F471692

General Info

Members Datasets Scaffolds Average Seq Length
640 276 640 94

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_11097359|Ga0207646_110973592
Length 114
Sequence MKEIAGFDAALPQFEAAGAQVVGVSADHQKTLEAFAKQTGTKHLLLSDFRSPRQMLPQYDAMVTDEKSPIFRYAKRAYFIIDKQGTVRYVKIMDNPLNLLDANEVLAELKKVTG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
210 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
211 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
212 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
213 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1045726 3300001915 Bacteria 644
2 rootL2_10186341 3300003322 Bacteria 1987
3 JGI25407J50210_10146549 3300003373 Bacteria 581
4 JGI25405J52794_10018580 3300003911 Unclassified 1388
5 Ga0058863_11697093 3300004799 Unclassified 593
6 Ga0058862_12575548 3300004803 Bacteria 1357
7 Ga0065712_10311569 3300005290 Bacteria 843
8 Ga0065715_10308892 3300005293 Bacteria 1025
9 Ga0065707_10817523 3300005295 Bacteria 593
10 Ga0070676_10000771 3300005328 Bacteria 15771
11 Ga0070683_100101507 3300005329 Bacteria 2709
12 Ga0070690_100436828 3300005330 Bacteria 968
13 Ga0068869_100000503 3300005334 Bacteria 21804
14 Ga0070666_10135337 3300005335 Bacteria 1714
15 Ga0070666_11412568 3300005335 Bacteria 520
16 Ga0070680_100002337 3300005336 Bacteria 14007
17 Ga0070680_100107633 3300005336 Bacteria 2319
18 Ga0070680_100302435 3300005336 Unclassified 1357
19 Ga0070682_100000182 3300005337 Bacteria 47152
20 Ga0068868_100009025 3300005338 Bacteria 7156
21 Ga0070660_100002694 3300005339 Bacteria 12201
22 Ga0070689_100017569 3300005340 Bacteria 5258
23 Ga0070689_100091848 3300005340 Bacteria 2394
24 Ga0070689_100615708 3300005340 Bacteria 942
25 Ga0070691_10003395 3300005341 Bacteria 7162
26 Ga0070691_10011353 3300005341 Bacteria 4067
27 Ga0070691_10014611 3300005341 Bacteria 3604
28 Ga0070691_10656923 3300005341 Archaea 625
29 Ga0070687_100322871 3300005343 Bacteria 987
30 Ga0070661_100000280 3300005344 Bacteria 41161
31 Ga0070692_10001685 3300005345 Bacteria 8184
32 Ga0070668_100400242 3300005347 Bacteria 1172
33 Ga0070668_100668191 3300005347 Bacteria 914
34 Ga0070669_100011809 3300005353 Bacteria 6196
35 Ga0070669_100187063 3300005353 Unclassified 1623
36 Ga0070669_101521708 3300005353 Bacteria 582
37 Ga0070674_101545962 3300005356 Unclassified 597
38 Ga0070659_100000500 3300005366 Bacteria 28860
39 Ga0070667_100184281 3300005367 Bacteria 1847
40 Ga0070703_10002816 3300005406 Bacteria 4982
41 Ga0070703_10038737 3300005406 Bacteria 1475
42 Ga0070709_10027601 3300005434 Bacteria 3377
43 Ga0070713_100935715 3300005436 Unclassified 834
44 Ga0070701_10084605 3300005438 Bacteria 1725
45 Ga0070701_10138385 3300005438 Bacteria 1390
46 Ga0070701_11010048 3300005438 Bacteria 581
47 Ga0070705_100001910 3300005440 Bacteria 10703
48 Ga0070705_100321719 3300005440 Unclassified 1117
49 Ga0070705_100344756 3300005440 Unclassified 1084
50 Ga0070705_100840538 3300005440 Bacteria 734
51 Ga0070700_100264836 3300005441 Bacteria 1239
52 Ga0070694_100002581 3300005444 Bacteria 10702
53 Ga0070694_100010952 3300005444 Bacteria 5609
54 Ga0070694_100034533 3300005444 Bacteria 3336
55 Ga0070694_100064642 3300005444 Bacteria 2505
56 Ga0070694_100170521 3300005444 Bacteria 1603
57 Ga0070694_100289714 3300005444 Unclassified 1251
58 Ga0070694_101589304 3300005444 Archaea 555
59 Ga0070708_100175955 3300005445 Bacteria 1999
60 Ga0070708_100245107 3300005445 Bacteria 1683
61 Ga0070708_100300784 3300005445 Bacteria 1511
62 Ga0070708_100340385 3300005445 Bacteria 1414
63 Ga0070708_100360436 3300005445 Bacteria 1370
64 Ga0070708_101214336 3300005445 Unclassified 705
65 Ga0070708_101318679 3300005445 Unclassified 674
66 Ga0070663_100001673 3300005455 Bacteria 12284
67 Ga0070663_100295907 3300005455 Unclassified 1294
68 Ga0070662_100001013 3300005457 Bacteria 17181
69 Ga0070662_100025074 3300005457 Unclassified 4115
70 Ga0070662_100213792 3300005457 Bacteria 1536
71 Ga0070681_10027811 3300005458 Bacteria 5686
72 Ga0070681_10161622 3300005458 Bacteria 2164
73 Ga0070681_10675929 3300005458 Bacteria 948
74 Ga0068867_100045002 3300005459 Bacteria 3235
75 Ga0068867_100197973 3300005459 Bacteria 1607
76 Ga0070706_100005525 3300005467 Bacteria 12032
77 Ga0070706_100080671 3300005467 Bacteria 3013
78 Ga0070706_100242845 3300005467 Bacteria 1681
79 Ga0070706_100902339 3300005467 Bacteria 816
80 Ga0070707_100023916 3300005468 Bacteria 5779
81 Ga0070707_100112317 3300005468 Bacteria 2643
82 Ga0070707_100327546 3300005468 Bacteria 1488
83 Ga0070707_100365081 3300005468 Bacteria 1403
84 Ga0070707_100890467 3300005468 Bacteria 854
85 Ga0070698_100011493 3300005471 Bacteria 9394
86 Ga0070698_100058520 3300005471 Bacteria 3896
87 Ga0070698_100079769 3300005471 Bacteria 3269
88 Ga0070698_100479027 3300005471 Bacteria 1181
89 Ga0070698_100982987 3300005471 Unclassified 791
90 Ga0070698_101864560 3300005471 Bacteria 554
91 Ga0070699_100007156 3300005518 Bacteria 9695
92 Ga0070699_100011450 3300005518 Bacteria 7659
93 Ga0070699_100018159 3300005518 Bacteria 6043
94 Ga0070699_100051526 3300005518 Plasmid 3563
95 Ga0070699_100130602 3300005518 Bacteria 2214
96 Ga0070679_100014766 3300005530 Bacteria 7505
97 Ga0070679_101873072 3300005530 Archaea 548
98 Ga0070684_100441758 3300005535 Bacteria 1202
99 Ga0070697_100004998 3300005536 Bacteria 10183
100 Ga0070697_100090247 3300005536 Bacteria 2532
101 Ga0070697_100232861 3300005536 Bacteria 1571
102 Ga0070697_100542108 3300005536 Bacteria 1020
103 Ga0070697_100782531 3300005536 Unclassified 844
104 Ga0068853_100000088 3300005539 Bacteria 63120
105 Ga0070672_100042006 3300005543 Bacteria 3519
106 Ga0070672_100368512 3300005543 Bacteria 1227
107 Ga0070686_100333331 3300005544 Unclassified 1135
108 Ga0070686_101703159 3300005544 Bacteria 535
109 Ga0070695_100000261 3300005545 Bacteria 26461
110 Ga0070695_100000723 3300005545 Bacteria 17621
111 Ga0070695_100022342 3300005545 Bacteria 3880
112 Ga0070695_100050654 3300005545 Bacteria 2662
113 Ga0070695_100191756 3300005545 Bacteria 1455
114 Ga0070696_100052049 3300005546 Bacteria 2848
115 Ga0070696_100347062 3300005546 Bacteria 1149
116 Ga0070696_100400310 3300005546 Bacteria 1074
117 Ga0070696_100987532 3300005546 Unclassified 703
118 Ga0070693_100000207 3300005547 Bacteria 27302
119 Ga0070693_100216313 3300005547 Unclassified 1253
120 Ga0070704_100000505 3300005549 Bacteria 18545
121 Ga0070704_100022237 3300005549 Bacteria 4124
122 Ga0070704_100066790 3300005549 Bacteria 2595
123 Ga0070704_100220530 3300005549 Bacteria 1542
124 Ga0068855_100001473 3300005563 Bacteria 29428
125 Ga0068855_102526520 3300005563 Unclassified 511
126 Ga0070664_100018282 3300005564 Bacteria 5754
127 Ga0068857_100098711 3300005577 Bacteria 2619
128 Ga0068854_100020336 3300005578 Bacteria 4489
129 Ga0068854_100696799 3300005578 Unclassified 876
130 Ga0068856_100000796 3300005614 Bacteria 33989
131 Ga0070702_100001713 3300005615 Bacteria 9107
132 Ga0070702_100111610 3300005615 Bacteria 1696
133 Ga0068859_100000533 3300005617 Bacteria 37712
