ga0075433_10433255 | 3300006852 | Unclassified | 1159 |
| 176 | Ga0075433_10490265 | 3300006852 | Unclassified | 1082 |
| 177 | Ga0075433_10535948 | 3300006852 | Bacteria | 1029 |
| 178 | Ga0075433_11321572 | 3300006852 | Unclassified | 624 |
| 179 | Ga0075434_100009040 | 3300006871 | Bacteria | 9281 |
| 180 | Ga0075434_100019339 | 3300006871 | Bacteria | 6590 |
| 181 | Ga0075434_100058926 | 3300006871 | Bacteria | 3817 |
| 182 | Ga0075434_100095766 | 3300006871 | Unclassified | 2973 |
| 183 | Ga0075434_100104676 | 3300006871 | Bacteria | 2839 |
| 184 | Ga0075434_100249441 | 3300006871 | Bacteria | 1794 |
| 185 | Ga0075429_100000021 | 3300006880 | Bacteria | 69066 |
| 186 | Ga0075429_100016408 | 3300006880 | Bacteria | 6421 |
| 187 | Ga0075429_100141438 | 3300006880 | Unclassified | 2106 |
| 188 | Ga0075429_101906050 | 3300006880 | Unclassified | 515 |
| 189 | Ga0068865_100062083 | 3300006881 | Bacteria | 2622 |
| 190 | Ga0068865_100367380 | 3300006881 | Bacteria | 1170 |
| 191 | Ga0068865_100462566 | 3300006881 | Bacteria | 1051 |
| 192 | Ga0075436_100036175 | 3300006914 | Bacteria | 3407 |
| 193 | Ga0075436_100061886 | 3300006914 | Bacteria | 2586 |
| 194 | Ga0075436_101036060 | 3300006914 | Bacteria | 616 |
| 195 | Ga0075436_101056007 | 3300006914 | Bacteria | 611 |
| 196 | Ga0097620_100000533 | 3300006931 | Bacteria | 37712 |
| 197 | Ga0097620_100296619 | 3300006931 | Bacteria | 1710 |
| 198 | Ga0075435_100031805 | 3300007076 | Bacteria | 4162 |
| 199 | Ga0075435_100068902 | 3300007076 | Bacteria | 2883 |
| 200 | Ga0075435_100108032 | 3300007076 | Bacteria | 2311 |
| 201 | Ga0075435_100109569 | 3300007076 | Bacteria | 2295 |
| 202 | Ga0075435_100496762 | 3300007076 | Unclassified | 1055 |
| 203 | Ga0099794_10000503 | 3300007265 | Bacteria | 13101 |
| 204 | Ga0099794_10450255 | 3300007265 | Unclassified | 675 |
| 205 | Ga0099794_10651642 | 3300007265 | Unclassified | 559 |
| 206 | Ga0105240_11886622 | 3300009093 | Unclassified | 622 |
| 207 | Ga0111539_10000098 | 3300009094 | Bacteria | 91568 |
| 208 | Ga0111539_10000182 | 3300009094 | Bacteria | 73143 |
| 209 | Ga0111539_10019865 | 3300009094 | Bacteria | 8277 |
| 210 | Ga0111539_10328383 | 3300009094 | Bacteria | 1780 |
| 211 | Ga0114129_10000002 | 3300009147 | Bacteria | 204413 |
| 212 | Ga0114129_10034596 | 3300009147 | Bacteria | 7137 |
| 213 | Ga0114129_10089569 | 3300009147 | Bacteria | 4265 |
| 214 | Ga0114129_10155118 | 3300009147 | Bacteria | 3132 |
| 215 | Ga0114129_10293575 | 3300009147 | Bacteria | 2169 |
| 216 | Ga0114129_10439398 | 3300009147 | Bacteria | 1713 |
| 217 | Ga0114129_10472727 | 3300009147 | Bacteria | 1641 |
| 218 | Ga0114129_10497236 | 3300009147 | Unclassified | 1593 |
| 219 | Ga0114129_10567988 | 3300009147 | Unclassified | 1473 |
| 220 | Ga0114129_10818763 | 3300009147 | Bacteria | 1186 |
| 221 | Ga0114129_12066203 | 3300009147 | Bacteria | 688 |
| 222 | Ga0105243_10449421 | 3300009148 | Bacteria | 1209 |
| 223 | Ga0105243_10600707 | 3300009148 | Bacteria | 1059 |
| 224 | Ga0105243_10746520 | 3300009148 | Bacteria | 959 |
| 225 | Ga0105243_11431357 | 3300009148 | Bacteria | 713 |
| 226 | Ga0105241_10002948 | 3300009174 | Bacteria | 12706 |
| 227 | Ga0105241_10182826 | 3300009174 | Bacteria | 1740 |
| 228 | Ga0105241_11713727 | 3300009174 | Bacteria | 611 |
| 229 | Ga0105242_10114856 | 3300009176 | Bacteria | 2301 |
| 230 | Ga0105248_10307270 | 3300009177 | Bacteria | 1786 |
| 231 | Ga0105237_10193261 | 3300009545 | Bacteria | 2035 |
| 232 | Ga0105249_10502832 | 3300009553 | Bacteria | 1257 |
| 233 | Ga0105249_10550525 | 3300009553 | Unclassified | 1204 |
| 234 | Ga0105249_12354112 | 3300009553 | Bacteria | 605 |
| 235 | Ga0105239_10058392 | 3300010375 | Bacteria | 4233 |
| 236 | Ga0105246_10016340 | 3300011119 | Bacteria | 4699 |
| 237 | Ga0157373_10000176 | 3300013100 | Bacteria | 52378 |
| 238 | Ga0157371_10059205 | 3300013102 | Bacteria | 2715 |
| 239 | Ga0157371_10507006 | 3300013102 | Unclassified | 891 |
| 240 | Ga0157369_10021645 | 3300013105 | Bacteria | 7191 |
| 241 | Ga0157378_10158786 | 3300013297 | Bacteria | 2113 |
| 242 | Ga0163162_10081405 | 3300013306 | Bacteria | 3309 |
| 243 | Ga0163162_11754107 | 3300013306 | Bacteria | 709 |
| 244 | Ga0163162_11956855 | 3300013306 | Bacteria | 671 |
| 245 | Ga0157372_10005276 | 3300013307 | Bacteria | 13714 |
| 246 | Ga0157372_11177881 | 3300013307 | Unclassified | 886 |
| 247 | Ga0157375_10017503 | 3300013308 | Bacteria | 6469 |
| 248 | Ga0157375_10054737 | 3300013308 | Bacteria | 3931 |
| 249 | Ga0163163_10133543 | 3300014325 | Bacteria | 2522 |
| 250 | Ga0157380_11152131 | 3300014326 | Unclassified | 817 |
| 251 | Ga0157377_10620035 | 3300014745 | Bacteria | 774 |
| 252 | Ga0182007_10030110 | 3300015262 | Bacteria | 1856 |
| 253 | Ga0163161_10269119 | 3300017792 | Unclassified | 1333 |
| 254 | Ga0206354_11134721 | 3300020081 | Bacteria | 700 |
| 255 | Ga0206353_10370831 | 3300020082 | Bacteria | 1141 |
| 256 | Ga0207656_10623616 | 3300025321 | Unclassified | 551 |
| 257 | Ga0207653_10043055 | 3300025885 | Bacteria | 1486 |
| 258 | Ga0207653_10186329 | 3300025885 | Bacteria | 778 |
| 259 | Ga0207642_10488371 | 3300025899 | Bacteria | 752 |
| 260 | Ga0207688_10032458 | 3300025901 | Bacteria | 2886 |
| 261 | Ga0207647_10321303 | 3300025904 | Bacteria | 879 |
| 262 | Ga0207685_10104491 | 3300025905 | Bacteria | 1217 |
| 263 | Ga0207699_10188239 | 3300025906 | Bacteria | 1391 |
| 264 | Ga0207699_10862459 | 3300025906 | Bacteria | 667 |
| 265 | Ga0207645_10000232 | 3300025907 | Bacteria | 46199 |
| 266 | Ga0207643_10000871 | 3300025908 | Bacteria | 18190 |
| 267 | Ga0207684_10009619 | 3300025910 | Bacteria | 8527 |
| 268 | Ga0207684_10015909 | 3300025910 | Bacteria | 6465 |
| 269 | Ga0207684_10177738 | 3300025910 | Bacteria | 1835 |
| 270 | Ga0207684_10218659 | 3300025910 | Bacteria | 1644 |
| 271 | Ga0207684_10265128 | 3300025910 | Bacteria | 1482 |
| 272 | Ga0207684_11746787 | 3300025910 | Bacteria | 500 |
| 273 | Ga0207654_10010714 | 3300025911 | Bacteria | 4669 |
| 274 | Ga0207654_10687303 | 3300025911 | Unclassified | 734 |
| 275 | Ga0207654_10698190 | 3300025911 | Bacteria | 729 |
| 276 | Ga0207707_10000076 | 3300025912 | Bacteria | 100491 |
| 277 | Ga0207707_10161541 | 3300025912 | Bacteria | 1958 |
| 278 | Ga0207693_10095474 | 3300025915 | Bacteria | 2331 |
| 279 | Ga0207660_10000514 | 3300025917 | Bacteria | 25852 |
| 280 | Ga0207660_10008444 | 3300025917 | Bacteria | 6661 |
| 281 | Ga0207660_10506773 | 3300025917 | Bacteria | 979 |
| 282 | Ga0207662_10522351 | 3300025918 | Unclassified | 819 |
| 283 | Ga0207657_10000005 | 3300025919 | Bacteria | 213481 |
| 284 | Ga0207649_10057555 | 3300025920 | Bacteria | 2431 |
| 285 | Ga0207652_10000060 | 3300025921 | Bacteria | 113511 |
| 286 | Ga0207646_10013579 | 3300025922 | Bacteria | 7779 |
| 287 | Ga0207646_10020969 | 3300025922 | Bacteria | 6044 |
| 288 | Ga0207646_10023404 | 3300025922 | Bacteria | 5674 |
| 289 | Ga0207646_10038020 | 3300025922 | Bacteria | 4338 |
| 290 | Ga0207646_10046542 | 3300025922 | Bacteria | 3891 |
| 291 | Ga0207646_10078974 | 3300025922 | Bacteria | 2942 |
| 292 | Ga0207646_10489712 | 3300025922 | Bacteria | 1108 |
| 293 | Ga0207646_11097359 | 3300025922 | Unclassified | 700 |
| 294 | Ga0207681_10265938 | 3300025923 | Unclassified | 1344 |
| 295 | Ga0207681_10382542 | 3300025923 | Bacteria | 1133 |
| 296 | Ga0207681_10946738 | 3300025923 | Bacteria | 722 |
| 297 | Ga0207650_10192383 | 3300025925 | Bacteria | 1630 |
| 298 | Ga0207700_11704484 | 3300025928 | Unclassified | 556 |
| 299 | Ga0207690_10241596 | 3300025932 | Bacteria | 1391 |
| 300 | Ga0207706_10003272 | 3300025933 | Bacteria | 15500 |
| 301 | Ga0207706_10037858 | 3300025933 | Bacteria | 4281 |
| 302 | Ga0207706_10267976 | 3300025933 | Bacteria | 1491 |
| 303 | Ga0207686_10036416 | 3300025934 | Bacteria | 2962 |
| 304 | Ga0207709_10145565 | 3300025935 | Bacteria | 1634 |
| 305 | Ga0207709_10293352 | 3300025935 | Bacteria | 1206 |
| 306 | Ga0207709_10769509 | 3300025935 | Bacteria | 775 |
| 307 | Ga0207670_10007115 | 3300025936 | Bacteria | 6233 |
| 308 | Ga0207670_10033481 | 3300025936 | Bacteria | 3312 |
| 309 | Ga0207670_10896146 | 3300025936 | Bacteria | 743 |
| 310 | Ga0207669_11349606 | 3300025937 | Bacteria | 606 |
| 311 | Ga0207704_10388106 | 3300025938 | Bacteria | 1098 |
| 312 | Ga0207704_10413570 | 3300025938 | Bacteria | 1067 |
| 313 | Ga0207665_10000907 | 3300025939 | Bacteria | 19964 |
| 314 | Ga0207691_10068537 | 3300025940 | Bacteria | 3205 |
| 315 | Ga0207711_10421515 | 3300025941 | Bacteria | 1241 |
| 316 | Ga0207689_10000423 | 3300025942 | Bacteria | 39658 |
| 317 | Ga0207689_10760819 | 3300025942 | Unclassified | 817 |
| 318 | Ga0207661_10347104 | 3300025944 | Bacteria | 1338 |
| 319 | Ga0207679_10000231 | 3300025945 | Bacteria | 43268 |
| 320 | Ga0207667_10001202 | 3300025949 | Bacteria | 32395 |
| 321 | Ga0207651_11254030 | 3300025960 | Unclassified | 666 |
| 322 | Ga0207712_10462006 | 3300025961 | Unclassified | 1078 |
| 323 | Ga0207668_10379177 | 3300025972 | Bacteria | 1190 |
| 324 | Ga0207668_10652483 | 3300025972 | Bacteria | 921 |
| 325 | Ga0207668_11819157 | 3300025972 | Unclassified | 549 |
| 326 | Ga0207640_10022458 | 3300025981 | Bacteria | 3777 |
| 327 | Ga0207658_10814074 | 3300025986 | Bacteria | 848 |
| 328 | Ga0207677_10119935 | 3300026023 | Bacteria | 1976 |