134 Ga0068859_100296622 3300005617 Bacteria 1710
135 Ga0068864_100008591 3300005618 Bacteria 8428
136 Ga0068866_10105550 3300005718 Bacteria 1562
137 Ga0068861_100041115 3300005719 Bacteria 3462
138 Ga0068861_100129209 3300005719 Bacteria 2049
139 Ga0068861_100269298 3300005719 Unclassified 1462
140 Ga0068851_10806425 3300005834 Unclassified 583
141 Ga0068870_10000609 3300005840 Bacteria 13615
142 Ga0068863_100031766 3300005841 Bacteria 5038
143 Ga0068863_100273000 3300005841 Bacteria 1637
144 Ga0068858_100037627 3300005842 Bacteria 4488
145 Ga0068860_100011455 3300005843 Bacteria 8737
146 Ga0068860_100050252 3300005843 Bacteria 3969
147 Ga0068862_100000415 3300005844 Bacteria 46252
148 Ga0068862_100039297 3300005844 Bacteria 4018
149 Ga0068862_100677874 3300005844 Bacteria 997
150 Ga0081455_10000749 3300005937 Bacteria 42221
151 Ga0081455_10910639 3300005937 Unclassified 547
152 Ga0081538_10008698 3300005981 Bacteria 8575
153 Ga0081539_10169170 3300005985 Bacteria 1035
154 Ga0075432_10008791 3300006058 Bacteria 3447
155 Ga0070716_100017412 3300006173 Bacteria 3725
156 Ga0097621_100731401 3300006237 Bacteria 913
157 Ga0068871_100307538 3300006358 Bacteria 1393
158 Ga0075428_100023993 3300006844 Bacteria 6750
159 Ga0075428_100050379 3300006844 Bacteria 4567
160 Ga0075428_100258161 3300006844 Bacteria 1877
161 Ga0075430_100000250 3300006846 Bacteria 37273
162 Ga0075430_100014450 3300006846 Bacteria 6724
163 Ga0075430_100102207 3300006846 Bacteria 2393
164 Ga0075430_100286412 3300006846 Bacteria 1363
165 Ga0075431_100011427 3300006847 Bacteria 8948
166 Ga0075431_100049431 3300006847 Bacteria 4335
167 Ga0075431_101438124 3300006847 Bacteria 649
168 Ga0075433_10006756 3300006852 Bacteria 9092
169 Ga0075433_10008839 3300006852 Bacteria 8037
170 Ga0075433_10023064 3300006852 Bacteria 5234
171 Ga0075433_10023417 3300006852 Bacteria 5198
172 Ga0075433_10043963 3300006852 Bacteria 3879
173 Ga0075433_10122590 3300006852 Bacteria 2308
174 Ga0075433_10141181 3300006852 Unclassified 2141
175 Ga0075433_10433255 3300006852 Unclassified 1159
176 Ga0075433_10490265 3300006852 Unclassified 1082
177 Ga0075433_10535948 3300006852 Bacteria 1029
178 Ga0075433_11321572 3300006852 Unclassified 624
179 Ga0075434_100009040 3300006871 Bacteria 9281
180 Ga0075434_100019339 3300006871 Bacteria 6590
181 Ga0075434_100058926 3300006871 Bacteria 3817
182 Ga0075434_100095766 3300006871 Unclassified 2973
183 Ga0075434_100104676 3300006871 Bacteria 2839
184 Ga0075434_100249441 3300006871 Bacteria 1794
185 Ga0075429_100000021 3300006880 Bacteria 69066
186 Ga0075429_100016408 3300006880 Bacteria 6421
187 Ga0075429_100141438 3300006880 Unclassified 2106
188 Ga0075429_101906050 3300006880 Unclassified 515
189 Ga0068865_100062083 3300006881 Bacteria 2622
190 Ga0068865_100367380 3300006881 Bacteria 1170
191 Ga0068865_100462566 3300006881 Bacteria 1051
192 Ga0075436_100036175 3300006914 Bacteria 3407
193 Ga0075436_100061886 3300006914 Bacteria 2586
194 Ga0075436_101036060 3300006914 Bacteria 616
195 Ga0075436_101056007 3300006914 Bacteria 611
196 Ga0097620_100000533 3300006931 Bacteria 37712
197 Ga0097620_100296619 3300006931 Bacteria 1710
198 Ga0075435_100031805 3300007076 Bacteria 4162
199 Ga0075435_100068902 3300007076 Bacteria 2883
200 Ga0075435_100108032 3300007076 Bacteria 2311
201 Ga0075435_100109569 3300007076 Bacteria 2295
202 Ga0075435_100496762 3300007076 Unclassified 1055
203 Ga0099794_10000503 3300007265 Bacteria 13101
204 Ga0099794_10450255 3300007265 Unclassified 675
205 Ga0099794_10651642 3300007265 Unclassified 559
206 Ga0105240_11886622 3300009093 Unclassified 622
207 Ga0111539_10000098 3300009094 Bacteria 91568
208 Ga0111539_10000182 3300009094 Bacteria 73143
209 Ga0111539_10019865 3300009094 Bacteria 8277
210 Ga0111539_10328383 3300009094 Bacteria 1780
211 Ga0114129_10000002 3300009147 Bacteria 204413
212 Ga0114129_10034596 3300009147 Bacteria 7137
213 Ga0114129_10089569 3300009147 Bacteria 4265
214 Ga0114129_10155118 3300009147 Bacteria 3132
215 Ga0114129_10293575 3300009147 Bacteria 2169
216 Ga0114129_10439398 3300009147 Bacteria 1713
217 Ga0114129_10472727 3300009147 Bacteria 1641
218 Ga0114129_10497236 3300009147 Unclassified 1593
219 Ga0114129_10567988 3300009147 Unclassified 1473
220 Ga0114129_10818763 3300009147 Bacteria 1186
221 Ga0114129_12066203 3300009147 Bacteria 688
222 Ga0105243_10449421 3300009148 Bacteria 1209
223 Ga0105243_10600707 3300009148 Bacteria 1059
224 Ga0105243_10746520 3300009148 Bacteria 959
225 Ga0105243_11431357 3300009148 Bacteria 713
226 Ga0105241_10002948 3300009174 Bacteria 12706
227 Ga0105241_10182826 3300009174 Bacteria 1740
228 Ga0105241_11713727 3300009174 Bacteria 611
229 Ga0105242_10114856 3300009176 Bacteria 2301
230 Ga0105248_10307270 3300009177 Bacteria 1786
231 Ga0105237_10193261 3300009545 Bacteria 2035
232 Ga0105249_10502832 3300009553 Bacteria 1257
233 Ga0105249_10550525 3300009553 Unclassified 1204
234 Ga0105249_12354112 3300009553 Bacteria 605
235 Ga0105239_10058392 3300010375 Bacteria 4233
236 Ga0105246_10016340 3300011119 Bacteria 4699
237 Ga0157373_10000176 3300013100 Bacteria 52378
238 Ga0157371_10059205 3300013102 Bacteria 2715
239 Ga0157371_10507006 3300013102 Unclassified 891
240 Ga0157369_10021645 3300013105 Bacteria 7191
241 Ga0157378_10158786 3300013297 Bacteria 2113
242 Ga0163162_10081405 3300013306 Bacteria 3309
243 Ga0163162_11754107 3300013306 Bacteria 709
244 Ga0163162_11956855 3300013306 Bacteria 671
245 Ga0157372_10005276 3300013307 Bacteria 13714
246 Ga0157372_11177881 3300013307 Unclassified 886
247 Ga0157375_10017503 3300013308 Bacteria 6469
248 Ga0157375_10054737 3300013308 Bacteria 3931
249 Ga0163163_10133543 3300014325 Bacteria 2522
250 Ga0157380_11152131 3300014326 Unclassified 817
251 Ga0157377_10620035 3300014745 Bacteria 774
252 Ga0182007_10030110 3300015262 Bacteria 1856
253 Ga0163161_10269119 3300017792 Unclassified 1333
254 Ga0206354_11134721 3300020081 Bacteria 700
255 Ga0206353_10370831 3300020082 Bacteria 1141
256 Ga0207656_10623616 3300025321 Unclassified 551
257 Ga0207653_10043055 3300025885 Bacteria 1486
258 Ga0207653_10186329 3300025885 Bacteria 778
259 Ga0207642_10488371 3300025899 Bacteria 752
260 Ga0207688_10032458 3300025901 Bacteria 2886
261 Ga0207647_10321303 3300025904 Bacteria 879
262 Ga0207685_10104491 3300025905 Bacteria 1217
263 Ga0207699_10188239 3300025906 Bacteria 1391
264 Ga0207699_10862459 3300025906 Bacteria 667
265 Ga0207645_10000232 3300025907 Bacteria 46199
266 Ga0207643_10000871 3300025908 Bacteria 18190
267 Ga0207684_10009619 3300025910 Bacteria 8527
268 Ga0207684_10015909 3300025910 Bacteria 6465
269 Ga0207684_10177738 3300025910 Bacteria 1835
270 Ga0207684_10218659 3300025910 Bacteria 1644
271 Ga0207684_10265128 3300025910 Bacteria 1482
272 Ga0207684_11746787 3300025910 Bacteria 500
273 Ga0207654_10010714 3300025911 Bacteria 4669
274 Ga0207654_10687303 3300025911 Unclassified 734
275 Ga0207654_10698190 3300025911 Bacteria 729
276 Ga0207707_10000076 3300025912 Bacteria 100491
277 Ga0207707_10161541 3300025912 Bacteria 1958