| 329 | Ga0207703_10027052 | 3300026035 | Bacteria | 4518 |
| 330 | Ga0207639_10000571 | 3300026041 | Bacteria | 25417 |
| 331 | Ga0207678_10005780 | 3300026067 | Bacteria | 11029 |
| 332 | Ga0207708_10174817 | 3300026075 | Bacteria | 1702 |
| 333 | Ga0207702_10000576 | 3300026078 | Bacteria | 40802 |
| 334 | Ga0207641_10274759 | 3300026088 | Bacteria | 1582 |
| 335 | Ga0207648_10000565 | 3300026089 | Bacteria | 41535 |
| 336 | Ga0207648_10148077 | 3300026089 | Bacteria | 2071 |
| 337 | Ga0207676_10065966 | 3300026095 | Bacteria | 2884 |
| 338 | Ga0207674_10001421 | 3300026116 | Bacteria | 30917 |
| 339 | Ga0207674_10416390 | 3300026116 | Bacteria | 1298 |
| 340 | Ga0207675_100000795 | 3300026118 | Bacteria | 31348 |
| 341 | Ga0207675_100381262 | 3300026118 | Unclassified | 1386 |
| 342 | Ga0209969_1007467 | 3300027360 | Bacteria | 1545 |
| 343 | Ga0209981_1008124 | 3300027378 | Bacteria | 1422 |
| 344 | Ga0209996_1010954 | 3300027395 | Bacteria | 1208 |
| 345 | Ga0209984_1025367 | 3300027424 | Bacteria | 825 |
| 346 | Ga0210000_1030615 | 3300027462 | Bacteria | 841 |
| 347 | Ga0209995_1006412 | 3300027471 | Bacteria | 1891 |
| 348 | Ga0209968_1004063 | 3300027526 | Bacteria | 2197 |
| 349 | Ga0209982_1003255 | 3300027552 | Bacteria | 2300 |
| 350 | Ga0209970_1003842 | 3300027614 | Bacteria | 2510 |
| 351 | Ga0210002_1007517 | 3300027617 | Unclassified | 1653 |
| 352 | Ga0209983_1000319 | 3300027665 | Bacteria | 10106 |
| 353 | Ga0209588_1001293 | 3300027671 | Bacteria | 6501 |
| 354 | Ga0209971_1000016 | 3300027682 | Bacteria | 65564 |
| 355 | Ga0209966_1000083 | 3300027695 | Bacteria | 41039 |
| 356 | Ga0209998_10000186 | 3300027717 | Bacteria | 22054 |
| 357 | Ga0209974_10010451 | 3300027876 | Bacteria | 3132 |
| 358 | Ga0207428_11252088 | 3300027907 | Unclassified | 515 |
| 359 | Ga0268265_10024557 | 3300028380 | Bacteria | 4265 |
| 360 | Ga0268264_10630298 | 3300028381 | Bacteria | 1059 |
| 361 | Ga0268264_10664707 | 3300028381 | Unclassified | 1032 |
| 362 | Ga0307408_100019353 | 3300031548 | Bacteria | 4583 |
| 363 | Ga0307408_100598345 | 3300031548 | Bacteria | 979 |
| 364 | Ga0307408_100608332 | 3300031548 | Bacteria | 972 |
| 365 | Ga0307408_101157323 | 3300031548 | Bacteria | 720 |
| 366 | Ga0307405_10068590 | 3300031731 | Bacteria | 2270 |
| 367 | Ga0307405_10457013 | 3300031731 | Bacteria | 1014 |
| 368 | Ga0307413_11010410 | 3300031824 | Bacteria | 713 |
| 369 | Ga0307412_10079111 | 3300031911 | Bacteria | 2267 |
| 370 | Ga0307409_100201694 | 3300031995 | Bacteria | 1780 |
| 371 | Ga0307416_100120640 | 3300032002 | Bacteria | 2335 |
| 372 | Ga0307411_12236046 | 3300032005 | Bacteria | 513 |
| 373 | Ga0307415_100255359 | 3300032126 | Bacteria | 1427 |
| 374 | Ga0373948_0078945 | 3300034817 | Bacteria | 748 |
| 375 | Ga0373948_0191570 | 3300034817 | Bacteria | 529 |
| 376 | Ga0373959_0018418 | 3300034820 | Bacteria | 1313 |
| 377 | Ga0373926_0369777 | 3300035083 | Bacteria | 564 |
| 378 | Ga0373940_0020189 | 3300035088 | Bacteria | 1690 |
| 379 | Ga0373940_0064400 | 3300035088 | Bacteria | 1055 |
| 380 | Ga0373949_0027963 | 3300035090 | Bacteria | 1329 |
| 381 | Ga0373951_0003783 | 3300035091 | Bacteria | 3646 |
| 382 | Ga0373932_0024625 | 3300035112 | Bacteria | 1622 |
| 383 | Ga0373932_0042632 | 3300035112 | Bacteria | 1317 |
| 384 | Ga0373932_0221219 | 3300035112 | Bacteria | 680 |
| 385 | Ga0373941_0008250 | 3300035115 | Bacteria | 2581 |
| 386 | Ga0373960_0096028 | 3300035121 | Bacteria | 954 |
| 387 | Ga0373960_0257290 | 3300035121 | Bacteria | 636 |
| 388 | Ga0373942_0078924 | 3300035207 | Bacteria | 974 |
| 389 | Ga0373942_0244663 | 3300035207 | Bacteria | 608 |
| 390 | Ga0373961_0154908 | 3300035241 | Bacteria | 783 |
| 391 | Ga0373962_0036421 | 3300035242 | Bacteria | 1370 |
| 392 | Ga0373931_0002121 | 3300035691 | Bacteria | 8739 |
| 393 | Ga0373931_0174321 | 3300035691 | Bacteria | 1269 |
| 394 | Ga0373931_1069353 | 3300035691 | Bacteria | 548 |
| 395 | Ga0395901_2149756 | 3300038443 | Unclassified | 503 |
| 396 | Ga0242420_014824 | 3300038996 | Unclassified | 1342 |
| 397 | Ga0242420_091729 | 3300038996 | Bacteria | 638 |
| 398 | Ga0439448_0000194 | 3300042005 | Bacteria | 12632 |
| 399 | Ga0439450_032463 | 3300042008 | Bacteria | 1179 |
| 400 | Ga0439455_0019620 | 3300042012 | Bacteria | 1596 |
| 401 | Ga0450892_042802 | 3300042130 | Unclassified | 502 |
| 402 | Ga0450898_031285 | 3300042134 | Bacteria | 978 |
| 403 | Ga0450889_025175 | 3300042144 | Archaea | 677 |
| 404 | Ga0439458_0005713 | 3300042157 | Bacteria | 2788 |
| 405 | Ga0439459_0000085 | 3300042438 | Bacteria | 8202 |
| 406 | Ga0439459_0248764 | 3300042438 | Archaea | 501 |
| 407 | Ga0439464_0050594 | 3300042439 | Bacteria | 1201 |
| 408 | Ga0439460_0000040 | 3300042461 | Bacteria | 18942 |
| 409 | Ga0439460_0230921 | 3300042461 | Unclassified | 636 |
| 410 | Ga0451577_0023293 | 3300042876 | Bacteria | 5648 |
| 411 | Ga0451577_0071964 | 3300042876 | Bacteria | 3084 |
| 412 | Ga0451577_0153712 | 3300042876 | Bacteria | 2070 |
| 413 | Ga0451577_1165076 | 3300042876 | Bacteria | 688 |
| 414 | Ga0453683_0046226 | 3300044673 | Bacteria | 2729 |
| 415 | Ga0453683_0080277 | 3300044673 | Bacteria | 2043 |
| 416 | Ga0453683_0860137 | 3300044673 | Unclassified | 598 |
| 417 | Ga0453684_0030395 | 3300044712 | Bacteria | 7633 |
| 418 | Ga0453684_0334218 | 3300044712 | Bacteria | 1712 |
| 419 | Ga0453684_0378239 | 3300044712 | Bacteria | 1591 |
| 420 | Ga0451576_0065930 | 3300045051 | Bacteria | 3769 |
| 421 | Ga0451576_0120397 | 3300045051 | Bacteria | 2732 |
| 422 | Ga0451576_0135218 | 3300045051 | Bacteria | 2570 |
| 423 | Ga0451576_0225154 | 3300045051 | Bacteria | 1958 |
| 424 | Ga0451576_0263860 | 3300045051 | Bacteria | 1800 |
| 425 | Ga0495594_0239046 | 3300046499 | Bacteria | 1035 |
| 426 | Ga0496100_1168968 | 3300048903 | Unclassified | 607 |
| 427 | Ga0496102_0101668 | 3300048905 | Bacteria | 2671 |
| 428 | Ga0496102_1185707 | 3300048905 | Bacteria | 683 |
| 429 | Ga0496104_1135177 | 3300048907 | Bacteria | 685 |
| 430 | Ga0496106_0012725 | 3300048909 | Bacteria | 6215 |
| 431 | Ga0496106_0481310 | 3300048909 | Bacteria | 997 |
| 432 | Ga0496107_0169182 | 3300048910 | Bacteria | 1621 |
| 433 | Ga0496108_0442272 | 3300048911 | Bacteria | 1136 |
| 434 | Ga0496112_0104155 | 3300048915 | Bacteria | 2808 |
| 435 | Ga0501309_030418 | 3300049129 | Bacteria | 795 |
| 436 | Ga0501299_120183 | 3300049522 | Bacteria | 632 |
| 437 | Ga0501299_174364 | 3300049522 | Unclassified | 558 |
| 438 | Ga0501031_0191196 | 3300049568 | Bacteria | 1337 |
| 439 | Ga0501031_0284217 | 3300049568 | Bacteria | 1073 |
| 440 | Ga0501032_0259205 | 3300049569 | Unclassified | 1128 |
| 441 | Ga0501032_0359753 | 3300049569 | Unclassified | 937 |
| 442 | Ga0501033_0030492 | 3300049570 | Bacteria | 4053 |
| 443 | Ga0501033_0036137 | 3300049570 | Bacteria | 3703 |
| 444 | Ga0501033_0140789 | 3300049570 | Bacteria | 1744 |
| 445 | Ga0501036_0038426 | 3300049572 | Bacteria | 4051 |
| 446 | Ga0501036_0113302 | 3300049572 | Bacteria | 2292 |
| 447 | Ga0501036_0231144 | 3300049572 | Unclassified | 1552 |
| 448 | Ga0501036_0573092 | 3300049572 | Unclassified | 937 |
| 449 | Ga0501036_0904762 | 3300049572 | Bacteria | 724 |
| 450 | Ga0501036_1073062 | 3300049572 | Unclassified | 658 |
| 451 | Ga0501037_0123077 | 3300049573 | Bacteria | 1864 |
| 452 | Ga0501038_0029104 | 3300049574 | Bacteria | 4899 |
| 453 | Ga0501038_0147601 | 3300049574 | Bacteria | 1919 |
| 454 | Ga0501038_0581108 | 3300049574 | Bacteria | 849 |
| 455 | Ga0501038_0582981 | 3300049574 | Unclassified | 848 |
| 456 | Ga0501038_0938840 | 3300049574 | Bacteria | 637 |
| 457 | Ga0501039_0023016 | 3300049575 | Bacteria | 4779 |
| 458 | Ga0501039_0045755 | 3300049575 | Bacteria | 3381 |
| 459 | Ga0501039_0254450 | 3300049575 | Unclassified | 1381 |
| 460 | Ga0501039_0308011 | 3300049575 | Bacteria | 1245 |
| 461 | Ga0501039_1212281 | 3300049575 | Bacteria | 583 |
| 462 | Ga0501039_1253949 | 3300049575 | Archaea | 573 |
| 463 | Ga0501040_0003866 | 3300049576 | Bacteria | 9714 |
| 464 | Ga0501040_0021147 | 3300049576 | Bacteria | 4340 |
| 465 | Ga0501040_0177448 | 3300049576 | Bacteria | 1509 |
| 466 | Ga0501040_0460982 | 3300049576 | Bacteria | 915 |
| 467 | Ga0501040_0504342 | 3300049576 | Bacteria | 872 |
| 468 | Ga0501040_1097577 | 3300049576 | Unclassified | 577 |
| 469 | Ga0501041_0019623 | 3300049577 | Bacteria | 4039 |
| 470 | Ga0501041_0047897 | 3300049577 | Unclassified | 2603 |
| 471 | Ga0501041_0078068 | 3300049577 | Bacteria | 2037 |
| 472 | Ga0501041_0093261 | 3300049577 | Bacteria | 1859 |
| 473 | Ga0501042_0000478 | 3300049578 | Bacteria | 20717 |
| 474 | Ga0501042_0017246 | 3300049578 | Bacteria | 4978 |
| 475 | Ga0501042_0171073 | 3300049578 | Bacteria | 1567 |
| 476 | Ga0501042_0653097 | 3300049578 | Unclassified | 765 |
| 477 | Ga0501042_0684994 | 3300049578 | Unclassified | 745 |
| 478 | Ga0501042_1329073 | 3300049578 | Bacteria | 524 |
| 479 | Ga0501043_0151069 | 3300049579 | Bacteria | 1817 |
| 480 | Ga0501043_0219013 | 3300049579 | Unclassified | 1473 |
| 481 | Ga0501043_0571621 | 3300049579 | Bacteria | 838 |
| 482 | Ga0501046_0000115 | 3300049580 | Bacteria | 84375 |
| 483 | Ga0501046_0069930 | 3300049580 | Bacteria | 2730 |
| 484 | Ga0501046_0534665 | 3300049580 | Bacteria | 837 |
| 485 | Ga0501048_0004927 | 3300049582 | Bacteria | 10185 |
| 486 | Ga0501048_0062307 | 3300049582 | Bacteria | 2640 |
| 487 | Ga0501048_0068115 | 3300049582 | Unclassified | 2515 |
| 488 | Ga0501048_0157964 | 3300049582 | Bacteria | 1604 |
| 489 | Ga0501048_0349342 | 3300049582 | Unclassified | 1055 |
| 490 | Ga0501067_0043144 | 3300049583 | Bacteria | 2505 |
| 491 | Ga0501068_0062457 | 3300049584 | Bacteria | 2265 |
| 492 | Ga0501069_0194657 | 3300049585 | Unclassified | 1174 |
| 493 | Ga0501070_1240019 | 3300049586 | Viruses | 571 |
| 494 | Ga0501071_0286918 | 3300049587 | Unclassified | 1246 |
| 495 | Ga0501071_0354077 | 3300049587 | Bacteria | 1117 |
| 496 | Ga0501071_0389942 | 3300049587 | Unclassified | 1063 |
| 497 | Ga0501071_0538360 | 3300049587 | Bacteria | 896 |
| 498 | Ga0501071_0892757 | 3300049587 | Unclassified | 686 |
| 499 | Ga0501072_0007495 | 3300049588 | Bacteria | 8281 |
| 500 | Ga0501072_0010133 | 3300049588 | Bacteria | 7175 |
| 501 | Ga0501072_0076053 | 3300049588 | Bacteria | 2656 |
| 502 | Ga0501072_0096155 | 3300049588 | Bacteria | 2354 |
| 503 | Ga0501072_0249975 | 3300049588 | Bacteria | 1412 |
| 504 | Ga0501072_0476264 | 3300049588 | Bacteria | 988 |
| 505 | Ga0501073_0252740 | 3300049589 | Unclassified | 1217 |
| 506 | Ga0501073_0489971 | 3300049589 | Bacteria | 850 |
| 507 | Ga0501073_0647770 | 3300049589 | Bacteria | 729 |
| 508 | Ga0501074_0036269 | 3300049590 | Bacteria | 3573 |
| 509 | Ga0501074_0443316 | 3300049590 | Unclassified | 921 |
| 510 | Ga0501075_0000143 | 3300049591 | Bacteria | 35679 |
| 511 | Ga0501075_0008042 | 3300049591 | Bacteria | 7333 |
| 512 | Ga0501075_0021792 | 3300049591 | Bacteria | 4673 |
| 513 | Ga0501075_0038227 | 3300049591 | Bacteria | 3587 |
| 514 | Ga0501075_0061567 | 3300049591 | Bacteria | 2828 |
| 515 | Ga0501075_0173362 | 3300049591 | Bacteria | 1646 |
| 516 | Ga0501075_0183149 | 3300049591 | Bacteria | 1598 |
| 517 | Ga0501075_0423340 | 3300049591 | Bacteria | 1015 |
| 518 | Ga0501075_0607929 | 3300049591 | Archaea | 834 |
| 519 | Ga0501076_0005597 | 3300049592 | Bacteria | 9050 |
| 520 | Ga0501076_0006074 | 3300049592 | Bacteria | 8736 |
| 521 | Ga0501076_0135832 | 3300049592 | Bacteria | 1996 |
| 522 | Ga0501076_0148837 | 3300049592 | Bacteria | 1904 |
| 523 | Ga0501076_0151981 | 3300049592 | Unclassified | 1883 |
| 524 | Ga0501076_0335126 | 3300049592 | Unclassified | 1241 |
| 525 | Ga0501077_0020563 | 3300049593 | Bacteria | 4178 |
| 526 | Ga0501077_0037087 | 3300049593 | Bacteria | 3106 |
| 527 | Ga0501077_0044495 | 3300049593 | Unclassified | 2820 |
| 528 | Ga0501077_0044873 | 3300049593 | Unclassified | 2807 |
| 529 | Ga0501077_0072508 | 3300049593 | Bacteria | 2182 |
| 530 | Ga0501077_0116959 | 3300049593 | Bacteria | 1690 |
| 531 | Ga0501077_0625212 | 3300049593 | Bacteria | 692 |
| 532 | Ga0501225_0209263 | 3300049705 | Bacteria | 623 |
| 533 | Ga0501234_057341 | 3300049707 | Bacteria | 656 |
| 534 | Ga0501079_0002407 | 3300049741 | Bacteria | 13570 |
| 535 | Ga0501079_0005017 | 3300049741 | Bacteria | 9819 |
| 536 | Ga0501079_0015441 | 3300049741 | Bacteria | 5827 |
| 537 | Ga0501079_0015801 | 3300049741 | Bacteria | 5768 |
| 538 | Ga0501079_0018848 | 3300049741 | Bacteria | 5274 |
| 539 | Ga0501079_0061444 | 3300049741 | Bacteria | 2898 |
| 540 | Ga0501079_0222386 | 3300049741 | Unclassified | 1475 |
| 541 | Ga0501079_0364557 | 3300049741 | Bacteria | 1132 |
| 542 | Ga0501079_1209308 | 3300049741 | Bacteria | 595 |
| 543 | Ga0501080_0001618 | 3300049742 | Bacteria | 19146 |
| 544 | Ga0501080_0052107 | 3300049742 | Bacteria | 3809 |
| 545 | Ga0501080_0132422 | 3300049742 | Bacteria | 2308 |
| 546 | Ga0501080_0139189 | 3300049742 | Bacteria | 2245 |
| 547 | Ga0501080_0211939 | 3300049742 | Unclassified | 1775 |
| 548 | Ga0501080_0215836 | 3300049742 | Unclassified | 1757 |
| 549 | Ga0501080_1135773 | 3300049742 | Unclassified | 674 |
| 550 | Ga0501081_0009979 | 3300049743 | Bacteria | 6191 |
| 551 | Ga0501081_0020851 | 3300049743 | Bacteria | 4372 |
| 552 | Ga0501081_0026034 | 3300049743 | Bacteria | 3941 |
| 553 | Ga0501081_0026773 | 3300049743 | Bacteria | 3890 |
| 554 | Ga0501081_0046408 | 3300049743 | Bacteria | 2986 |
| 555 | Ga0501081_0102421 | 3300049743 | Bacteria | 2025 |
| 556 | Ga0501081_0224295 | 3300049743 | Bacteria | 1367 |
| 557 | Ga0501081_0465812 | 3300049743 | Archaea | 940 |
| 558 | Ga0501081_0889350 | 3300049743 | Unclassified | 671 |
| 559 | Ga0501081_0943615 | 3300049743 | Bacteria | 651 |
| 560 | Ga0501083_0014076 | 3300049744 | Bacteria | 5593 |
| 561 | Ga0501083_0044283 | 3300049744 | Unclassified | 3013 |
| 562 | Ga0501083_0139766 | 3300049744 | Unclassified | 1586 |
| 563 | Ga0501083_0330712 | 3300049744 | Unclassified | 991 |
| 564 | Ga0501035_0041447 | 3300049822 | Bacteria | 4157 |
| 565 | Ga0501035_0567352 | 3300049822 | Unclassified | 928 |
| 566 | Ga0501045_0001069 | 3300049824 | Bacteria | 18104 |
| 567 | Ga0501045_0003469 | 3300049824 | Bacteria | 10792 |
| 568 | Ga0501045_0041722 | 3300049824 | Bacteria | 3339 |
| 569 | Ga0501045_0052413 | 3300049824 | Bacteria | 2979 |
| 570 | Ga0501045_0062802 | 3300049824 | Bacteria | 2725 |
| 571 | Ga0501045_0068810 | 3300049824 | Bacteria | 2602 |
| 572 | Ga0501045_0147033 | 3300049824 | Bacteria | 1753 |
| 573 | Ga0501045_0244661 | 3300049824 | Unclassified | 1335 |
| 574 | Ga0501045_0355480 | 3300049824 | Bacteria | 1090 |
| 575 | nmdc:mga05p37_110911_c1 | 3300050507 | Bacteria | 3374 |
| 576 | nmdc:mga05p37_114229_c1 | 3300050507 | Bacteria | 3319 |
| 577 | nmdc:mga05p37_232223_c1 | 3300050507 | Bacteria | 2222 |
| 578 | nmdc:mga05p37_29443_c1 | 3300050507 | Bacteria | 6701 |
| 579 | nmdc:mga05p37_2_c1 | 3300050507 | Bacteria | 173421 |
| 580 | nmdc:mga05p37_515013_c1 | 3300050507 | Bacteria | 1370 |
| 581 | nmdc:mga05p37_522927_c1 | 3300050507 | Unclassified | 1357 |
| 582 | nmdc:mga05p37_828547_c1 | 3300050507 | Bacteria | 1008 |
| 583 | nmdc:mga05p37_844240_c1 | 3300050507 | Bacteria | 996 |
| 584 | nmdc:mga09592_54253_c1 | 3300050508 | Bacteria | 3386 |
| 585 | nmdc:mga09592_55509_c1 | 3300050508 | Bacteria | 3347 |
| 586 | nmdc:mga09592_902088_c1 | 3300050508 | Unclassified | 743 |
| 587 | nmdc:mga09592_959_c1 | 3300050508 | Bacteria | 22733 |
| 588 | nmdc:mga0qj67_109060_c2 | 3300050509 | Bacteria | 1417 |
| 589 | nmdc:mga0qj67_183231_c1 | 3300050509 | Bacteria | 1701 |
| 590 | nmdc:mga0qj67_64225_c1 | 3300050509 | Bacteria | 2920 |
| 591 | nmdc:mga06r32_101849_c1 | 3300050510 | Bacteria | 2819 |
| 592 | nmdc:mga06r32_116859_c1 | 3300050510 | Bacteria | 2628 |
| 593 | nmdc:mga06r32_1317738_c1 | 3300050510 | Bacteria | 666 |
| 594 | nmdc:mga06r32_163181_c1 | 3300050510 | Bacteria | 2211 |
| 595 | nmdc:mga06r32_673070_c1 | 3300050510 | Bacteria | 1002 |
| 596 | nmdc:mga06r32_695_c1 | 3300050510 | Bacteria | 29349 |
| 597 | nmdc:mga08y16_254871_c1 | 3300050511 | Bacteria | 1813 |
| 598 | nmdc:mga0n895_207725_c1 | 3300050512 | Bacteria | 1989 |
| 599 | nmdc:mga0n895_226753_c2 | 3300050512 | Bacteria | 1099 |
| 600 | nmdc:mga0n895_667055_c1 | 3300050512 | Bacteria | 1038 |
| 601 | nmdc:mga0n895_7354_c1 | 3300050512 | Bacteria | 9445 |
| 602 | nmdc:mga0rr50_1125703_c1 | 3300050513 | Unclassified | 668 |
| 603 | nmdc:mga0rr50_184072_c1 | 3300050513 | Bacteria | 1709 |
| 604 | nmdc:mga0rr50_305441_c1 | 3300050513 | Bacteria | 1332 |
| 605 | nmdc:mga0rr50_466143_c1 | 3300050513 | Unclassified | 1072 |
| 606 | nmdc:mga0rr50_70814_c1 | 3300050513 | Bacteria | 2658 |
| 607 | nmdc:mga0rr50_813048_c1 | 3300050513 | Bacteria | 797 |
| 608 | nmdc:mga08x19_114603_c1 | 3300050514 | Bacteria | 1801 |
| 609 | nmdc:mga08x19_1284594_c1 | 3300050514 | Unclassified | 518 |
| 610 | nmdc:mga08x19_158420_c1 | 3300050514 | Bacteria | 1537 |
| 611 | nmdc:mga08x19_20105_c1 | 3300050514 | Bacteria | 4110 |
| 612 | nmdc:mga0a205_312010_c1 | 3300050515 | Bacteria | 1445 |
| 613 | nmdc:mga0a205_348483_c1 | 3300050515 | Bacteria | 1349 |
| 614 | nmdc:mga0a205_41704_c1 | 3300050515 | Bacteria | 3539 |
| 615 | nmdc:mga0a205_7120_c1 | 3300050515 | Bacteria | 10109 |
| 616 | nmdc:mga0a205_805658_c1 | 3300050515 | Unclassified | 787 |
| 617 | Ga0501084_0012422 | 3300054114 | Bacteria | 7058 |
| 618 | Ga0501084_0018019 | 3300054114 | Bacteria | 5880 |
| 619 | Ga0501084_0022793 | 3300054114 | Bacteria | 5226 |
| 620 | Ga0501084_0101974 | 3300054114 | Bacteria | 2410 |
| 621 | Ga0501084_0124719 | 3300054114 | Bacteria | 2167 |
| 622 | Ga0501084_0223534 | 3300054114 | Bacteria | 1589 |
| 623 | Ga0590071_087421 | 3300059421 | Bacteria | 778 |
| 624 | Ga0501082_0001107 | 3300060353 | Bacteria | 23813 |
| 625 | Ga0501082_0058304 | 3300060353 | Bacteria | 3327 |
| 626 | Ga0501082_0116747 | 3300060353 | Bacteria | 2311 |
| 627 | Ga0501082_0150954 | 3300060353 | Unclassified | 2018 |
| 628 | Ga0501082_0181043 | 3300060353 | Bacteria | 1833 |
| 629 | Ga0501082_0302735 | 3300060353 | Unclassified | 1392 |
| 630 | Ga0501082_0518908 | 3300060353 | Bacteria | 1041 |
| 631 | Ga0501082_0575423 | 3300060353 | Bacteria | 985 |
| 632 | Ga0501082_0999712 | 3300060353 | Bacteria | 731 |
| 633 | Ga0501082_1542492 | 3300060353 | Unclassified | 580 |
| 634 | Ga0530510_0005890 | 3300061734 | Bacteria | 8498 |
| 635 | Ga0530510_0013587 | 3300061734 | Bacteria | 5727 |
| 636 | Ga0530510_0037417 | 3300061734 | Bacteria | 3499 |
| 637 | Ga0530510_0043068 | 3300061734 | Bacteria | 3260 |