278 Ga0207693_10095474 3300025915 Bacteria 2331
279 Ga0207660_10000514 3300025917 Bacteria 25852
280 Ga0207660_10008444 3300025917 Bacteria 6661
281 Ga0207660_10506773 3300025917 Bacteria 979
282 Ga0207662_10522351 3300025918 Unclassified 819
283 Ga0207657_10000005 3300025919 Bacteria 213481
284 Ga0207649_10057555 3300025920 Bacteria 2431
285 Ga0207652_10000060 3300025921 Bacteria 113511
286 Ga0207646_10013579 3300025922 Bacteria 7779
287 Ga0207646_10020969 3300025922 Bacteria 6044
288 Ga0207646_10023404 3300025922 Bacteria 5674
289 Ga0207646_10038020 3300025922 Bacteria 4338
290 Ga0207646_10046542 3300025922 Bacteria 3891
291 Ga0207646_10078974 3300025922 Bacteria 2942
292 Ga0207646_10489712 3300025922 Bacteria 1108
293 Ga0207646_11097359 3300025922 Unclassified 700
294 Ga0207681_10265938 3300025923 Unclassified 1344
295 Ga0207681_10382542 3300025923 Bacteria 1133
296 Ga0207681_10946738 3300025923 Bacteria 722
297 Ga0207650_10192383 3300025925 Bacteria 1630
298 Ga0207700_11704484 3300025928 Unclassified 556
299 Ga0207690_10241596 3300025932 Bacteria 1391
300 Ga0207706_10003272 3300025933 Bacteria 15500
301 Ga0207706_10037858 3300025933 Bacteria 4281
302 Ga0207706_10267976 3300025933 Bacteria 1491
303 Ga0207686_10036416 3300025934 Bacteria 2962
304 Ga0207709_10145565 3300025935 Bacteria 1634
305 Ga0207709_10293352 3300025935 Bacteria 1206
306 Ga0207709_10769509 3300025935 Bacteria 775
307 Ga0207670_10007115 3300025936 Bacteria 6233
308 Ga0207670_10033481 3300025936 Bacteria 3312
309 Ga0207670_10896146 3300025936 Bacteria 743
310 Ga0207669_11349606 3300025937 Bacteria 606
311 Ga0207704_10388106 3300025938 Bacteria 1098
312 Ga0207704_10413570 3300025938 Bacteria 1067
313 Ga0207665_10000907 3300025939 Bacteria 19964
314 Ga0207691_10068537 3300025940 Bacteria 3205
315 Ga0207711_10421515 3300025941 Bacteria 1241
316 Ga0207689_10000423 3300025942 Bacteria 39658
317 Ga0207689_10760819 3300025942 Unclassified 817
318 Ga0207661_10347104 3300025944 Bacteria 1338
319 Ga0207679_10000231 3300025945 Bacteria 43268
320 Ga0207667_10001202 3300025949 Bacteria 32395
321 Ga0207651_11254030 3300025960 Unclassified 666
322 Ga0207712_10462006 3300025961 Unclassified 1078
323 Ga0207668_10379177 3300025972 Bacteria 1190
324 Ga0207668_10652483 3300025972 Bacteria 921
325 Ga0207668_11819157 3300025972 Unclassified 549
326 Ga0207640_10022458 3300025981 Bacteria 3777
327 Ga0207658_10814074 3300025986 Bacteria 848
328 Ga0207677_10119935 3300026023 Bacteria 1976
329 Ga0207703_10027052 3300026035 Bacteria 4518
330 Ga0207639_10000571 3300026041 Bacteria 25417
331 Ga0207678_10005780 3300026067 Bacteria 11029
332 Ga0207708_10174817 3300026075 Bacteria 1702
333 Ga0207702_10000576 3300026078 Bacteria 40802
334 Ga0207641_10274759 3300026088 Bacteria 1582
335 Ga0207648_10000565 3300026089 Bacteria 41535
336 Ga0207648_10148077 3300026089 Bacteria 2071
337 Ga0207676_10065966 3300026095 Bacteria 2884
338 Ga0207674_10001421 3300026116 Bacteria 30917
339 Ga0207674_10416390 3300026116 Bacteria 1298
340 Ga0207675_100000795 3300026118 Bacteria 31348
341 Ga0207675_100381262 3300026118 Unclassified 1386
342 Ga0209969_1007467 3300027360 Bacteria 1545
343 Ga0209981_1008124 3300027378 Bacteria 1422
344 Ga0209996_1010954 3300027395 Bacteria 1208
345 Ga0209984_1025367 3300027424 Bacteria 825
346 Ga0210000_1030615 3300027462 Bacteria 841
347 Ga0209995_1006412 3300027471 Bacteria 1891
348 Ga0209968_1004063 3300027526 Bacteria 2197
349 Ga0209982_1003255 3300027552 Bacteria 2300
350 Ga0209970_1003842 3300027614 Bacteria 2510
351 Ga0210002_1007517 3300027617 Unclassified 1653
352 Ga0209983_1000319 3300027665 Bacteria 10106
353 Ga0209588_1001293 3300027671 Bacteria 6501
354 Ga0209971_1000016 3300027682 Bacteria 65564
355 Ga0209966_1000083 3300027695 Bacteria 41039
356 Ga0209998_10000186 3300027717 Bacteria 22054
357 Ga0209974_10010451 3300027876 Bacteria 3132
358 Ga0207428_11252088 3300027907 Unclassified 515
359 Ga0268265_10024557 3300028380 Bacteria 4265
360 Ga0268264_10630298 3300028381 Bacteria 1059
361 Ga0268264_10664707 3300028381 Unclassified 1032
362 Ga0307408_100019353 3300031548 Bacteria 4583
363 Ga0307408_100598345 3300031548 Bacteria 979
364 Ga0307408_100608332 3300031548 Bacteria 972
365 Ga0307408_101157323 3300031548 Bacteria 720
366 Ga0307405_10068590 3300031731 Bacteria 2270
367 Ga0307405_10457013 3300031731 Bacteria 1014
368 Ga0307413_11010410 3300031824 Bacteria 713
369 Ga0307412_10079111 3300031911 Bacteria 2267
370 Ga0307409_100201694 3300031995 Bacteria 1780
371 Ga0307416_100120640 3300032002 Bacteria 2335
372 Ga0307411_12236046 3300032005 Bacteria 513
373 Ga0307415_100255359 3300032126 Bacteria 1427
374 Ga0373948_0078945 3300034817 Bacteria 748
375 Ga0373948_0191570 3300034817 Bacteria 529
376 Ga0373959_0018418 3300034820 Bacteria 1313
377 Ga0373926_0369777 3300035083 Bacteria 564
378 Ga0373940_0020189 3300035088 Bacteria 1690
379 Ga0373940_0064400 3300035088 Bacteria 1055
380 Ga0373949_0027963 3300035090 Bacteria 1329
381 Ga0373951_0003783 3300035091 Bacteria 3646
382 Ga0373932_0024625 3300035112 Bacteria 1622
383 Ga0373932_0042632 3300035112 Bacteria 1317
384 Ga0373932_0221219 3300035112 Bacteria 680
385 Ga0373941_0008250 3300035115 Bacteria 2581
386 Ga0373960_0096028 3300035121 Bacteria 954
387 Ga0373960_0257290 3300035121 Bacteria 636
388 Ga0373942_0078924 3300035207 Bacteria 974
389 Ga0373942_0244663 3300035207 Bacteria 608
390 Ga0373961_0154908 3300035241 Bacteria 783
391 Ga0373962_0036421 3300035242 Bacteria 1370
392 Ga0373931_0002121 3300035691 Bacteria 8739
393 Ga0373931_0174321 3300035691 Bacteria 1269
394 Ga0373931_1069353 3300035691 Bacteria 548
395 Ga0395901_2149756 3300038443 Unclassified 503
396 Ga0242420_014824 3300038996 Unclassified 1342
397 Ga0242420_091729 3300038996 Bacteria 638
398 Ga0439448_0000194 3300042005 Bacteria 12632
399 Ga0439450_032463 3300042008 Bacteria 1179
400 Ga0439455_0019620 3300042012 Bacteria 1596
401 Ga0450892_042802 3300042130 Unclassified 502
402 Ga0450898_031285 3300042134 Bacteria 978
403 Ga0450889_025175 3300042144 Archaea 677
404 Ga0439458_0005713 3300042157 Bacteria 2788
405 Ga0439459_0000085 3300042438 Bacteria 8202
406 Ga0439459_0248764 3300042438 Archaea 501
407 Ga0439464_0050594 3300042439 Bacteria 1201
408 Ga0439460_0000040 3300042461 Bacteria 18942
409 Ga0439460_0230921 3300042461 Unclassified 636
410 Ga0451577_0023293 3300042876 Bacteria 5648
411 Ga0451577_0071964 3300042876 Bacteria 3084
412 Ga0451577_0153712 3300042876 Bacteria 2070
413 Ga0451577_1165076 3300042876 Bacteria 688
414 Ga0453683_0046226 3300044673 Bacteria 2729
415 Ga0453683_0080277 3300044673 Bacteria 2043
416 Ga0453683_0860137 3300044673 Unclassified 598
417 Ga0453684_0030395 3300044712 Bacteria 7633
418 Ga0453684_0334218 3300044712 Bacteria 1712
419 Ga0453684_0378239 3300044712 Bacteria 1591
420 Ga0451576_0065930 3300045051 Bacteria 3769
421 Ga0451576_0120397 3300045051 Bacteria 2732
422 Ga0451576_0135218 3300045051 Bacteria 2570
423 Ga0451576_0225154 3300045051 Bacteria 1958
424 Ga0451576_0263860 3300045051 Bacteria 1800