| 638 | Ga0530510_0239184 | 3300061734 | Unclassified | 1351 |
| 639 | Ga0530510_0274035 | 3300061734 | Bacteria | 1259 |
| 640 | Ga0530510_0296212 | 3300061734 | Bacteria | 1210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_1542492 | Ga0501082_1542492_269_535 | 87 |
| 2 | 3300001915 | JGI24741J21665_1045726 | JGI24741J21665_10457262 | 89 |
| 3 | 3300003322 | rootL2_10186341 | rootL2_101863413 | 89 |
| 4 | 3300003373 | JGI25407J50210_10146549 | JGI25407J50210_101465491 | 89 |
| 5 | 3300003911 | JGI25405J52794_10018580 | JGI25405J52794_100185802 | 89 |
| 6 | 3300004799 | Ga0058863_11697093 | Ga0058863_116970931 | 89 |
| 7 | 3300004803 | Ga0058862_12575548 | Ga0058862_125755483 | 89 |
| 8 | 3300005290 | Ga0065712_10311569 | Ga0065712_103115693 | 89 |
| 9 | 3300005293 | Ga0065715_10308892 | Ga0065715_103088923 | 89 |
| 10 | 3300005295 | Ga0065707_10817523 | Ga0065707_108175232 | 89 |
| 11 | 3300005328 | Ga0070676_10000771 | Ga0070676_100007719 | 89 |
| 12 | 3300005329 | Ga0070683_100101507 | Ga0070683_1001015075 | 89 |
| 13 | 3300005330 | Ga0070690_100436828 | Ga0070690_1004368283 | 89 |
| 14 | 3300005334 | Ga0068869_100000503 | Ga0068869_10000050314 | 89 |
| 15 | 3300005335 | Ga0070666_10135337 | Ga0070666_101353374 | 89 |
| 16 | 3300005335 | Ga0070666_11412568 | Ga0070666_114125681 | 89 |
| 17 | 3300005336 | Ga0070680_100002337 | Ga0070680_1000023376 | 89 |
| 18 | 3300005336 | Ga0070680_100107633 | Ga0070680_1001076334 | 89 |
| 19 | 3300005336 | Ga0070680_100302435 | Ga0070680_1003024353 | 89 |
| 20 | 3300005337 | Ga0070682_100000182 | Ga0070682_1000001826 | 89 |
| 21 | 3300005338 | Ga0068868_100009025 | Ga0068868_1000090254 | 89 |
| 22 | 3300005339 | Ga0070660_100002694 | Ga0070660_10000269410 | 89 |
| 23 | 3300005340 | Ga0070689_100017569 | Ga0070689_1000175692 | 89 |
| 24 | 3300005340 | Ga0070689_100091848 | Ga0070689_1000918484 | 89 |
| 25 | 3300005340 | Ga0070689_100615708 | Ga0070689_1006157083 | 89 |
| 26 | 3300005341 | Ga0070691_10003395 | Ga0070691_100033956 | 89 |
| 27 | 3300005341 | Ga0070691_10011353 | Ga0070691_100113534 | 89 |
| 28 | 3300005341 | Ga0070691_10014611 | Ga0070691_100146113 | 89 |
| 29 | 3300005341 | Ga0070691_10656923 | Ga0070691_106569232 | 89 |
| 30 | 3300005343 | Ga0070687_100322871 | Ga0070687_1003228712 | 89 |
| 31 | 3300005344 | Ga0070661_100000280 | Ga0070661_1000002803 | 89 |
| 32 | 3300005345 | Ga0070692_10001685 | Ga0070692_100016856 | 89 |
| 33 | 3300005347 | Ga0070668_100400242 | Ga0070668_1004002424 | 89 |
| 34 | 3300005347 | Ga0070668_100668191 | Ga0070668_1006681911 | 89 |
| 35 | 3300005353 | Ga0070669_100011809 | Ga0070669_1000118095 | 89 |
| 36 | 3300005353 | Ga0070669_100187063 | Ga0070669_1001870633 | 89 |
| 37 | 3300005353 | Ga0070669_101521708 | Ga0070669_1015217081 | 89 |
| 38 | 3300005356 | Ga0070674_101545962 | Ga0070674_1015459621 | 89 |
| 39 | 3300005366 | Ga0070659_100000500 | Ga0070659_1000005006 | 89 |
| 40 | 3300005367 | Ga0070667_100184281 | Ga0070667_1001842813 | 89 |
| 41 | 3300005406 | Ga0070703_10002816 | Ga0070703_100028162 | 89 |
| 42 | 3300005406 | Ga0070703_10038737 | Ga0070703_100387372 | 89 |
| 43 | 3300005434 | Ga0070709_10027601 | Ga0070709_100276015 | 89 |
| 44 | 3300005436 | Ga0070713_100935715 | Ga0070713_1009357152 | 89 |
| 45 | 3300005438 | Ga0070701_10084605 | Ga0070701_100846053 | 89 |
| 46 | 3300005438 | Ga0070701_10138385 | Ga0070701_101383853 | 89 |
| 47 | 3300005438 | Ga0070701_11010048 | Ga0070701_110100481 | 89 |
| 48 | 3300005440 | Ga0070705_100001910 | Ga0070705_1000019108 | 89 |
| 49 | 3300005440 | Ga0070705_100321719 | Ga0070705_1003217193 | 89 |
| 50 | 3300005440 | Ga0070705_100344756 | Ga0070705_1003447564 | 89 |
| 51 | 3300005440 | Ga0070705_100840538 | Ga0070705_1008405382 | 89 |
| 52 | 3300005441 | Ga0070700_100264836 | Ga0070700_1002648362 | 89 |
| 53 | 3300005444 | Ga0070694_100002581 | Ga0070694_10000258111 | 89 |
| 54 | 3300005444 | Ga0070694_100010952 | Ga0070694_1000109523 | 89 |
| 55 | 3300005444 | Ga0070694_100034533 | Ga0070694_1000345335 | 89 |
| 56 | 3300005444 | Ga0070694_100064642 | Ga0070694_1000646423 | 89 |
| 57 | 3300005444 | Ga0070694_100170521 | Ga0070694_1001705212 | 89 |
| 58 | 3300005444 | Ga0070694_100289714 | Ga0070694_1002897142 | 89 |
| 59 | 3300005444 | Ga0070694_101589304 | Ga0070694_1015893041 | 89 |
| 60 | 3300005445 | Ga0070708_100175955 | Ga0070708_1001759554 | 89 |
| 61 | 3300005445 | Ga0070708_100245107 | Ga0070708_1002451074 | 89 |
| 62 | 3300005445 | Ga0070708_100300784 | Ga0070708_1003007843 | 89 |
| 63 | 3300005445 | Ga0070708_100340385 | Ga0070708_1003403854 | 89 |
| 64 | 3300005445 | Ga0070708_100360436 | Ga0070708_1003604363 | 89 |
| 65 | 3300005445 | Ga0070708_101214336 | Ga0070708_1012143361 | 89 |
| 66 | 3300005445 | Ga0070708_101318679 | Ga0070708_1013186792 | 89 |
| 67 | 3300005455 | Ga0070663_100001673 | Ga0070663_1000016739 | 89 |
| 68 | 3300005455 | Ga0070663_100295907 | Ga0070663_1002959073 | 89 |
| 69 | 3300005457 | Ga0070662_100001013 | Ga0070662_10000101313 | 89 |
| 70 | 3300005457 | Ga0070662_100025074 | Ga0070662_1000250743 | 89 |
| 71 | 3300005457 | Ga0070662_100213792 | Ga0070662_1002137923 | 89 |
| 72 | 3300005458 | Ga0070681_10027811 | Ga0070681_100278116 | 89 |
| 73 | 3300005458 | Ga0070681_10161622 | Ga0070681_101616224 | 89 |
| 74 | 3300005458 | Ga0070681_10675929 | Ga0070681_106759293 | 89 |
| 75 | 3300005459 | Ga0068867_100045002 | Ga0068867_1000450024 | 89 |
| 76 | 3300005459 | Ga0068867_100197973 | Ga0068867_1001979732 | 89 |
| 77 | 3300005467 | Ga0070706_100005525 | Ga0070706_1000055258 | 89 |
| 78 | 3300005467 | Ga0070706_100080671 | Ga0070706_1000806714 | 89 |
| 79 | 3300005467 | Ga0070706_100242845 | Ga0070706_1002428452 | 89 |
| 80 | 3300005467 | Ga0070706_100902339 | Ga0070706_1009023391 | 89 |
| 81 | 3300005468 | Ga0070707_100023916 | Ga0070707_1000239164 | 89 |
| 82 | 3300005468 | Ga0070707_100112317 | Ga0070707_1001123173 | 89 |
| 83 | 3300005468 | Ga0070707_100327546 | Ga0070707_1003275461 | 89 |
| 84 | 3300005468 | Ga0070707_100365081 | Ga0070707_1003650813 | 89 |
| 85 | 3300005468 | Ga0070707_100890467 | Ga0070707_1008904672 | 89 |
| 86 | 3300005471 | Ga0070698_100011493 | Ga0070698_1000114935 | 89 |
| 87 | 3300005471 | Ga0070698_100058520 | Ga0070698_1000585204 | 89 |
| 88 | 3300005471 | Ga0070698_100079769 | Ga0070698_1000797693 | 89 |
| 89 | 3300005471 | Ga0070698_100479027 | Ga0070698_1004790273 | 89 |
| 90 | 3300005471 | Ga0070698_100982987 | Ga0070698_1009829872 | 89 |
| 91 | 3300005471 | Ga0070698_101864560 | Ga0070698_1018645602 | 89 |
| 92 | 3300005518 | Ga0070699_100007156 | Ga0070699_1000071563 | 89 |
| 93 | 3300005518 | Ga0070699_100011450 | Ga0070699_1000114508 | 89 |
| 94 | 3300005518 | Ga0070699_100018159 | Ga0070699_1000181598 | 89 |
| 95 | 3300005518 | Ga0070699_100051526 | Ga0070699_1000515265 | 89 |
| 96 | 3300005518 | Ga0070699_100130602 | Ga0070699_1001306024 | 89 |
| 97 | 3300005530 | Ga0070679_100014766 | Ga0070679_1000147669 | 89 |
| 98 | 3300005530 | Ga0070679_101873072 | Ga0070679_1018730721 | 89 |
| 99 | 3300005535 | Ga0070684_100441758 | Ga0070684_1004417582 | 89 |
| 100 | 3300005536 | Ga0070697_100004998 | Ga0070697_1000049985 | 89 |
| 101 | 3300005536 | Ga0070697_100090247 | Ga0070697_1000902472 | 89 |
| 102 | 3300005536 | Ga0070697_100232861 | Ga0070697_1002328614 | 89 |
| 103 | 3300005536 | Ga0070697_100542108 | Ga0070697_1005421082 | 89 |
| 104 | 3300005536 | Ga0070697_100782531 | Ga0070697_1007825312 | 89 |
| 105 | 3300005539 | Ga0068853_100000088 | Ga0068853_10000008861 | 89 |
| 106 | 3300005543 | Ga0070672_100042006 | Ga0070672_1000420063 | 89 |
| 107 | 3300005543 | Ga0070672_100368512 | Ga0070672_1003685123 | 89 |
| 108 | 3300005544 | Ga0070686_100333331 | Ga0070686_1003333312 | 89 |
| 109 | 3300005544 | Ga0070686_101703159 | Ga0070686_1017031592 | 89 |
| 110 | 3300005545 | Ga0070695_100000261 | Ga0070695_10000026111 | 89 |
| 111 | 3300005545 | Ga0070695_100000723 | Ga0070695_10000072318 | 89 |
| 112 | 3300005545 | Ga0070695_100022342 | Ga0070695_1000223425 | 89 |
| 113 | 3300005545 | Ga0070695_100050654 | Ga0070695_1000506544 | 89 |
| 114 | 3300005545 | Ga0070695_100191756 | Ga0070695_1001917562 | 89 |
| 115 | 3300005546 | Ga0070696_100052049 | Ga0070696_1000520496 | 89 |
| 116 | 3300005546 | Ga0070696_100347062 | Ga0070696_1003470623 | 89 |
| 117 | 3300005546 | Ga0070696_100400310 | Ga0070696_1004003102 | 89 |
| 118 | 3300005546 | Ga0070696_100987532 | Ga0070696_1009875322 | 89 |
| 119 | 3300005547 | Ga0070693_100000207 | Ga0070693_10000020718 | 89 |
| 120 | 3300005547 | Ga0070693_100216313 | Ga0070693_1002163133 | 89 |
| 121 | 3300005549 | Ga0070704_100000505 | Ga0070704_10000050520 | 89 |
| 122 | 3300005549 | Ga0070704_100022237 | Ga0070704_1000222375 | 89 |
| 123 | 3300005549 | Ga0070704_100066790 | Ga0070704_1000667904 | 89 |
| 124 | 3300005549 | Ga0070704_100220530 | Ga0070704_1002205302 | 89 |
| 125 | 3300005563 | Ga0068855_100001473 | Ga0068855_10000147316 | 89 |
| 126 | 3300005563 | Ga0068855_102526520 | Ga0068855_1025265201 | 89 |
| 127 | 3300005564 | Ga0070664_100018282 | Ga0070664_1000182825 | 89 |
| 128 | 3300005577 | Ga0068857_100098711 | Ga0068857_1000987116 | 89 |
| 129 | 3300005578 | Ga0068854_100020336 | Ga0068854_1000203365 | 89 |
| 130 | 3300005578 | Ga0068854_100696799 | Ga0068854_1006967993 | 89 |
| 131 | 3300005614 | Ga0068856_100000796 | Ga0068856_10000079620 | 89 |
| 132 | 3300005615 | Ga0070702_100001713 | Ga0070702_1000017137 | 89 |
| 133 | 3300005615 | Ga0070702_100111610 | Ga0070702_1001116103 | 89 |
| 134 | 3300005617 | Ga0068859_100000533 | Ga0068859_10000053341 | 89 |
| 135 | 3300005617 | Ga0068859_100296622 | Ga0068859_1002966223 | 89 |
| 136 | 3300005618 | Ga0068864_100008591 | Ga0068864_1000085915 | 89 |
| 137 | 3300005718 | Ga0068866_10105550 | Ga0068866_101055503 | 89 |
| 138 | 3300005719 | Ga0068861_100041115 | Ga0068861_1000411156 | 89 |
| 139 | 3300005719 | Ga0068861_100129209 | Ga0068861_1001292094 | 89 |
| 140 | 3300005719 | Ga0068861_100269298 | Ga0068861_1002692983 | 89 |
| 141 | 3300005834 | Ga0068851_10806425 | Ga0068851_108064251 | 89 |
| 142 | 3300005840 | Ga0068870_10000609 | Ga0068870_1000060912 | 89 |
| 143 | 3300005841 | Ga0068863_100031766 | Ga0068863_1000317666 | 89 |
| 144 | 3300005841 | Ga0068863_100273000 | Ga0068863_1002730002 | 89 |
| 145 | 3300005842 | Ga0068858_100037627 | Ga0068858_1000376274 | 89 |
| 146 | 3300005843 | Ga0068860_100011455 | Ga0068860_1000114554 | 89 |
| 147 | 3300005843 | Ga0068860_100050252 | Ga0068860_1000502522 | 89 |
| 148 | 3300005844 | Ga0068862_100000415 | Ga0068862_10000041513 | 89 |
| 149 | 3300005844 | Ga0068862_100039297 | Ga0068862_1000392971 | 89 |
| 150 | 3300005844 | Ga0068862_100677874 | Ga0068862_1006778742 | 89 |
| 151 | 3300005937 | Ga0081455_10000749 | Ga0081455_1000074922 | 89 |
| 152 | 3300005937 | Ga0081455_10910639 | Ga0081455_109106392 | 89 |
| 153 | 3300005981 | Ga0081538_10008698 | Ga0081538_100086983 | 89 |
| 154 | 3300005985 | Ga0081539_10169170 | Ga0081539_101691702 | 89 |
| 155 | 3300006058 | Ga0075432_10008791 | Ga0075432_100087914 | 89 |
| 156 | 3300006173 | Ga0070716_100017412 | Ga0070716_1000174125 | 89 |
| 157 | 3300006237 | Ga0097621_100731401 | Ga0097621_1007314012 | 89 |
| 158 | 3300006358 | Ga0068871_100307538 | Ga0068871_1003075384 | 89 |
| 159 | 3300006844 | Ga0075428_100023993 | Ga0075428_10002399310 | 89 |
| 160 | 3300006844 | Ga0075428_100050379 | Ga0075428_1000503793 | 89 |
| 161 | 3300006844 | Ga0075428_100258161 | Ga0075428_1002581613 | 89 |
| 162 | 3300006846 | Ga0075430_100000250 | Ga0075430_10000025020 | 89 |
| 163 | 3300006846 | Ga0075430_100014450 | Ga0075430_1000144508 | 89 |
| 164 | 3300006846 | Ga0075430_100102207 | Ga0075430_1001022073 | 89 |
| 165 | 3300006846 | Ga0075430_100286412 | Ga0075430_1002864123 | 89 |
| 166 | 3300006847 | Ga0075431_100011427 | Ga0075431_1000114275 | 89 |
| 167 | 3300006847 | Ga0075431_100049431 | Ga0075431_1000494313 | 89 |
| 168 | 3300006847 | Ga0075431_101438124 | Ga0075431_1014381241 | 89 |
| 169 | 3300006852 | Ga0075433_10006756 | Ga0075433_100067566 | 89 |
| 170 | 3300006852 | Ga0075433_10008839 | Ga0075433_100088394 | 89 |
| 171 | 3300006852 | Ga0075433_10023064 | Ga0075433_100230642 | 89 |
| 172 | 3300006852 | Ga0075433_10023417 | Ga0075433_100234176 | 89 |
| 173 | 3300006852 | Ga0075433_10043963 | Ga0075433_100439634 | 89 |
| 174 | 3300006852 | Ga0075433_10122590 | Ga0075433_101225904 | 89 |
| 175 | 3300006852 | Ga0075433_10141181 | Ga0075433_101411814 | 89 |
| 176 | 3300006852 | Ga0075433_10433255 | Ga0075433_104332553 | 89 |
| 177 | 3300006852 | Ga0075433_10490265 | Ga0075433_104902652 | 89 |
| 178 | 3300006852 | Ga0075433_10535948 | Ga0075433_105359483 | 89 |
| 179 | 3300006852 | Ga0075433_11321572 | Ga0075433_113215722 | 89 |
| 180 | 3300006871 | Ga0075434_100009040 | Ga0075434_10000904011 | 89 |
| 181 | 3300006871 | Ga0075434_100019339 | Ga0075434_1000193394 | 89 |
| 182 | 3300006871 | Ga0075434_100058926 | Ga0075434_1000589266 | 89 |
| 183 | 3300006871 | Ga0075434_100095766 | Ga0075434_1000957664 | 89 |
| 184 | 3300006871 | Ga0075434_100104676 | Ga0075434_1001046764 | 89 |
| 185 | 3300006871 | Ga0075434_100249441 | Ga0075434_1002494413 | 89 |
| 186 | 3300006880 | Ga0075429_100000021 | Ga0075429_10000002154 | 89 |
| 187 | 3300006880 | Ga0075429_100016408 | Ga0075429_1000164083 | 89 |
| 188 | 3300006880 | Ga0075429_100141438 | Ga0075429_1001414383 | 89 |
| 189 | 3300006880 | Ga0075429_101906050 | Ga0075429_1019060502 | 89 |
| 190 | 3300006881 | Ga0068865_100062083 | Ga0068865_1000620833 | 89 |
| 191 | 3300006881 | Ga0068865_100367380 | Ga0068865_1003673802 | 89 |
| 192 | 3300006881 | Ga0068865_100462566 | Ga0068865_1004625662 | 89 |
| 193 | 3300006914 | Ga0075436_100036175 | Ga0075436_1000361756 | 89 |
| 194 | 3300006914 | Ga0075436_100061886 | Ga0075436_1000618863 | 89 |
| 195 | 3300006914 | Ga0075436_101036060 | Ga0075436_1010360602 | 89 |
| 196 | 3300006914 | Ga0075436_101056007 | Ga0075436_1010560072 | 89 |
| 197 | 3300006931 | Ga0097620_100000533 | Ga0097620_10000053341 | 89 |
| 198 | 3300006931 | Ga0097620_100296619 | Ga0097620_1002966193 | 89 |
| 199 | 3300007076 | Ga0075435_100031805 | Ga0075435_1000318053 | 89 |
| 200 | 3300007076 | Ga0075435_100068902 | Ga0075435_1000689025 | 89 |
| 201 | 3300007076 | Ga0075435_100108032 | Ga0075435_1001080323 | 89 |
| 202 | 3300007076 | Ga0075435_100109569 | Ga0075435_1001095694 | 89 |
| 203 | 3300007076 | Ga0075435_100496762 | Ga0075435_1004967623 | 89 |
| 204 | 3300007265 | Ga0099794_10000503 | Ga0099794_100005039 | 89 |
| 205 | 3300007265 | Ga0099794_10450255 | Ga0099794_104502551 | 89 |
| 206 | 3300007265 | Ga0099794_10651642 | Ga0099794_106516422 | 89 |
| 207 | 3300009093 | Ga0105240_11886622 | Ga0105240_118866222 | 89 |
| 208 | 3300009094 | Ga0111539_10000098 | Ga0111539_1000009828 | 89 |
| 209 | 3300009094 | Ga0111539_10000182 | Ga0111539_1000018230 | 89 |
| 210 | 3300009094 | Ga0111539_10019865 | Ga0111539_1001986510 | 89 |
| 211 | 3300009094 | Ga0111539_10328383 | Ga0111539_103283834 | 89 |
| 212 | 3300009147 | Ga0114129_10000002 | Ga0114129_10000002132 | 89 |
| 213 | 3300009147 | Ga0114129_10034596 | Ga0114129_100345961 | 89 |
| 214 | 3300009147 | Ga0114129_10089569 | Ga0114129_100895695 | 89 |
| 215 | 3300009147 | Ga0114129_10155118 | Ga0114129_101551186 | 89 |
| 216 | 3300009147 | Ga0114129_10293575 | Ga0114129_102935753 | 89 |
| 217 | 3300009147 | Ga0114129_10439398 | Ga0114129_104393983 | 89 |
| 218 | 3300009147 | Ga0114129_10472727 | Ga0114129_104727271 | 89 |
| 219 | 3300009147 | Ga0114129_10497236 | Ga0114129_104972363 | 89 |
| 220 | 3300009147 | Ga0114129_10567988 | Ga0114129_105679881 | 89 |
| 221 | 3300009147 | Ga0114129_10818763 | Ga0114129_108187633 | 89 |
| 222 | 3300009147 | Ga0114129_12066203 | Ga0114129_120662032 | 89 |
| 223 | 3300009148 | Ga0105243_10449421 | Ga0105243_104494212 | 89 |
| 224 | 3300009148 | Ga0105243_10600707 | Ga0105243_106007072 | 89 |
| 225 | 3300009148 | Ga0105243_10746520 | Ga0105243_107465202 | 89 |
| 226 | 3300009148 | Ga0105243_11431357 | Ga0105243_114313572 | 89 |
| 227 | 3300009174 | Ga0105241_10002948 | Ga0105241_100029486 | 89 |
| 228 | 3300009174 | Ga0105241_10182826 | Ga0105241_101828263 | 89 |
| 229 | 3300009174 | Ga0105241_11713727 | Ga0105241_117137272 | 89 |
| 230 | 3300009176 | Ga0105242_10114856 | Ga0105242_101148564 | 89 |
| 231 | 3300009177 | Ga0105248_10307270 | Ga0105248_103072703 | 89 |
| 232 | 3300009545 | Ga0105237_10193261 | Ga0105237_101932613 | 89 |
| 233 | 3300009553 | Ga0105249_10502832 | Ga0105249_105028322 | 89 |
| 234 | 3300009553 | Ga0105249_10550525 | Ga0105249_105505252 | 89 |
| 235 | 3300009553 | Ga0105249_12354112 | Ga0105249_123541122 | 89 |
| 236 | 3300010375 | Ga0105239_10058392 | Ga0105239_100583926 | 89 |
| 237 | 3300011119 | Ga0105246_10016340 | Ga0105246_100163408 | 89 |
| 238 | 3300013100 | Ga0157373_10000176 | Ga0157373_1000017624 | 89 |
| 239 | 3300013102 | Ga0157371_10059205 | Ga0157371_100592054 | 89 |
| 240 | 3300013102 | Ga0157371_10507006 | Ga0157371_105070062 | 89 |
| 241 | 3300013105 | Ga0157369_10021645 | Ga0157369_100216454 | 89 |
| 242 | 3300013297 | Ga0157378_10158786 | Ga0157378_101587863 | 89 |
| 243 | 3300013306 | Ga0163162_10081405 | Ga0163162_100814054 | 89 |
| 244 | 3300013306 | Ga0163162_11754107 | Ga0163162_117541072 | 89 |
| 245 | 3300013306 | Ga0163162_11956855 | Ga0163162_119568552 | 89 |
| 246 | 3300013307 | Ga0157372_10005276 | Ga0157372_100052767 | 89 |
| 247 | 3300013307 | Ga0157372_11177881 | Ga0157372_111778812 | 89 |
| 248 | 3300013308 | Ga0157375_10017503 | Ga0157375_100175034 | 89 |
| 249 | 3300013308 | Ga0157375_10054737 | Ga0157375_100547373 | 89 |
| 250 | 3300014325 | Ga0163163_10133543 | Ga0163163_101335434 | 89 |
| 251 | 3300014326 | Ga0157380_11152131 | Ga0157380_111521311 | 89 |
| 252 | 3300014745 | Ga0157377_10620035 | Ga0157377_106200352 | 89 |
| 253 | 3300015262 | Ga0182007_10030110 | Ga0182007_100301103 | 89 |
| 254 | 3300017792 | Ga0163161_10269119 | Ga0163161_102691193 | 89 |
| 255 | 3300020081 | Ga0206354_11134721 | Ga0206354_111347212 | 89 |
| 256 | 3300020082 | Ga0206353_10370831 | Ga0206353_103708312 | 89 |
| 257 | 3300025321 | Ga0207656_10623616 | Ga0207656_106236161 | 89 |
| 258 | 3300025885 | Ga0207653_10043055 | Ga0207653_100430554 | 89 |
| 259 | 3300025885 | Ga0207653_10186329 | Ga0207653_101863292 | 89 |
| 260 | 3300025899 | Ga0207642_10488371 | Ga0207642_104883712 | 89 |
| 261 | 3300025901 | Ga0207688_10032458 | Ga0207688_100324584 | 89 |
| 262 | 3300025904 | Ga0207647_10321303 | Ga0207647_103213031 | 89 |
| 263 | 3300025905 | Ga0207685_10104491 | Ga0207685_101044914 | 89 |
| 264 | 3300025906 | Ga0207699_10188239 | Ga0207699_101882394 | 89 |