425 Ga0495594_0239046 3300046499 Bacteria 1035
426 Ga0496100_1168968 3300048903 Unclassified 607
427 Ga0496102_0101668 3300048905 Bacteria 2671
428 Ga0496102_1185707 3300048905 Bacteria 683
429 Ga0496104_1135177 3300048907 Bacteria 685
430 Ga0496106_0012725 3300048909 Bacteria 6215
431 Ga0496106_0481310 3300048909 Bacteria 997
432 Ga0496107_0169182 3300048910 Bacteria 1621
433 Ga0496108_0442272 3300048911 Bacteria 1136
434 Ga0496112_0104155 3300048915 Bacteria 2808
435 Ga0501309_030418 3300049129 Bacteria 795
436 Ga0501299_120183 3300049522 Bacteria 632
437 Ga0501299_174364 3300049522 Unclassified 558
438 Ga0501031_0191196 3300049568 Bacteria 1337
439 Ga0501031_0284217 3300049568 Bacteria 1073
440 Ga0501032_0259205 3300049569 Unclassified 1128
441 Ga0501032_0359753 3300049569 Unclassified 937
442 Ga0501033_0030492 3300049570 Bacteria 4053
443 Ga0501033_0036137 3300049570 Bacteria 3703
444 Ga0501033_0140789 3300049570 Bacteria 1744
445 Ga0501036_0038426 3300049572 Bacteria 4051
446 Ga0501036_0113302 3300049572 Bacteria 2292
447 Ga0501036_0231144 3300049572 Unclassified 1552
448 Ga0501036_0573092 3300049572 Unclassified 937
449 Ga0501036_0904762 3300049572 Bacteria 724
450 Ga0501036_1073062 3300049572 Unclassified 658
451 Ga0501037_0123077 3300049573 Bacteria 1864
452 Ga0501038_0029104 3300049574 Bacteria 4899
453 Ga0501038_0147601 3300049574 Bacteria 1919
454 Ga0501038_0581108 3300049574 Bacteria 849
455 Ga0501038_0582981 3300049574 Unclassified 848
456 Ga0501038_0938840 3300049574 Bacteria 637
457 Ga0501039_0023016 3300049575 Bacteria 4779
458 Ga0501039_0045755 3300049575 Bacteria 3381
459 Ga0501039_0254450 3300049575 Unclassified 1381
460 Ga0501039_0308011 3300049575 Bacteria 1245
461 Ga0501039_1212281 3300049575 Bacteria 583
462 Ga0501039_1253949 3300049575 Archaea 573
463 Ga0501040_0003866 3300049576 Bacteria 9714
464 Ga0501040_0021147 3300049576 Bacteria 4340
465 Ga0501040_0177448 3300049576 Bacteria 1509
466 Ga0501040_0460982 3300049576 Bacteria 915
467 Ga0501040_0504342 3300049576 Bacteria 872
468 Ga0501040_1097577 3300049576 Unclassified 577
469 Ga0501041_0019623 3300049577 Bacteria 4039
470 Ga0501041_0047897 3300049577 Unclassified 2603
471 Ga0501041_0078068 3300049577 Bacteria 2037
472 Ga0501041_0093261 3300049577 Bacteria 1859
473 Ga0501042_0000478 3300049578 Bacteria 20717
474 Ga0501042_0017246 3300049578 Bacteria 4978
475 Ga0501042_0171073 3300049578 Bacteria 1567
476 Ga0501042_0653097 3300049578 Unclassified 765
477 Ga0501042_0684994 3300049578 Unclassified 745
478 Ga0501042_1329073 3300049578 Bacteria 524
479 Ga0501043_0151069 3300049579 Bacteria 1817
480 Ga0501043_0219013 3300049579 Unclassified 1473
481 Ga0501043_0571621 3300049579 Bacteria 838
482 Ga0501046_0000115 3300049580 Bacteria 84375
483 Ga0501046_0069930 3300049580 Bacteria 2730
484 Ga0501046_0534665 3300049580 Bacteria 837
485 Ga0501048_0004927 3300049582 Bacteria 10185
486 Ga0501048_0062307 3300049582 Bacteria 2640
487 Ga0501048_0068115 3300049582 Unclassified 2515
488 Ga0501048_0157964 3300049582 Bacteria 1604
489 Ga0501048_0349342 3300049582 Unclassified 1055
490 Ga0501067_0043144 3300049583 Bacteria 2505
491 Ga0501068_0062457 3300049584 Bacteria 2265
492 Ga0501069_0194657 3300049585 Unclassified 1174
493 Ga0501070_1240019 3300049586 Viruses 571
494 Ga0501071_0286918 3300049587 Unclassified 1246
495 Ga0501071_0354077 3300049587 Bacteria 1117
496 Ga0501071_0389942 3300049587 Unclassified 1063
497 Ga0501071_0538360 3300049587 Bacteria 896
498 Ga0501071_0892757 3300049587 Unclassified 686
499 Ga0501072_0007495 3300049588 Bacteria 8281
500 Ga0501072_0010133 3300049588 Bacteria 7175
501 Ga0501072_0076053 3300049588 Bacteria 2656
502 Ga0501072_0096155 3300049588 Bacteria 2354
503 Ga0501072_0249975 3300049588 Bacteria 1412
504 Ga0501072_0476264 3300049588 Bacteria 988
505 Ga0501073_0252740 3300049589 Unclassified 1217
506 Ga0501073_0489971 3300049589 Bacteria 850
507 Ga0501073_0647770 3300049589 Bacteria 729
508 Ga0501074_0036269 3300049590 Bacteria 3573
509 Ga0501074_0443316 3300049590 Unclassified 921
510 Ga0501075_0000143 3300049591 Bacteria 35679
511 Ga0501075_0008042 3300049591 Bacteria 7333
512 Ga0501075_0021792 3300049591 Bacteria 4673
513 Ga0501075_0038227 3300049591 Bacteria 3587
514 Ga0501075_0061567 3300049591 Bacteria 2828
515 Ga0501075_0173362 3300049591 Bacteria 1646
516 Ga0501075_0183149 3300049591 Bacteria 1598
517 Ga0501075_0423340 3300049591 Bacteria 1015
518 Ga0501075_0607929 3300049591 Archaea 834
519 Ga0501076_0005597 3300049592 Bacteria 9050
520 Ga0501076_0006074 3300049592 Bacteria 8736
521 Ga0501076_0135832 3300049592 Bacteria 1996
522 Ga0501076_0148837 3300049592 Bacteria 1904
523 Ga0501076_0151981 3300049592 Unclassified 1883
524 Ga0501076_0335126 3300049592 Unclassified 1241
525 Ga0501077_0020563 3300049593 Bacteria 4178
526 Ga0501077_0037087 3300049593 Bacteria 3106
527 Ga0501077_0044495 3300049593 Unclassified 2820
528 Ga0501077_0044873 3300049593 Unclassified 2807
529 Ga0501077_0072508 3300049593 Bacteria 2182
530 Ga0501077_0116959 3300049593 Bacteria 1690
531 Ga0501077_0625212 3300049593 Bacteria 692
532 Ga0501225_0209263 3300049705 Bacteria 623
533 Ga0501234_057341 3300049707 Bacteria 656
534 Ga0501079_0002407 3300049741 Bacteria 13570
535 Ga0501079_0005017 3300049741 Bacteria 9819
536 Ga0501079_0015441 3300049741 Bacteria 5827
537 Ga0501079_0015801 3300049741 Bacteria 5768
538 Ga0501079_0018848 3300049741 Bacteria 5274
539 Ga0501079_0061444 3300049741 Bacteria 2898
540 Ga0501079_0222386 3300049741 Unclassified 1475
541 Ga0501079_0364557 3300049741 Bacteria 1132
542 Ga0501079_1209308 3300049741 Bacteria 595
543 Ga0501080_0001618 3300049742 Bacteria 19146
544 Ga0501080_0052107 3300049742 Bacteria 3809
545 Ga0501080_0132422 3300049742 Bacteria 2308
546 Ga0501080_0139189 3300049742 Bacteria 2245
547 Ga0501080_0211939 3300049742 Unclassified 1775
548 Ga0501080_0215836 3300049742 Unclassified 1757
549 Ga0501080_1135773 3300049742 Unclassified 674
550 Ga0501081_0009979 3300049743 Bacteria 6191
551 Ga0501081_0020851 3300049743 Bacteria 4372
552 Ga0501081_0026034 3300049743 Bacteria 3941
553 Ga0501081_0026773 3300049743 Bacteria 3890
554 Ga0501081_0046408 3300049743 Bacteria 2986
555 Ga0501081_0102421 3300049743 Bacteria 2025
556 Ga0501081_0224295 3300049743 Bacteria 1367
557 Ga0501081_0465812 3300049743 Archaea 940
558 Ga0501081_0889350 3300049743 Unclassified 671
559 Ga0501081_0943615 3300049743 Bacteria 651
560 Ga0501083_0014076 3300049744 Bacteria 5593
561 Ga0501083_0044283 3300049744 Unclassified 3013
562 Ga0501083_0139766 3300049744 Unclassified 1586
563 Ga0501083_0330712 3300049744 Unclassified 991
564 Ga0501035_0041447 3300049822 Bacteria 4157
565 Ga0501035_0567352 3300049822 Unclassified 928
566 Ga0501045_0001069 3300049824 Bacteria 18104
567 Ga0501045_0003469 3300049824 Bacteria 10792
568 Ga0501045_0041722 3300049824 Bacteria 3339
569 Ga0501045_0052413 3300049824 Bacteria 2979
570 Ga0501045_0062802 3300049824 Bacteria 2725
571 Ga0501045_0068810 3300049824 Bacteria 2602
572 Ga0501045_0147033 3300049824 Bacteria 1753