| 265 | 3300025906 | Ga0207699_10862459 | Ga0207699_108624592 | 89 |
| 266 | 3300025907 | Ga0207645_10000232 | Ga0207645_1000023238 | 89 |
| 267 | 3300025908 | Ga0207643_10000871 | Ga0207643_100008718 | 89 |
| 268 | 3300025910 | Ga0207684_10009619 | Ga0207684_100096193 | 89 |
| 269 | 3300025910 | Ga0207684_10015909 | Ga0207684_100159098 | 89 |
| 270 | 3300025910 | Ga0207684_10177738 | Ga0207684_101777382 | 89 |
| 271 | 3300025910 | Ga0207684_10218659 | Ga0207684_102186594 | 89 |
| 272 | 3300025910 | Ga0207684_10265128 | Ga0207684_102651283 | 89 |
| 273 | 3300025910 | Ga0207684_11746787 | Ga0207684_117467871 | 89 |
| 274 | 3300025911 | Ga0207654_10010714 | Ga0207654_100107145 | 89 |
| 275 | 3300025911 | Ga0207654_10687303 | Ga0207654_106873033 | 89 |
| 276 | 3300025911 | Ga0207654_10698190 | Ga0207654_106981902 | 89 |
| 277 | 3300025912 | Ga0207707_10000076 | Ga0207707_1000007696 | 89 |
| 278 | 3300025912 | Ga0207707_10161541 | Ga0207707_101615413 | 89 |
| 279 | 3300025915 | Ga0207693_10095474 | Ga0207693_100954742 | 89 |
| 280 | 3300025917 | Ga0207660_10000514 | Ga0207660_1000051419 | 89 |
| 281 | 3300025917 | Ga0207660_10008444 | Ga0207660_100084443 | 89 |
| 282 | 3300025917 | Ga0207660_10506773 | Ga0207660_105067732 | 89 |
| 283 | 3300025918 | Ga0207662_10522351 | Ga0207662_105223512 | 89 |
| 284 | 3300025919 | Ga0207657_10000005 | Ga0207657_1000000541 | 89 |
| 285 | 3300025920 | Ga0207649_10057555 | Ga0207649_100575556 | 89 |
| 286 | 3300025921 | Ga0207652_10000060 | Ga0207652_1000006018 | 89 |
| 287 | 3300025922 | Ga0207646_10013579 | Ga0207646_100135796 | 89 |
| 288 | 3300025922 | Ga0207646_10020969 | Ga0207646_100209695 | 89 |
| 289 | 3300025922 | Ga0207646_10023404 | Ga0207646_100234045 | 89 |
| 290 | 3300025922 | Ga0207646_10038020 | Ga0207646_100380205 | 89 |
| 291 | 3300025922 | Ga0207646_10046542 | Ga0207646_100465424 | 89 |
| 292 | 3300025922 | Ga0207646_10078974 | Ga0207646_100789743 | 89 |
| 293 | 3300025922 | Ga0207646_10489712 | Ga0207646_104897122 | 89 |
| 294 | 3300025922 | Ga0207646_11097359 | Ga0207646_110973592 | 89 |
| 295 | 3300025923 | Ga0207681_10265938 | Ga0207681_102659383 | 89 |
| 296 | 3300025923 | Ga0207681_10382542 | Ga0207681_103825423 | 89 |
| 297 | 3300025923 | Ga0207681_10946738 | Ga0207681_109467381 | 89 |
| 298 | 3300025925 | Ga0207650_10192383 | Ga0207650_101923833 | 89 |
| 299 | 3300025928 | Ga0207700_11704484 | Ga0207700_117044842 | 89 |
| 300 | 3300025932 | Ga0207690_10241596 | Ga0207690_102415963 | 89 |
| 301 | 3300025933 | Ga0207706_10003272 | Ga0207706_1000327214 | 89 |
| 302 | 3300025933 | Ga0207706_10037858 | Ga0207706_100378584 | 89 |
| 303 | 3300025933 | Ga0207706_10267976 | Ga0207706_102679762 | 89 |
| 304 | 3300025934 | Ga0207686_10036416 | Ga0207686_100364164 | 89 |
| 305 | 3300025935 | Ga0207709_10145565 | Ga0207709_101455653 | 89 |
| 306 | 3300025935 | Ga0207709_10293352 | Ga0207709_102933522 | 89 |
| 307 | 3300025935 | Ga0207709_10769509 | Ga0207709_107695092 | 89 |
| 308 | 3300025936 | Ga0207670_10007115 | Ga0207670_100071157 | 89 |
| 309 | 3300025936 | Ga0207670_10033481 | Ga0207670_100334813 | 89 |
| 310 | 3300025936 | Ga0207670_10896146 | Ga0207670_108961462 | 89 |
| 311 | 3300025937 | Ga0207669_11349606 | Ga0207669_113496062 | 89 |
| 312 | 3300025938 | Ga0207704_10388106 | Ga0207704_103881063 | 89 |
| 313 | 3300025938 | Ga0207704_10413570 | Ga0207704_104135702 | 89 |
| 314 | 3300025939 | Ga0207665_10000907 | Ga0207665_1000090719 | 89 |
| 315 | 3300025940 | Ga0207691_10068537 | Ga0207691_100685373 | 89 |
| 316 | 3300025941 | Ga0207711_10421515 | Ga0207711_104215153 | 89 |
| 317 | 3300025942 | Ga0207689_10000423 | Ga0207689_1000042339 | 89 |
| 318 | 3300025942 | Ga0207689_10760819 | Ga0207689_107608191 | 89 |
| 319 | 3300025944 | Ga0207661_10347104 | Ga0207661_103471043 | 89 |
| 320 | 3300025945 | Ga0207679_10000231 | Ga0207679_1000023136 | 89 |
| 321 | 3300025949 | Ga0207667_10001202 | Ga0207667_1000120229 | 89 |
| 322 | 3300025960 | Ga0207651_11254030 | Ga0207651_112540302 | 89 |
| 323 | 3300025961 | Ga0207712_10462006 | Ga0207712_104620061 | 89 |
| 324 | 3300025972 | Ga0207668_10379177 | Ga0207668_103791774 | 89 |
| 325 | 3300025972 | Ga0207668_10652483 | Ga0207668_106524832 | 89 |
| 326 | 3300025972 | Ga0207668_11819157 | Ga0207668_118191571 | 89 |
| 327 | 3300025981 | Ga0207640_10022458 | Ga0207640_100224585 | 89 |
| 328 | 3300025986 | Ga0207658_10814074 | Ga0207658_108140742 | 89 |
| 329 | 3300026023 | Ga0207677_10119935 | Ga0207677_101199353 | 89 |
| 330 | 3300026035 | Ga0207703_10027052 | Ga0207703_100270526 | 89 |
| 331 | 3300026041 | Ga0207639_10000571 | Ga0207639_1000057123 | 89 |
| 332 | 3300026067 | Ga0207678_10005780 | Ga0207678_100057805 | 89 |
| 333 | 3300026075 | Ga0207708_10174817 | Ga0207708_101748173 | 89 |
| 334 | 3300026078 | Ga0207702_10000576 | Ga0207702_1000057639 | 89 |
| 335 | 3300026088 | Ga0207641_10274759 | Ga0207641_102747592 | 89 |
| 336 | 3300026089 | Ga0207648_10000565 | Ga0207648_1000056530 | 89 |
| 337 | 3300026089 | Ga0207648_10148077 | Ga0207648_101480774 | 89 |
| 338 | 3300026095 | Ga0207676_10065966 | Ga0207676_100659665 | 89 |
| 339 | 3300026116 | Ga0207674_10001421 | Ga0207674_1000142119 | 89 |
| 340 | 3300026116 | Ga0207674_10416390 | Ga0207674_104163903 | 89 |
| 341 | 3300026118 | Ga0207675_100000795 | Ga0207675_10000079518 | 89 |
| 342 | 3300026118 | Ga0207675_100381262 | Ga0207675_1003812623 | 89 |
| 343 | 3300027360 | Ga0209969_1007467 | Ga0209969_10074673 | 89 |
| 344 | 3300027378 | Ga0209981_1008124 | Ga0209981_10081243 | 89 |
| 345 | 3300027395 | Ga0209996_1010954 | Ga0209996_10109543 | 89 |
| 346 | 3300027424 | Ga0209984_1025367 | Ga0209984_10253672 | 89 |
| 347 | 3300027462 | Ga0210000_1030615 | Ga0210000_10306152 | 89 |
| 348 | 3300027471 | Ga0209995_1006412 | Ga0209995_10064121 | 89 |
| 349 | 3300027526 | Ga0209968_1004063 | Ga0209968_10040634 | 89 |
| 350 | 3300027552 | Ga0209982_1003255 | Ga0209982_10032555 | 89 |
| 351 | 3300027614 | Ga0209970_1003842 | Ga0209970_10038422 | 89 |
| 352 | 3300027617 | Ga0210002_1007517 | Ga0210002_10075172 | 89 |
| 353 | 3300027665 | Ga0209983_1000319 | Ga0209983_100031913 | 89 |
| 354 | 3300027671 | Ga0209588_1001293 | Ga0209588_10012939 | 89 |
| 355 | 3300027682 | Ga0209971_1000016 | Ga0209971_100001644 | 89 |
| 356 | 3300027695 | Ga0209966_1000083 | Ga0209966_10000833 | 89 |
| 357 | 3300027717 | Ga0209998_10000186 | Ga0209998_1000018625 | 89 |
| 358 | 3300027876 | Ga0209974_10010451 | Ga0209974_100104513 | 89 |
| 359 | 3300027907 | Ga0207428_11252088 | Ga0207428_112520881 | 89 |
| 360 | 3300028380 | Ga0268265_10024557 | Ga0268265_100245575 | 89 |
| 361 | 3300028381 | Ga0268264_10630298 | Ga0268264_106302983 | 89 |
| 362 | 3300028381 | Ga0268264_10664707 | Ga0268264_106647072 | 89 |
| 363 | 3300031548 | Ga0307408_100019353 | Ga0307408_1000193534 | 89 |
| 364 | 3300031548 | Ga0307408_100598345 | Ga0307408_1005983452 | 89 |
| 365 | 3300031548 | Ga0307408_100608332 | Ga0307408_1006083322 | 89 |
| 366 | 3300031548 | Ga0307408_101157323 | Ga0307408_1011573231 | 89 |
| 367 | 3300031731 | Ga0307405_10068590 | Ga0307405_100685903 | 89 |
| 368 | 3300031731 | Ga0307405_10457013 | Ga0307405_104570133 | 89 |
| 369 | 3300031824 | Ga0307413_11010410 | Ga0307413_110104102 | 89 |
| 370 | 3300031911 | Ga0307412_10079111 | Ga0307412_100791113 | 89 |
| 371 | 3300031995 | Ga0307409_100201694 | Ga0307409_1002016944 | 89 |
| 372 | 3300032002 | Ga0307416_100120640 | Ga0307416_1001206402 | 89 |
| 373 | 3300032005 | Ga0307411_12236046 | Ga0307411_122360462 | 89 |
| 374 | 3300032126 | Ga0307415_100255359 | Ga0307415_1002553591 | 89 |
| 375 | 3300034817 | Ga0373948_0078945 | Ga0373948_0078945_204_479 | 89 |
| 376 | 3300034817 | Ga0373948_0191570 | Ga0373948_0191570_58_336 | 89 |
| 377 | 3300034820 | Ga0373959_0018418 | Ga0373959_0018418_270_545 | 89 |
| 378 | 3300035083 | Ga0373926_0369777 | Ga0373926_0369777_136_444 | 89 |
| 379 | 3300035088 | Ga0373940_0020189 | Ga0373940_0020189_1163_1438 | 89 |
| 380 | 3300035088 | Ga0373940_0064400 | Ga0373940_0064400_357_635 | 89 |
| 381 | 3300035090 | Ga0373949_0027963 | Ga0373949_0027963_762_1037 | 89 |
| 382 | 3300035091 | Ga0373951_0003783 | Ga0373951_0003783_2832_3107 | 89 |
| 383 | 3300035112 | Ga0373932_0024625 | Ga0373932_0024625_432_710 | 89 |
| 384 | 3300035112 | Ga0373932_0042632 | Ga0373932_0042632_193_471 | 89 |
| 385 | 3300035112 | Ga0373932_0221219 | Ga0373932_0221219_89_400 | 89 |
| 386 | 3300035115 | Ga0373941_0008250 | Ga0373941_0008250_2019_2297 | 89 |
| 387 | 3300035121 | Ga0373960_0096028 | Ga0373960_0096028_316_591 | 89 |
| 388 | 3300035121 | Ga0373960_0257290 | Ga0373960_0257290_67_345 | 89 |
| 389 | 3300035207 | Ga0373942_0078924 | Ga0373942_0078924_146_421 | 89 |
| 390 | 3300035207 | Ga0373942_0244663 | Ga0373942_0244663_100_378 | 89 |
| 391 | 3300035241 | Ga0373961_0154908 | Ga0373961_0154908_41_349 | 89 |
| 392 | 3300035242 | Ga0373962_0036421 | Ga0373962_0036421_683_958 | 89 |
| 393 | 3300035691 | Ga0373931_0002121 | Ga0373931_0002121_63_341 | 89 |
| 394 | 3300035691 | Ga0373931_0174321 | Ga0373931_0174321_339_614 | 89 |
| 395 | 3300035691 | Ga0373931_1069353 | Ga0373931_1069353_127_438 | 89 |
| 396 | 3300038443 | Ga0395901_2149756 | Ga0395901_2149756_130_447 | 89 |
| 397 | 3300038996 | Ga0242420_014824 | Ga0242420_014824_754_1062 | 89 |
| 398 | 3300038996 | Ga0242420_091729 | Ga0242420_091729_348_623 | 89 |
| 399 | 3300042005 | Ga0439448_0000194 | Ga0439448_0000194_1659_1934 | 89 |
| 400 | 3300042008 | Ga0439450_032463 | Ga0439450_032463_416_745 | 89 |
| 401 | 3300042012 | Ga0439455_0019620 | Ga0439455_0019620_598_873 | 89 |
| 402 | 3300042130 | Ga0450892_042802 | Ga0450892_042802_203_478 | 89 |
| 403 | 3300042134 | Ga0450898_031285 | Ga0450898_031285_166_441 | 89 |
| 404 | 3300042144 | Ga0450889_025175 | Ga0450889_025175_151_426 | 89 |
| 405 | 3300042157 | Ga0439458_0005713 | Ga0439458_0005713_523_798 | 89 |
| 406 | 3300042438 | Ga0439459_0000085 | Ga0439459_0000085_2712_2987 | 89 |
| 407 | 3300042438 | Ga0439459_0248764 | Ga0439459_0248764_189_464 | 89 |
| 408 | 3300042439 | Ga0439464_0050594 | Ga0439464_0050594_469_798 | 89 |
| 409 | 3300042461 | Ga0439460_0000040 | Ga0439460_0000040_5984_6313 | 89 |
| 410 | 3300042461 | Ga0439460_0230921 | Ga0439460_0230921_70_345 | 89 |
| 411 | 3300042876 | Ga0451577_0023293 | Ga0451577_0023293_3239_3514 | 89 |
| 412 | 3300042876 | Ga0451577_0071964 | Ga0451577_0071964_2142_2471 | 89 |
| 413 | 3300042876 | Ga0451577_0153712 | Ga0451577_0153712_1686_1961 | 89 |
| 414 | 3300042876 | Ga0451577_1165076 | Ga0451577_1165076_66_344 | 89 |
| 415 | 3300044673 | Ga0453683_0046226 | Ga0453683_0046226_1552_1827 | 89 |
| 416 | 3300044673 | Ga0453683_0080277 | Ga0453683_0080277_555_833 | 89 |
| 417 | 3300044673 | Ga0453683_0860137 | Ga0453683_0860137_218_493 | 89 |
| 418 | 3300044712 | Ga0453684_0030395 | Ga0453684_0030395_1873_2148 | 89 |
| 419 | 3300044712 | Ga0453684_0334218 | Ga0453684_0334218_696_971 | 89 |
| 420 | 3300044712 | Ga0453684_0378239 | Ga0453684_0378239_737_1045 | 89 |
| 421 | 3300045051 | Ga0451576_0065930 | Ga0451576_0065930_1084_1392 | 89 |
| 422 | 3300045051 | Ga0451576_0120397 | Ga0451576_0120397_2268_2543 | 89 |
| 423 | 3300045051 | Ga0451576_0135218 | Ga0451576_0135218_1227_1556 | 89 |
| 424 | 3300045051 | Ga0451576_0225154 | Ga0451576_0225154_1070_1345 | 89 |
| 425 | 3300045051 | Ga0451576_0263860 | Ga0451576_0263860_1465_1740 | 89 |
| 426 | 3300046499 | Ga0495594_0239046 | Ga0495594_0239046_490_768 | 89 |
| 427 | 3300048903 | Ga0496100_1168968 | Ga0496100_1168968_173_451 | 89 |
| 428 | 3300048905 | Ga0496102_0101668 | Ga0496102_0101668_2128_2403 | 89 |
| 429 | 3300048905 | Ga0496102_1185707 | Ga0496102_1185707_261_539 | 89 |
| 430 | 3300048907 | Ga0496104_1135177 | Ga0496104_1135177_314_589 | 89 |
| 431 | 3300048909 | Ga0496106_0012725 | Ga0496106_0012725_5437_5715 | 89 |
| 432 | 3300048909 | Ga0496106_0481310 | Ga0496106_0481310_502_780 | 89 |
| 433 | 3300048910 | Ga0496107_0169182 | Ga0496107_0169182_513_791 | 89 |
| 434 | 3300048911 | Ga0496108_0442272 | Ga0496108_0442272_692_967 | 89 |
| 435 | 3300048915 | Ga0496112_0104155 | Ga0496112_0104155_1155_1430 | 89 |
| 436 | 3300049129 | Ga0501309_030418 | Ga0501309_030418_228_506 | 89 |
| 437 | 3300049522 | Ga0501299_120183 | Ga0501299_120183_254_532 | 89 |
| 438 | 3300049522 | Ga0501299_174364 | Ga0501299_174364_10_288 | 89 |
| 439 | 3300049568 | Ga0501031_0191196 | Ga0501031_0191196_202_531 | 89 |
| 440 | 3300049568 | Ga0501031_0284217 | Ga0501031_0284217_341_619 | 89 |
| 441 | 3300049569 | Ga0501032_0259205 | Ga0501032_0259205_571_849 | 89 |
| 442 | 3300049569 | Ga0501032_0359753 | Ga0501032_0359753_428_703 | 89 |
| 443 | 3300049570 | Ga0501033_0030492 | Ga0501033_0030492_3623_3901 | 89 |
| 444 | 3300049570 | Ga0501033_0036137 | Ga0501033_0036137_308_637 | 89 |
| 445 | 3300049570 | Ga0501033_0140789 | Ga0501033_0140789_270_599 | 89 |
| 446 | 3300049572 | Ga0501036_0038426 | Ga0501036_0038426_3070_3399 | 89 |
| 447 | 3300049572 | Ga0501036_0113302 | Ga0501036_0113302_653_931 | 89 |
| 448 | 3300049572 | Ga0501036_0231144 | Ga0501036_0231144_78_347 | 89 |
| 449 | 3300049572 | Ga0501036_0573092 | Ga0501036_0573092_399_674 | 89 |
| 450 | 3300049572 | Ga0501036_0904762 | Ga0501036_0904762_296_574 | 89 |
| 451 | 3300049572 | Ga0501036_1073062 | Ga0501036_1073062_139_417 | 89 |
| 452 | 3300049573 | Ga0501037_0123077 | Ga0501037_0123077_112_390 | 89 |
| 453 | 3300049574 | Ga0501038_0029104 | Ga0501038_0029104_2981_3310 | 89 |
| 454 | 3300049574 | Ga0501038_0147601 | Ga0501038_0147601_1557_1835 | 89 |
| 455 | 3300049574 | Ga0501038_0581108 | Ga0501038_0581108_340_669 | 89 |
| 456 | 3300049574 | Ga0501038_0582981 | Ga0501038_0582981_392_670 | 89 |
| 457 | 3300049574 | Ga0501038_0938840 | Ga0501038_0938840_120_398 | 89 |
| 458 | 3300049575 | Ga0501039_0023016 | Ga0501039_0023016_1227_1505 | 89 |
| 459 | 3300049575 | Ga0501039_0045755 | Ga0501039_0045755_1134_1463 | 89 |
| 460 | 3300049575 | Ga0501039_0254450 | Ga0501039_0254450_837_1151 | 89 |
| 461 | 3300049575 | Ga0501039_0308011 | Ga0501039_0308011_550_825 | 89 |
| 462 | 3300049575 | Ga0501039_1212281 | Ga0501039_1212281_179_508 | 89 |
| 463 | 3300049575 | Ga0501039_1253949 | Ga0501039_1253949_239_517 | 89 |
| 464 | 3300049576 | Ga0501040_0003866 | Ga0501040_0003866_5517_5846 | 89 |
| 465 | 3300049576 | Ga0501040_0021147 | Ga0501040_0021147_2631_2906 | 89 |
| 466 | 3300049576 | Ga0501040_0177448 | Ga0501040_0177448_1200_1478 | 89 |
| 467 | 3300049576 | Ga0501040_0460982 | Ga0501040_0460982_437_715 | 89 |
| 468 | 3300049576 | Ga0501040_0504342 | Ga0501040_0504342_234_509 | 89 |
| 469 | 3300049576 | Ga0501040_1097577 | Ga0501040_1097577_264_542 | 89 |
| 470 | 3300049577 | Ga0501041_0019623 | Ga0501041_0019623_3329_3604 | 89 |
| 471 | 3300049577 | Ga0501041_0047897 | Ga0501041_0047897_325_600 | 89 |
| 472 | 3300049577 | Ga0501041_0078068 | Ga0501041_0078068_1444_1773 | 89 |
| 473 | 3300049577 | Ga0501041_0093261 | Ga0501041_0093261_472_801 | 89 |
| 474 | 3300049578 | Ga0501042_0000478 | Ga0501042_0000478_10833_11162 | 89 |
| 475 | 3300049578 | Ga0501042_0017246 | Ga0501042_0017246_2173_2502 | 89 |
| 476 | 3300049578 | Ga0501042_0171073 | Ga0501042_0171073_485_763 | 89 |
| 477 | 3300049578 | Ga0501042_0653097 | Ga0501042_0653097_277_585 | 89 |
| 478 | 3300049578 | Ga0501042_0684994 | Ga0501042_0684994_111_386 | 89 |
| 479 | 3300049578 | Ga0501042_1329073 | Ga0501042_1329073_34_360 | 89 |
| 480 | 3300049579 | Ga0501043_0151069 | Ga0501043_0151069_516_845 | 89 |
| 481 | 3300049579 | Ga0501043_0219013 | Ga0501043_0219013_371_649 | 89 |
| 482 | 3300049579 | Ga0501043_0571621 | Ga0501043_0571621_496_825 | 89 |
| 483 | 3300049580 | Ga0501046_0000115 | Ga0501046_0000115_53872_54201 | 89 |
| 484 | 3300049580 | Ga0501046_0069930 | Ga0501046_0069930_1682_2011 | 89 |
| 485 | 3300049580 | Ga0501046_0534665 | Ga0501046_0534665_67_345 | 89 |
| 486 | 3300049582 | Ga0501048_0004927 | Ga0501048_0004927_4517_4846 | 89 |
| 487 | 3300049582 | Ga0501048_0062307 | Ga0501048_0062307_1284_1562 | 89 |
| 488 | 3300049582 | Ga0501048_0068115 | Ga0501048_0068115_135_413 | 89 |
| 489 | 3300049582 | Ga0501048_0157964 | Ga0501048_0157964_484_813 | 89 |
| 490 | 3300049582 | Ga0501048_0349342 | Ga0501048_0349342_536_811 | 89 |
| 491 | 3300049583 | Ga0501067_0043144 | Ga0501067_0043144_1664_1939 | 89 |
| 492 | 3300049584 | Ga0501068_0062457 | Ga0501068_0062457_229_558 | 89 |
| 493 | 3300049585 | Ga0501069_0194657 | Ga0501069_0194657_555_863 | 89 |
| 494 | 3300049586 | Ga0501070_1240019 | Ga0501070_1240019_180_488 | 89 |
| 495 | 3300049587 | Ga0501071_0286918 | Ga0501071_0286918_259_537 | 89 |
| 496 | 3300049587 | Ga0501071_0354077 | Ga0501071_0354077_554_883 | 89 |
| 497 | 3300049587 | Ga0501071_0389942 | Ga0501071_0389942_98_376 | 89 |
| 498 | 3300049587 | Ga0501071_0538360 | Ga0501071_0538360_496_825 | 89 |
| 499 | 3300049587 | Ga0501071_0892757 | Ga0501071_0892757_292_561 | 89 |
| 500 | 3300049588 | Ga0501072_0007495 | Ga0501072_0007495_4186_4515 | 89 |
| 501 | 3300049588 | Ga0501072_0010133 | Ga0501072_0010133_5515_5793 | 89 |
| 502 | 3300049588 | Ga0501072_0076053 | Ga0501072_0076053_1942_2271 | 89 |
| 503 | 3300049588 | Ga0501072_0096155 | Ga0501072_0096155_895_1170 | 89 |
| 504 | 3300049588 | Ga0501072_0249975 | Ga0501072_0249975_217_525 | 89 |
| 505 | 3300049588 | Ga0501072_0476264 | Ga0501072_0476264_558_833 | 89 |
| 506 | 3300049589 | Ga0501073_0252740 | Ga0501073_0252740_781_1059 | 89 |
| 507 | 3300049589 | Ga0501073_0489971 | Ga0501073_0489971_241_570 | 89 |
| 508 | 3300049589 | Ga0501073_0647770 | Ga0501073_0647770_59_388 | 89 |
| 509 | 3300049590 | Ga0501074_0036269 | Ga0501074_0036269_1885_2214 | 89 |
| 510 | 3300049590 | Ga0501074_0443316 | Ga0501074_0443316_571_846 | 89 |
| 511 | 3300049591 | Ga0501075_0000143 | Ga0501075_0000143_11352_11681 | 89 |
| 512 | 3300049591 | Ga0501075_0008042 | Ga0501075_0008042_4977_5306 | 89 |
| 513 | 3300049591 | Ga0501075_0021792 | Ga0501075_0021792_950_1225 | 89 |
| 514 | 3300049591 | Ga0501075_0038227 | Ga0501075_0038227_3148_3423 | 89 |
| 515 | 3300049591 | Ga0501075_0061567 | Ga0501075_0061567_1214_1492 | 89 |
| 516 | 3300049591 | Ga0501075_0173362 | Ga0501075_0173362_806_1084 | 89 |
| 517 | 3300049591 | Ga0501075_0183149 | Ga0501075_0183149_1028_1306 | 89 |
| 518 | 3300049591 | Ga0501075_0423340 | Ga0501075_0423340_146_454 | 89 |
| 519 | 3300049591 | Ga0501075_0607929 | Ga0501075_0607929_458_787 | 89 |
| 520 | 3300049592 | Ga0501076_0005597 | Ga0501076_0005597_1975_2304 | 89 |
| 521 | 3300049592 | Ga0501076_0006074 | Ga0501076_0006074_4370_4699 | 89 |
| 522 | 3300049592 | Ga0501076_0135832 | Ga0501076_0135832_1514_1789 | 89 |