573 Ga0501045_0244661 3300049824 Unclassified 1335
574 Ga0501045_0355480 3300049824 Bacteria 1090
575 nmdc:mga05p37_110911_c1 3300050507 Bacteria 3374
576 nmdc:mga05p37_114229_c1 3300050507 Bacteria 3319
577 nmdc:mga05p37_232223_c1 3300050507 Bacteria 2222
578 nmdc:mga05p37_29443_c1 3300050507 Bacteria 6701
579 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
580 nmdc:mga05p37_515013_c1 3300050507 Bacteria 1370
581 nmdc:mga05p37_522927_c1 3300050507 Unclassified 1357
582 nmdc:mga05p37_828547_c1 3300050507 Bacteria 1008
583 nmdc:mga05p37_844240_c1 3300050507 Bacteria 996
584 nmdc:mga09592_54253_c1 3300050508 Bacteria 3386
585 nmdc:mga09592_55509_c1 3300050508 Bacteria 3347
586 nmdc:mga09592_902088_c1 3300050508 Unclassified 743
587 nmdc:mga09592_959_c1 3300050508 Bacteria 22733
588 nmdc:mga0qj67_109060_c2 3300050509 Bacteria 1417
589 nmdc:mga0qj67_183231_c1 3300050509 Bacteria 1701
590 nmdc:mga0qj67_64225_c1 3300050509 Bacteria 2920
591 nmdc:mga06r32_101849_c1 3300050510 Bacteria 2819
592 nmdc:mga06r32_116859_c1 3300050510 Bacteria 2628
593 nmdc:mga06r32_1317738_c1 3300050510 Bacteria 666
594 nmdc:mga06r32_163181_c1 3300050510 Bacteria 2211
595 nmdc:mga06r32_673070_c1 3300050510 Bacteria 1002
596 nmdc:mga06r32_695_c1 3300050510 Bacteria 29349
597 nmdc:mga08y16_254871_c1 3300050511 Bacteria 1813
598 nmdc:mga0n895_207725_c1 3300050512 Bacteria 1989
599 nmdc:mga0n895_226753_c2 3300050512 Bacteria 1099
600 nmdc:mga0n895_667055_c1 3300050512 Bacteria 1038
601 nmdc:mga0n895_7354_c1 3300050512 Bacteria 9445
602 nmdc:mga0rr50_1125703_c1 3300050513 Unclassified 668
603 nmdc:mga0rr50_184072_c1 3300050513 Bacteria 1709
604 nmdc:mga0rr50_305441_c1 3300050513 Bacteria 1332
605 nmdc:mga0rr50_466143_c1 3300050513 Unclassified 1072
606 nmdc:mga0rr50_70814_c1 3300050513 Bacteria 2658
607 nmdc:mga0rr50_813048_c1 3300050513 Bacteria 797
608 nmdc:mga08x19_114603_c1 3300050514 Bacteria 1801
609 nmdc:mga08x19_1284594_c1 3300050514 Unclassified 518
610 nmdc:mga08x19_158420_c1 3300050514 Bacteria 1537
611 nmdc:mga08x19_20105_c1 3300050514 Bacteria 4110
612 nmdc:mga0a205_312010_c1 3300050515 Bacteria 1445
613 nmdc:mga0a205_348483_c1 3300050515 Bacteria 1349
614 nmdc:mga0a205_41704_c1 3300050515 Bacteria 3539
615 nmdc:mga0a205_7120_c1 3300050515 Bacteria 10109
616 nmdc:mga0a205_805658_c1 3300050515 Unclassified 787
617 Ga0501084_0012422 3300054114 Bacteria 7058
618 Ga0501084_0018019 3300054114 Bacteria 5880
619 Ga0501084_0022793 3300054114 Bacteria 5226
620 Ga0501084_0101974 3300054114 Bacteria 2410
621 Ga0501084_0124719 3300054114 Bacteria 2167
622 Ga0501084_0223534 3300054114 Bacteria 1589
623 Ga0590071_087421 3300059421 Bacteria 778
624 Ga0501082_0001107 3300060353 Bacteria 23813
625 Ga0501082_0058304 3300060353 Bacteria 3327
626 Ga0501082_0116747 3300060353 Bacteria 2311
627 Ga0501082_0150954 3300060353 Unclassified 2018
628 Ga0501082_0181043 3300060353 Bacteria 1833
629 Ga0501082_0302735 3300060353 Unclassified 1392
630 Ga0501082_0518908 3300060353 Bacteria 1041
631 Ga0501082_0575423 3300060353 Bacteria 985
632 Ga0501082_0999712 3300060353 Bacteria 731
633 Ga0501082_1542492 3300060353 Unclassified 580
634 Ga0530510_0005890 3300061734 Bacteria 8498
635 Ga0530510_0013587 3300061734 Bacteria 5727
636 Ga0530510_0037417 3300061734 Bacteria 3499
637 Ga0530510_0043068 3300061734 Bacteria 3260
638 Ga0530510_0239184 3300061734 Unclassified 1351
639 Ga0530510_0274035 3300061734 Bacteria 1259
640 Ga0530510_0296212 3300061734 Bacteria 1210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_1542492 Ga0501082_1542492_269_535 87
2 3300001915 JGI24741J21665_1045726 JGI24741J21665_10457262 89
3 3300003322 rootL2_10186341 rootL2_101863413 89
4 3300003373 JGI25407J50210_10146549 JGI25407J50210_101465491 89
5 3300003911 JGI25405J52794_10018580 JGI25405J52794_100185802 89
6 3300004799 Ga0058863_11697093 Ga0058863_116970931 89
7 3300004803 Ga0058862_12575548 Ga0058862_125755483 89
8 3300005290 Ga0065712_10311569 Ga0065712_103115693 89
9 3300005293 Ga0065715_10308892 Ga0065715_103088923 89
10 3300005295 Ga0065707_10817523 Ga0065707_108175232 89
11 3300005328 Ga0070676_10000771 Ga0070676_100007719 89
12 3300005329 Ga0070683_100101507 Ga0070683_1001015075 89
13 3300005330 Ga0070690_100436828 Ga0070690_1004368283 89
14 3300005334 Ga0068869_100000503 Ga0068869_10000050314 89
15 3300005335 Ga0070666_10135337 Ga0070666_101353374 89
16 3300005335 Ga0070666_11412568 Ga0070666_114125681 89
17 3300005336 Ga0070680_100002337 Ga0070680_1000023376 89
18 3300005336 Ga0070680_100107633 Ga0070680_1001076334 89
19 3300005336 Ga0070680_100302435 Ga0070680_1003024353 89
20 3300005337 Ga0070682_100000182 Ga0070682_1000001826 89
21 3300005338 Ga0068868_100009025 Ga0068868_1000090254 89
22 3300005339 Ga0070660_100002694 Ga0070660_10000269410 89
23 3300005340 Ga0070689_100017569 Ga0070689_1000175692 89
24 3300005340 Ga0070689_100091848 Ga0070689_1000918484 89
25 3300005340 Ga0070689_100615708 Ga0070689_1006157083 89
26 3300005341 Ga0070691_10003395 Ga0070691_100033956 89
27 3300005341 Ga0070691_10011353 Ga0070691_100113534 89
28 3300005341 Ga0070691_10014611 Ga0070691_100146113 89
29 3300005341 Ga0070691_10656923 Ga0070691_106569232 89
30 3300005343 Ga0070687_100322871 Ga0070687_1003228712 89
31 3300005344 Ga0070661_100000280 Ga0070661_1000002803 89
32 3300005345 Ga0070692_10001685 Ga0070692_100016856 89
33 3300005347 Ga0070668_100400242 Ga0070668_1004002424 89
34 3300005347 Ga0070668_100668191 Ga0070668_1006681911 89
35 3300005353 Ga0070669_100011809 Ga0070669_1000118095 89
36 3300005353 Ga0070669_100187063 Ga0070669_1001870633 89
37 3300005353 Ga0070669_101521708 Ga0070669_1015217081 89
38 3300005356 Ga0070674_101545962 Ga0070674_1015459621 89
39 3300005366 Ga0070659_100000500 Ga0070659_1000005006 89
40 3300005367 Ga0070667_100184281 Ga0070667_1001842813 89
41 3300005406 Ga0070703_10002816 Ga0070703_100028162 89
42 3300005406 Ga0070703_10038737 Ga0070703_100387372 89
43 3300005434 Ga0070709_10027601 Ga0070709_100276015 89
44 3300005436 Ga0070713_100935715 Ga0070713_1009357152 89
45 3300005438 Ga0070701_10084605 Ga0070701_100846053 89
46 3300005438 Ga0070701_10138385 Ga0070701_101383853 89
47 3300005438 Ga0070701_11010048 Ga0070701_110100481 89
48 3300005440 Ga0070705_100001910 Ga0070705_1000019108 89
49 3300005440 Ga0070705_100321719 Ga0070705_1003217193 89
50 3300005440 Ga0070705_100344756 Ga0070705_1003447564 89
51 3300005440 Ga0070705_100840538 Ga0070705_1008405382 89
52 3300005441 Ga0070700_100264836 Ga0070700_1002648362 89
53 3300005444 Ga0070694_100002581 Ga0070694_10000258111 89
54 3300005444 Ga0070694_100010952 Ga0070694_1000109523 89
55 3300005444 Ga0070694_100034533 Ga0070694_1000345335 89
56 3300005444 Ga0070694_100064642 Ga0070694_1000646423 89
57 3300005444 Ga0070694_100170521 Ga0070694_1001705212 89
58 3300005444 Ga0070694_100289714 Ga0070694_1002897142 89
59 3300005444 Ga0070694_101589304 Ga0070694_1015893041 89
60 3300005445 Ga0070708_100175955 Ga0070708_1001759554 89
61 3300005445 Ga0070708_100245107 Ga0070708_1002451074 89
62 3300005445 Ga0070708_100300784 Ga0070708_1003007843 89
63 3300005445 Ga0070708_100340385 Ga0070708_1003403854 89
64 3300005445 Ga0070708_100360436 Ga0070708_1003604363 89
65 3300005445 Ga0070708_101214336 Ga0070708_1012143361 89
66 3300005445 Ga0070708_101318679 Ga0070708_1013186792 89
67 3300005455 Ga0070663_100001673 Ga0070663_1000016739 89
68 3300005455 Ga0070663_100295907 Ga0070663_1002959073 89
69 3300005457 Ga0070662_100001013 Ga0070662_10000101313 89
70 3300005457 Ga0070662_100025074 Ga0070662_1000250743 89
71 3300005457 Ga0070662_100213792 Ga0070662_1002137923 89
72 3300005458 Ga0070681_10027811 Ga0070681_100278116 89
73 3300005458 Ga0070681_10161622 Ga0070681_101616224 89
74 3300005458 Ga0070681_10675929 Ga0070681_106759293 89
75 3300005459 Ga0068867_100045002 Ga0068867_1000450024 89
76 3300005459 Ga0068867_100197973 Ga0068867_1001979732 89
77 3300005467 Ga0070706_100005525 Ga0070706_1000055258 89
78 3300005467 Ga0070706_100080671 Ga0070706_1000806714 89
79 3300005467 Ga0070706_100242845 Ga0070706_1002428452 89
80 3300005467 Ga0070706_100902339 Ga0070706_1009023391 89
81 3300005468 Ga0070707_100023916 Ga0070707_1000239164 89
82 3300005468 Ga0070707_100112317 Ga0070707_1001123173 89
83 3300005468 Ga0070707_100327546 Ga0070707_1003275461 89
84 3300005468 Ga0070707_100365081 Ga0070707_1003650813 89
85 3300005468 Ga0070707_100890467 Ga0070707_1008904672 89
86 3300005471 Ga0070698_100011493 Ga0070698_1000114935 89
87 3300005471 Ga0070698_100058520 Ga0070698_1000585204 89
88 3300005471 Ga0070698_100079769 Ga0070698_1000797693 89
89 3300005471 Ga0070698_100479027 Ga0070698_1004790273 89
90 3300005471 Ga0070698_100982987 Ga0070698_1009829872 89
91 3300005471 Ga0070698_101864560 Ga0070698_1018645602 89
92 3300005518 Ga0070699_100007156 Ga0070699_1000071563 89
93 3300005518 Ga0070699_100011450 Ga0070699_1000114508 89
94 3300005518 Ga0070699_100018159 Ga0070699_1000181598 89
95 3300005518 Ga0070699_100051526 Ga0070699_1000515265 89
96 3300005518 Ga0070699_100130602 Ga0070699_1001306024 89
97 3300005530 Ga0070679_100014766 Ga0070679_1000147669 89
98 3300005530 Ga0070679_101873072 Ga0070679_1018730721 89
99 3300005535 Ga0070684_100441758 Ga0070684_1004417582 89
100 3300005536 Ga0070697_100004998 Ga0070697_1000049985 89
101 3300005536 Ga0070697_100090247 Ga0070697_1000902472 89
102 3300005536 Ga0070697_100232861 Ga0070697_1002328614 89
103 3300005536 Ga0070697_100542108 Ga0070697_1005421082 89
104 3300005536 Ga0070697_100782531 Ga0070697_1007825312 89
105 3300005539 Ga0068853_100000088 Ga0068853_10000008861 89
106 3300005543 Ga0070672_100042006 Ga0070672_1000420063 89
107 3300005543 Ga0070672_100368512 Ga0070672_1003685123 89
108 3300005544 Ga0070686_100333331 Ga0070686_1003333312 89
109 3300005544 Ga0070686_101703159 Ga0070686_1017031592 89
110 3300005545 Ga0070695_100000261 Ga0070695_10000026111 89
111 3300005545 Ga0070695_100000723 Ga0070695_10000072318 89
112 3300005545 Ga0070695_100022342 Ga0070695_1000223425 89
113 3300005545 Ga0070695_100050654 Ga0070695_1000506544 89
114 3300005545 Ga0070695_100191756 Ga0070695_1001917562 89
115 3300005546 Ga0070696_100052049 Ga0070696_1000520496 89
116 3300005546 Ga0070696_100347062 Ga0070696_1003470623 89
117 3300005546 Ga0070696_100400310 Ga0070696_1004003102 89
118 3300005546 Ga0070696_100987532 Ga0070696_1009875322 89
119 3300005547 Ga0070693_100000207 Ga0070693_10000020718 89
120 3300005547 Ga0070693_100216313 Ga0070693_1002163133 89
121 3300005549 Ga0070704_100000505 Ga0070704_10000050520 89
122 3300005549 Ga0070704_100022237 Ga0070704_1000222375 89
123 3300005549 Ga0070704_100066790 Ga0070704_1000667904 89
124 3300005549 Ga0070704_100220530 Ga0070704_1002205302 89
125 3300005563 Ga0068855_100001473 Ga0068855_10000147316 89
126 3300005563 Ga0068855_102526520 Ga0068855_1025265201 89
127 3300005564 Ga0070664_100018282 Ga0070664_1000182825 89
128 3300005577 Ga0068857_100098711 Ga0068857_1000987116 89
129 3300005578 Ga0068854_100020336 Ga0068854_1000203365 89
130 3300005578 Ga0068854_100696799 Ga0068854_1006967993 89
131 3300005614 Ga0068856_100000796 Ga0068856_10000079620 89
132 3300005615 Ga0070702_100001713 Ga0070702_1000017137 89
133 3300005615 Ga0070702_100111610 Ga0070702_1001116103 89
134 3300005617 Ga0068859_100000533 Ga0068859_10000053341 89
135 3300005617 Ga0068859_100296622 Ga0068859_1002966223 89
136 3300005618 Ga0068864_100008591 Ga0068864_1000085915 89
137 3300005718 Ga0068866_10105550 Ga0068866_101055503 89
138 3300005719 Ga0068861_100041115 Ga0068861_1000411156 89
139 3300005719 Ga0068861_100129209 Ga0068861_1001292094 89
140 3300005719 Ga0068861_100269298 Ga0068861_1002692983 89
141 3300005834 Ga0068851_10806425 Ga0068851_108064251 89
142 3300005840 Ga0068870_10000609 Ga0068870_1000060912 89
143 3300005841 Ga0068863_100031766 Ga0068863_1000317666 89
144 3300005841 Ga0068863_100273000 Ga0068863_1002730002 89
145 3300005842 Ga0068858_100037627 Ga0068858_1000376274 89
146 3300005843 Ga0068860_100011455 Ga0068860_1000114554 89
147 3300005843 Ga0068860_100050252 Ga0068860_1000502522 89
148 3300005844 Ga0068862_100000415 Ga0068862_10000041513 89
149 3300005844 Ga0068862_100039297 Ga0068862_1000392971 89
150 3300005844 Ga0068862_100677874 Ga0068862_1006778742 89
151 3300005937 Ga0081455_10000749 Ga0081455_1000074922 89
152 3300005937 Ga0081455_10910639 Ga0081455_109106392 89
153 3300005981 Ga0081538_10008698 Ga0081538_100086983 89
154 3300005985 Ga0081539_10169170 Ga0081539_101691702 89
155 3300006058 Ga0075432_10008791 Ga0075432_100087914 89
156 3300006173 Ga0070716_100017412 Ga0070716_1000174125 89
157 3300006237 Ga0097621_100731401 Ga0097621_1007314012 89
158 3300006358 Ga0068871_100307538 Ga0068871_1003075384 89
159 3300006844 Ga0075428_100023993 Ga0075428_10002399310 89
160 3300006844 Ga0075428_100050379 Ga0075428_1000503793 89
161 3300006844 Ga0075428_100258161 Ga0075428_1002581613 89
162 3300006846 Ga0075430_100000250 Ga0075430_10000025020 89
163 3300006846 Ga0075430_100014450 Ga0075430_1000144508 89
164 3300006846 Ga0075430_100102207 Ga0075430_1001022073 89
165 3300006846 Ga0075430_100286412 Ga0075430_1002864123 89
166 3300006847 Ga0075431_100011427 Ga0075431_1000114275 89
167 3300006847 Ga0075431_100049431 Ga0075431_1000494313 89
168 3300006847 Ga0075431_101438124 Ga0075431_1014381241 89
169 3300006852 Ga0075433_10006756 Ga0075433_100067566 89
170 3300006852 Ga0075433_10008839 Ga0075433_100088394 89
171 3300006852 Ga0075433_10023064 Ga0075433_100230642 89
172 3300006852 Ga0075433_10023417 Ga0075433_100234176 89
173 3300006852 Ga0075433_10043963 Ga0075433_100439634 89
174 3300006852 Ga0075433_10122590 Ga0075433_101225904 89
175 3300006852 Ga0075433_10141181 Ga0075433_101411814 89
176 3300006852 Ga0075433_10433255 Ga0075433_104332553 89
177 3300006852 Ga0075433_10490265 Ga0075433_104902652 89
178 3300006852 Ga0075433_10535948 Ga0075433_105359483 89
179 3300006852 Ga0075433_11321572 Ga0075433_113215722 89
180 3300006871 Ga0075434_100009040 Ga0075434_10000904011 89
181 3300006871 Ga0075434_100019339 Ga0075434_1000193394 89
182 3300006871 Ga0075434_100058926 Ga0075434_1000589266 89
183 3300006871 Ga0075434_100095766 Ga0075434_1000957664 89
184 3300006871 Ga0075434_100104676 Ga0075434_1001046764 89
185 3300006871 Ga0075434_100249441 Ga0075434_1002494413 89
186 3300006880 Ga0075429_100000021 Ga0075429_10000002154 89
187 3300006880 Ga0075429_100016408 Ga0075429_1000164083 89
188 3300006880 Ga0075429_100141438 Ga0075429_1001414383 89
189 3300006880 Ga0075429_101906050 Ga0075429_1019060502 89
190 3300006881 Ga0068865_100062083 Ga0068865_1000620833 89
191 3300006881 Ga0068865_100367380 Ga0068865_1003673802 89
192 3300006881 Ga0068865_100462566 Ga0068865_1004625662 89
193 3300006914 Ga0075436_100036175 Ga0075436_1000361756 89
194 3300006914 Ga0075436_100061886 Ga0075436_1000618863 89
195 3300006914 Ga0075436_101036060 Ga0075436_1010360602 89
196 3300006914 Ga0075436_101056007 Ga0075436_1010560072 89
197 3300006931 Ga0097620_100000533 Ga0097620_10000053341 89
198 3300006931 Ga0097620_100296619 Ga0097620_1002966193 89
199 3300007076 Ga0075435_100031805 Ga0075435_1000318053 89
200 3300007076 Ga0075435_100068902 Ga0075435_1000689025 89
201 3300007076 Ga0075435_100108032 Ga0075435_1001080323 89
202 3300007076 Ga0075435_100109569 Ga0075435_1001095694 89
203 3300007076 Ga0075435_100496762 Ga0075435_1004967623 89
204 3300007265 Ga0099794_10000503 Ga0099794_100005039 89
205 3300007265 Ga0099794_10450255 Ga0099794_104502551 89
206 3300007265 Ga0099794_10651642 Ga0099794_106516422 89
207 3300009093 Ga0105240_11886622 Ga0105240_118866222 89
208 3300009094 Ga0111539_10000098 Ga0111539_1000009828 89
209 3300009094 Ga0111539_10000182 Ga0111539_1000018230 89
210 3300009094 Ga0111539_10019865 Ga0111539_1001986510 89
211 3300009094 Ga0111539_10328383 Ga0111539_103283834 89
212 3300009147 Ga0114129_10000002 Ga0114129_10000002132 89
213 3300009147 Ga0114129_10034596 Ga0114129_100345961 89
214 3300009147 Ga0114129_10089569 Ga0114129_100895695 89
215 3300009147 Ga0114129_10155118 Ga0114129_101551186 89
216 3300009147 Ga0114129_10293575 Ga0114129_102935753 89
217 3300009147 Ga0114129_10439398 Ga0114129_104393983 89
218 3300009147 Ga0114129_10472727 Ga0114129_104727271 89
219 3300009147 Ga0114129_10497236 Ga0114129_104972363 89
220 3300009147 Ga0114129_10567988 Ga0114129_105679881 89
221 3300009147 Ga0114129_10818763 Ga0114129_108187633 89
222 3300009147 Ga0114129_12066203 Ga0114129_120662032 89
223 3300009148 Ga0105243_10449421 Ga0105243_104494212 89
224 3300009148 Ga0105243_10600707 Ga0105243_106007072 89
225 3300009148 Ga0105243_10746520 Ga0105243_107465202 89
226 3300009148 Ga0105243_11431357 Ga0105243_114313572 89
227 3300009174 Ga0105241_10002948 Ga0105241_100029486 89
228 3300009174 Ga0105241_10182826 Ga0105241_101828263 89
229 3300009174 Ga0105241_11713727 Ga0105241_117137272 89
230 3300009176 Ga0105242_10114856 Ga0105242_101148564 89
231 3300009177 Ga0105248_10307270 Ga0105248_103072703 89
232 3300009545 Ga0105237_10193261 Ga0105237_101932613 89
233 3300009553 Ga0105249_10502832 Ga0105249_105028322 89
234 3300009553 Ga0105249_10550525 Ga0105249_105505252 89
235 3300009553 Ga0105249_12354112 Ga0105249_123541122 89
236 3300010375 Ga0105239_10058392 Ga0105239_100583926 89
237 3300011119 Ga0105246_10016340 Ga0105246_100163408 89
238 3300013100 Ga0157373_10000176 Ga0157373_1000017624 89
239 3300013102 Ga0157371_10059205 Ga0157371_100592054 89
240 3300013102 Ga0157371_10507006 Ga0157371_105070062 89
241 3300013105 Ga0157369_10021645 Ga0157369_100216454 89
242 3300013297 Ga0157378_10158786 Ga0157378_101587863 89
243 3300013306 Ga0163162_10081405 Ga0163162_100814054 89
244 3300013306 Ga0163162_11754107 Ga0163162_117541072 89
245 3300013306 Ga0163162_11956855 Ga0163162_119568552 89
246 3300013307 Ga0157372_10005276 Ga0157372_100052767 89
247 3300013307 Ga0157372_11177881 Ga0157372_111778812 89
248 3300013308 Ga0157375_10017503 Ga0157375_100175034 89
249 3300013308 Ga0157375_10054737 Ga0157375_100547373 89
250 3300014325 Ga0163163_10133543 Ga0163163_101335434 89
251 3300014326 Ga0157380_11152131 Ga0157380_111521311 89
252 3300014745 Ga0157377_10620035 Ga0157377_106200352 89
253 3300015262 Ga0182007_10030110 Ga0182007_100301103 89
254 3300017792 Ga0163161_10269119 Ga0163161_102691193 89
255 3300020081 Ga0206354_11134721 Ga0206354_111347212 89
256 3300020082 Ga0206353_10370831 Ga0206353_103708312 89
257 3300025321 Ga0207656_10623616 Ga0207656_106236161 89
258 3300025885 Ga0207653_10043055 Ga0207653_100430554 89
259 3300025885 Ga0207653_10186329 Ga0207653_101863292 89
260 3300025899 Ga0207642_10488371 Ga0207642_104883712 89
261 3300025901 Ga0207688_10032458 Ga0207688_100324584 89
262 3300025904 Ga0207647_10321303 Ga0207647_103213031 89
263 3300025905 Ga0207685_10104491 Ga0207685_101044914 89
264 3300025906 Ga0207699_10188239 Ga0207699_101882394 89
265 3300025906 Ga0207699_10862459 Ga0207699_108624592 89
266 3300025907 Ga0207645_10000232 Ga0207645_1000023238 89
267 3300025908 Ga0207643_10000871 Ga0207643_100008718 89
268 3300025910 Ga0207684_10009619 Ga0207684_100096193 89
269 3300025910 Ga0207684_10015909 Ga0207684_100159098 89
270 3300025910 Ga0207684_10177738 Ga0207684_101777382 89
271 3300025910 Ga0207684_10218659 Ga0207684_102186594 89
272 3300025910 Ga0207684_10265128 Ga0207684_102651283 89
273 3300025910 Ga0207684_11746787 Ga0207684_117467871 89
274 3300025911 Ga0207654_10010714 Ga0207654_100107145 89
275 3300025911 Ga0207654_10687303 Ga0207654_106873033 89
276 3300025911 Ga0207654_10698190 Ga0207654_106981902 89
277 3300025912 Ga0207707_10000076 Ga0207707_1000007696 89
278 3300025912 Ga0207707_10161541 Ga0207707_101615413 89
279 3300025915 Ga0207693_10095474 Ga0207693_100954742 89
280 3300025917 Ga0207660_10000514 Ga0207660_1000051419 89
281 3300025917 Ga0207660_10008444 Ga0207660_100084443 89
282 3300025917 Ga0207660_10506773 Ga0207660_105067732 89
283 3300025918 Ga0207662_10522351 Ga0207662_105223512 89
284 3300025919 Ga0207657_10000005 Ga0207657_1000000541 89
285 3300025920 Ga0207649_10057555 Ga0207649_100575556 89
286 3300025921 Ga0207652_10000060 Ga0207652_1000006018 89
287 3300025922 Ga0207646_10013579 Ga0207646_100135796 89
288 3300025922 Ga0207646_10020969 Ga0207646_100209695 89
289 3300025922 Ga0207646_10023404 Ga0207646_100234045 89
290 3300025922 Ga0207646_10038020 Ga0207646_100380205 89
291 3300025922 Ga0207646_10046542 Ga0207646_100465424 89
292 3300025922 Ga0207646_10078974 Ga0207646_100789743 89
293 3300025922 Ga0207646_10489712 Ga0207646_104897122 89
294 3300025922 Ga0207646_11097359 Ga0207646_110973592 89
295 3300025923 Ga0207681_10265938 Ga0207681_102659383 89
296 3300025923 Ga0207681_10382542 Ga0207681_103825423 89
297 3300025923 Ga0207681_10946738 Ga0207681_109467381 89
298 3300025925 Ga0207650_10192383 Ga0207650_101923833 89
299 3300025928 Ga0207700_11704484 Ga0207700_117044842 89
300 3300025932 Ga0207690_10241596 Ga0207690_102415963 89
301 3300025933 Ga0207706_10003272 Ga0207706_1000327214 89
302 3300025933 Ga0207706_10037858 Ga0207706_100378584 89
303 3300025933 Ga0207706_10267976 Ga0207706_102679762 89
304 3300025934 Ga0207686_10036416 Ga0207686_100364164 89
305 3300025935 Ga0207709_10145565 Ga0207709_101455653 89
306 3300025935 Ga0207709_10293352 Ga0207709_102933522 89
307 3300025935 Ga0207709_10769509 Ga0207709_107695092 89
308 3300025936 Ga0207670_10007115 Ga0207670_100071157 89
309 3300025936 Ga0207670_10033481 Ga0207670_100334813 89
310 3300025936 Ga0207670_10896146 Ga0207670_108961462 89
311 3300025937 Ga0207669_11349606 Ga0207669_113496062 89
312 3300025938 Ga0207704_10388106 Ga0207704_103881063 89
313 3300025938 Ga0207704_10413570 Ga0207704_104135702 89
314 3300025939 Ga0207665_10000907 Ga0207665_1000090719 89
315 3300025940 Ga0207691_10068537 Ga0207691_100685373 89
316 3300025941 Ga0207711_10421515 Ga0207711_104215153 89
317 3300025942 Ga0207689_10000423 Ga0207689_1000042339 89
318 3300025942 Ga0207689_10760819 Ga0207689_107608191 89
319 3300025944 Ga0207661_10347104 Ga0207661_103471043 89
320 3300025945 Ga0207679_10000231 Ga0207679_1000023136 89
321 3300025949 Ga0207667_10001202 Ga0207667_1000120229 89
322 3300025960 Ga0207651_11254030 Ga0207651_112540302 89
323 3300025961 Ga0207712_10462006 Ga0207712_104620061 89
324 3300025972 Ga0207668_10379177 Ga0207668_103791774 89
325 3300025972 Ga0207668_10652483 Ga0207668_106524832 89
326 3300025972 Ga0207668_11819157 Ga0207668_118191571 89
327 3300025981 Ga0207640_10022458 Ga0207640_100224585 89
328 3300025986 Ga0207658_10814074 Ga0207658_108140742 89
329 3300026023 Ga0207677_10119935 Ga0207677_101199353 89
330 3300026035 Ga0207703_10027052 Ga0207703_100270526 89
331 3300026041 Ga0207639_10000571 Ga0207639_1000057123 89
332 3300026067 Ga0207678_10005780 Ga0207678_100057805 89
333 3300026075 Ga0207708_10174817 Ga0207708_101748173 89
334 3300026078 Ga0207702_10000576 Ga0207702_1000057639 89
335 3300026088 Ga0207641_10274759 Ga0207641_102747592 89
336 3300026089 Ga0207648_10000565 Ga0207648_1000056530 89
337 3300026089 Ga0207648_10148077 Ga0207648_101480774 89
338 3300026095 Ga0207676_10065966 Ga0207676_100659665 89
339 3300026116 Ga0207674_10001421 Ga0207674_1000142119 89
340 3300026116 Ga0207674_10416390 Ga0207674_104163903 89
341 3300026118 Ga0207675_100000795 Ga0207675_10000079518 89
342 3300026118 Ga0207675_100381262 Ga0207675_1003812623 89
343 3300027360 Ga0209969_1007467 Ga0209969_10074673 89
344 3300027378 Ga0209981_1008124 Ga0209981_10081243 89
345 3300027395 Ga0209996_1010954 Ga0209996_10109543 89
346 3300027424 Ga0209984_1025367 Ga0209984_10253672 89
347 3300027462 Ga0210000_1030615 Ga0210000_10306152 89
348 3300027471 Ga0209995_1006412 Ga0209995_10064121 89
349 3300027526 Ga0209968_1004063 Ga0209968_10040634 89
350 3300027552 Ga0209982_1003255 Ga0209982_10032555 89
351 3300027614 Ga0209970_1003842 Ga0209970_10038422 89
352 3300027617 Ga0210002_1007517 Ga0210002_10075172 89
353 3300027665 Ga0209983_1000319 Ga0209983_100031913 89
354 3300027671 Ga0209588_1001293 Ga0209588_10012939 89
355 3300027682 Ga0209971_1000016 Ga0209971_100001644 89
356 3300027695 Ga0209966_1000083 Ga0209966_10000833 89
357 3300027717 Ga0209998_10000186 Ga0209998_1000018625 89
358 3300027876 Ga0209974_10010451 Ga0209974_100104513 89
359 3300027907 Ga0207428_11252088 Ga0207428_112520881 89
360 3300028380 Ga0268265_10024557 Ga0268265_100245575 89
361 3300028381 Ga0268264_10630298 Ga0268264_106302983 89
362 3300028381 Ga0268264_10664707 Ga0268264_106647072 89
363 3300031548 Ga0307408_100019353 Ga0307408_1000193534 89
364 3300031548 Ga0307408_100598345 Ga0307408_1005983452 89
365 3300031548 Ga0307408_100608332 Ga0307408_1006083322 89
366 3300031548 Ga0307408_101157323 Ga0307408_1011573231 89
367 3300031731 Ga0307405_10068590 Ga0307405_100685903 89
368 3300031731 Ga0307405_10457013 Ga0307405_104570133 89
369 3300031824 Ga0307413_11010410 Ga0307413_110104102 89
370 3300031911 Ga0307412_10079111 Ga0307412_100791113 89
371 3300031995 Ga0307409_100201694 Ga0307409_1002016944 89
372 3300032002 Ga0307416_100120640 Ga0307416_1001206402 89
373 3300032005 Ga0307411_12236046 Ga0307411_122360462 89
374 3300032126 Ga0307415_100255359 Ga0307415_1002553591 89
375 3300034817 Ga0373948_0078945 Ga0373948_0078945_204_479 89
376 3300034817 Ga0373948_0191570 Ga0373948_0191570_58_336 89
377 3300034820 Ga0373959_0018418 Ga0373959_0018418_270_545 89
378 3300035083 Ga0373926_0369777 Ga0373926_0369777_136_444 89
379 3300035088 Ga0373940_0020189 Ga0373940_0020189_1163_1438 89
380 3300035088 Ga0373940_0064400 Ga0373940_0064400_357_635 89
381 3300035090 Ga0373949_0027963 Ga0373949_0027963_762_1037 89
382 3300035091 Ga0373951_0003783 Ga0373951_0003783_2832_3107 89
383 3300035112 Ga0373932_0024625 Ga0373932_0024625_432_710 89
384 3300035112 Ga0373932_0042632 Ga0373932_0042632_193_471 89
385 3300035112 Ga0373932_0221219 Ga0373932_0221219_89_400 89
386 3300035115 Ga0373941_0008250 Ga0373941_0008250_2019_2297 89
387 3300035121 Ga0373960_0096028 Ga0373960_0096028_316_591 89
388 3300035121 Ga0373960_0257290 Ga0373960_0257290_67_345 89
389 3300035207 Ga0373942_0078924 Ga0373942_0078924_146_421 89
390 3300035207 Ga0373942_0244663 Ga0373942_0244663_100_378 89
391 3300035241 Ga0373961_0154908 Ga0373961_0154908_41_349 89
392 3300035242 Ga0373962_0036421 Ga0373962_0036421_683_958 89
393 3300035691 Ga0373931_0002121 Ga0373931_0002121_63_341 89
394 3300035691 Ga0373931_0174321 Ga0373931_0174321_339_614 89
395 3300035691 Ga0373931_1069353 Ga0373931_1069353_127_438 89
396 3300038443 Ga0395901_2149756 Ga0395901_2149756_130_447 89
397 3300038996 Ga0242420_014824 Ga0242420_014824_754_1062 89
398 3300038996 Ga0242420_091729 Ga0242420_091729_348_623 89
399 3300042005 Ga0439448_0000194 Ga0439448_0000194_1659_1934 89
400 3300042008 Ga0439450_032463 Ga0439450_032463_416_745 89
401 3300042012 Ga0439455_0019620 Ga0439455_0019620_598_873 89
402 3300042130 Ga0450892_042802 Ga0450892_042802_203_478 89
403 3300042134 Ga0450898_031285 Ga0450898_031285_166_441 89
404 3300042144 Ga0450889_025175 Ga0450889_025175_151_426 89
405 3300042157 Ga0439458_0005713 Ga0439458_0005713_523_798 89
406 3300042438 Ga0439459_0000085 Ga0439459_0000085_2712_2987 89
407 3300042438 Ga0439459_0248764 Ga0439459_0248764_189_464 89
408 3300042439 Ga0439464_0050594 Ga0439464_0050594_469_798 89
409 3300042461 Ga0439460_0000040 Ga0439460_0000040_5984_6313 89
410 3300042461 Ga0439460_0230921 Ga0439460_0230921_70_345 89
411 3300042876 Ga0451577_0023293 Ga0451577_0023293_3239_3514 89
412 3300042876 Ga0451577_0071964 Ga0451577_0071964_2142_2471 89
413 3300042876 Ga0451577_0153712 Ga0451577_0153712_1686_1961 89
414 3300042876 Ga0451577_1165076 Ga0451577_1165076_66_344 89
415 3300044673 Ga0453683_0046226 Ga0453683_0046226_1552_1827 89
416 3300044673 Ga0453683_0080277 Ga0453683_0080277_555_833 89
417 3300044673 Ga0453683_0860137 Ga0453683_0860137_218_493 89
418 3300044712 Ga0453684_0030395 Ga0453684_0030395_1873_2148 89
419 3300044712 Ga0453684_0334218 Ga0453684_0334218_696_971 89
420 3300044712 Ga0453684_0378239 Ga0453684_0378239_737_1045 89
421 3300045051 Ga0451576_0065930 Ga0451576_0065930_1084_1392 89
422 3300045051 Ga0451576_0120397 Ga0451576_0120397_2268_2543 89
423 3300045051 Ga0451576_0135218 Ga0451576_0135218_1227_1556 