| 523 | 3300049592 | Ga0501076_0148837 | Ga0501076_0148837_1353_1631 | 89 |
| 524 | 3300049592 | Ga0501076_0151981 | Ga0501076_0151981_1046_1321 | 89 |
| 525 | 3300049592 | Ga0501076_0335126 | Ga0501076_0335126_506_781 | 89 |
| 526 | 3300049593 | Ga0501077_0020563 | Ga0501077_0020563_3595_3873 | 89 |
| 527 | 3300049593 | Ga0501077_0037087 | Ga0501077_0037087_226_501 | 89 |
| 528 | 3300049593 | Ga0501077_0044495 | Ga0501077_0044495_564_842 | 89 |
| 529 | 3300049593 | Ga0501077_0044873 | Ga0501077_0044873_2515_2784 | 89 |
| 530 | 3300049593 | Ga0501077_0072508 | Ga0501077_0072508_1233_1562 | 89 |
| 531 | 3300049593 | Ga0501077_0116959 | Ga0501077_0116959_210_539 | 89 |
| 532 | 3300049593 | Ga0501077_0625212 | Ga0501077_0625212_243_551 | 89 |
| 533 | 3300049705 | Ga0501225_0209263 | Ga0501225_0209263_214_492 | 89 |
| 534 | 3300049707 | Ga0501234_057341 | Ga0501234_057341_71_349 | 89 |
| 535 | 3300049741 | Ga0501079_0002407 | Ga0501079_0002407_1496_1825 | 89 |
| 536 | 3300049741 | Ga0501079_0005017 | Ga0501079_0005017_4081_4356 | 89 |
| 537 | 3300049741 | Ga0501079_0015441 | Ga0501079_0015441_2180_2458 | 89 |
| 538 | 3300049741 | Ga0501079_0015801 | Ga0501079_0015801_1717_1992 | 89 |
| 539 | 3300049741 | Ga0501079_0018848 | Ga0501079_0018848_3371_3700 | 89 |
| 540 | 3300049741 | Ga0501079_0061444 | Ga0501079_0061444_1760_2038 | 89 |
| 541 | 3300049741 | Ga0501079_0222386 | Ga0501079_0222386_833_1162 | 89 |
| 542 | 3300049741 | Ga0501079_0364557 | Ga0501079_0364557_748_1023 | 89 |
| 543 | 3300049741 | Ga0501079_1209308 | Ga0501079_1209308_58_336 | 89 |
| 544 | 3300049742 | Ga0501080_0001618 | Ga0501080_0001618_2149_2478 | 89 |
| 545 | 3300049742 | Ga0501080_0052107 | Ga0501080_0052107_1139_1468 | 89 |
| 546 | 3300049742 | Ga0501080_0132422 | Ga0501080_0132422_1567_1845 | 89 |
| 547 | 3300049742 | Ga0501080_0139189 | Ga0501080_0139189_34_312 | 89 |
| 548 | 3300049742 | Ga0501080_0211939 | Ga0501080_0211939_1197_1472 | 89 |
| 549 | 3300049742 | Ga0501080_0215836 | Ga0501080_0215836_310_585 | 89 |
| 550 | 3300049742 | Ga0501080_1135773 | Ga0501080_1135773_336_659 | 89 |
| 551 | 3300049743 | Ga0501081_0009979 | Ga0501081_0009979_5081_5410 | 89 |
| 552 | 3300049743 | Ga0501081_0020851 | Ga0501081_0020851_119_394 | 89 |
| 553 | 3300049743 | Ga0501081_0026034 | Ga0501081_0026034_1845_2123 | 89 |
| 554 | 3300049743 | Ga0501081_0026773 | Ga0501081_0026773_3520_3849 | 89 |
| 555 | 3300049743 | Ga0501081_0046408 | Ga0501081_0046408_1000_1275 | 89 |
| 556 | 3300049743 | Ga0501081_0102421 | Ga0501081_0102421_502_780 | 89 |
| 557 | 3300049743 | Ga0501081_0224295 | Ga0501081_0224295_756_1034 | 89 |
| 558 | 3300049743 | Ga0501081_0465812 | Ga0501081_0465812_476_751 | 89 |
| 559 | 3300049743 | Ga0501081_0889350 | Ga0501081_0889350_111_389 | 89 |
| 560 | 3300049743 | Ga0501081_0943615 | Ga0501081_0943615_181_456 | 89 |
| 561 | 3300049744 | Ga0501083_0014076 | Ga0501083_0014076_5151_5480 | 89 |
| 562 | 3300049744 | Ga0501083_0044283 | Ga0501083_0044283_2350_2679 | 89 |
| 563 | 3300049744 | Ga0501083_0139766 | Ga0501083_0139766_696_974 | 89 |
| 564 | 3300049744 | Ga0501083_0330712 | Ga0501083_0330712_72_350 | 89 |
| 565 | 3300049822 | Ga0501035_0041447 | Ga0501035_0041447_3439_3768 | 89 |
| 566 | 3300049822 | Ga0501035_0567352 | Ga0501035_0567352_129_455 | 89 |
| 567 | 3300049824 | Ga0501045_0001069 | Ga0501045_0001069_6281_6559 | 89 |
| 568 | 3300049824 | Ga0501045_0003469 | Ga0501045_0003469_4998_5327 | 89 |
| 569 | 3300049824 | Ga0501045_0041722 | Ga0501045_0041722_156_467 | 89 |
| 570 | 3300049824 | Ga0501045_0052413 | Ga0501045_0052413_2611_2943 | 89 |
| 571 | 3300049824 | Ga0501045_0062802 | Ga0501045_0062802_425_754 | 89 |
| 572 | 3300049824 | Ga0501045_0068810 | Ga0501045_0068810_1713_1988 | 89 |
| 573 | 3300049824 | Ga0501045_0147033 | Ga0501045_0147033_557_835 | 89 |
| 574 | 3300049824 | Ga0501045_0244661 | Ga0501045_0244661_787_1062 | 89 |
| 575 | 3300049824 | Ga0501045_0355480 | Ga0501045_0355480_710_1018 | 89 |
| 576 | 3300050507 | nmdc:mga05p37_110911_c1 | nmdc:mga05p37_110911_c1_829_1143 | 89 |
| 577 | 3300050507 | nmdc:mga05p37_114229_c1 | nmdc:mga05p37_114229_c1_2098_2373 | 89 |
| 578 | 3300050507 | nmdc:mga05p37_232223_c1 | nmdc:mga05p37_232223_c1_1337_1612 | 89 |
| 579 | 3300050507 | nmdc:mga05p37_29443_c1 | nmdc:mga05p37_29443_c1_5115_5429 | 89 |
| 580 | 3300050507 | nmdc:mga05p37_2_c1 | nmdc:mga05p37_2_c1_87873_88151 | 89 |
| 581 | 3300050507 | nmdc:mga05p37_515013_c1 | nmdc:mga05p37_515013_c1_756_1070 | 89 |
| 582 | 3300050507 | nmdc:mga05p37_522927_c1 | nmdc:mga05p37_522927_c1_236_514 | 89 |
| 583 | 3300050507 | nmdc:mga05p37_828547_c1 | nmdc:mga05p37_828547_c1_688_966 | 89 |
| 584 | 3300050507 | nmdc:mga05p37_844240_c1 | nmdc:mga05p37_844240_c1_536_814 | 89 |
| 585 | 3300050508 | nmdc:mga09592_54253_c1 | nmdc:mga09592_54253_c1_1446_1724 | 89 |
| 586 | 3300050508 | nmdc:mga09592_55509_c1 | nmdc:mga09592_55509_c1_881_1195 | 89 |
| 587 | 3300050508 | nmdc:mga09592_902088_c1 | nmdc:mga09592_902088_c1_258_566 | 89 |
| 588 | 3300050508 | nmdc:mga09592_959_c1 | nmdc:mga09592_959_c1_4797_5075 | 89 |
| 589 | 3300050509 | nmdc:mga0qj67_109060_c2 | nmdc:mga0qj67_109060_c2_675_953 | 89 |
| 590 | 3300050509 | nmdc:mga0qj67_183231_c1 | nmdc:mga0qj67_183231_c1_832_1146 | 89 |
| 591 | 3300050509 | nmdc:mga0qj67_64225_c1 | nmdc:mga0qj67_64225_c1_2161_2439 | 89 |
| 592 | 3300050510 | nmdc:mga06r32_101849_c1 | nmdc:mga06r32_101849_c1_139_417 | 89 |
| 593 | 3300050510 | nmdc:mga06r32_116859_c1 | nmdc:mga06r32_116859_c1_87_365 | 89 |
| 594 | 3300050510 | nmdc:mga06r32_1317738_c1 | nmdc:mga06r32_1317738_c1_114_392 | 89 |
| 595 | 3300050510 | nmdc:mga06r32_163181_c1 | nmdc:mga06r32_163181_c1_701_1015 | 89 |
| 596 | 3300050510 | nmdc:mga06r32_673070_c1 | nmdc:mga06r32_673070_c1_551_865 | 89 |
| 597 | 3300050510 | nmdc:mga06r32_695_c1 | nmdc:mga06r32_695_c1_2152_2430 | 89 |
| 598 | 3300050511 | nmdc:mga08y16_254871_c1 | nmdc:mga08y16_254871_c1_1186_1464 | 89 |
| 599 | 3300050512 | nmdc:mga0n895_207725_c1 | nmdc:mga0n895_207725_c1_709_987 | 89 |
| 600 | 3300050512 | nmdc:mga0n895_226753_c2 | nmdc:mga0n895_226753_c2_326_634 | 89 |
| 601 | 3300050512 | nmdc:mga0n895_667055_c1 | nmdc:mga0n895_667055_c1_705_980 | 89 |
| 602 | 3300050512 | nmdc:mga0n895_7354_c1 | nmdc:mga0n895_7354_c1_1392_1670 | 89 |
| 603 | 3300050513 | nmdc:mga0rr50_1125703_c1 | nmdc:mga0rr50_1125703_c1_181_456 | 89 |
| 604 | 3300050513 | nmdc:mga0rr50_184072_c1 | nmdc:mga0rr50_184072_c1_647_922 | 89 |
| 605 | 3300050513 | nmdc:mga0rr50_305441_c1 | nmdc:mga0rr50_305441_c1_546_821 | 89 |
| 606 | 3300050513 | nmdc:mga0rr50_466143_c1 | nmdc:mga0rr50_466143_c1_25_303 | 89 |
| 607 | 3300050513 | nmdc:mga0rr50_70814_c1 | nmdc:mga0rr50_70814_c1_1126_1404 | 89 |
| 608 | 3300050513 | nmdc:mga0rr50_813048_c1 | nmdc:mga0rr50_813048_c1_344_658 | 89 |
| 609 | 3300050514 | nmdc:mga08x19_114603_c1 | nmdc:mga08x19_114603_c1_935_1243 | 89 |
| 610 | 3300050514 | nmdc:mga08x19_1284594_c1 | nmdc:mga08x19_1284594_c1_107_385 | 89 |
| 611 | 3300050514 | nmdc:mga08x19_158420_c1 | nmdc:mga08x19_158420_c1_669_944 | 89 |
| 612 | 3300050514 | nmdc:mga08x19_20105_c1 | nmdc:mga08x19_20105_c1_2462_2737 | 89 |
| 613 | 3300050515 | nmdc:mga0a205_312010_c1 | nmdc:mga0a205_312010_c1_522_836 | 89 |
| 614 | 3300050515 | nmdc:mga0a205_348483_c1 | nmdc:mga0a205_348483_c1_17_295 | 89 |
| 615 | 3300050515 | nmdc:mga0a205_41704_c1 | nmdc:mga0a205_41704_c1_3214_3522 | 89 |
| 616 | 3300050515 | nmdc:mga0a205_7120_c1 | nmdc:mga0a205_7120_c1_423_698 | 89 |
| 617 | 3300050515 | nmdc:mga0a205_805658_c1 | nmdc:mga0a205_805658_c1_384_698 | 89 |
| 618 | 3300054114 | Ga0501084_0012422 | Ga0501084_0012422_5362_5691 | 89 |
| 619 | 3300054114 | Ga0501084_0018019 | Ga0501084_0018019_1694_1972 | 89 |
| 620 | 3300054114 | Ga0501084_0022793 | Ga0501084_0022793_568_897 | 89 |
| 621 | 3300054114 | Ga0501084_0101974 | Ga0501084_0101974_1144_1419 | 89 |
| 622 | 3300054114 | Ga0501084_0124719 | Ga0501084_0124719_1374_1703 | 89 |
| 623 | 3300054114 | Ga0501084_0223534 | Ga0501084_0223534_49_363 | 89 |
| 624 | 3300059421 | Ga0590071_087421 | Ga0590071_087421_309_587 | 89 |
| 625 | 3300060353 | Ga0501082_0001107 | Ga0501082_0001107_5290_5619 | 89 |
| 626 | 3300060353 | Ga0501082_0058304 | Ga0501082_0058304_1273_1551 | 89 |
| 627 | 3300060353 | Ga0501082_0116747 | Ga0501082_0116747_496_825 | 89 |
| 628 | 3300060353 | Ga0501082_0150954 | Ga0501082_0150954_475_750 | 89 |
| 629 | 3300060353 | Ga0501082_0181043 | Ga0501082_0181043_800_1075 | 89 |
| 630 | 3300060353 | Ga0501082_0302735 | Ga0501082_0302735_306_584 | 89 |
| 631 | 3300060353 | Ga0501082_0518908 | Ga0501082_0518908_238_513 | 89 |
| 632 | 3300060353 | Ga0501082_0575423 | Ga0501082_0575423_511_789 | 89 |
| 633 | 3300060353 | Ga0501082_0999712 | Ga0501082_0999712_104_379 | 89 |
| 634 | 3300061734 | Ga0530510_0005890 | Ga0530510_0005890_3466_3795 | 89 |
| 635 | 3300061734 | Ga0530510_0013587 | Ga0530510_0013587_1440_1754 | 89 |
| 636 | 3300061734 | Ga0530510_0037417 | Ga0530510_0037417_2417_2692 | 89 |
| 637 | 3300061734 | Ga0530510_0043068 | Ga0530510_0043068_1014_1292 | 89 |
| 638 | 3300061734 | Ga0530510_0239184 | Ga0530510_0239184_852_1130 | 89 |
| 639 | 3300061734 | Ga0530510_0274035 | Ga0530510_0274035_830_1138 | 89 |
| 640 | 3300061734 | Ga0530510_0296212 | Ga0530510_0296212_181_459 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar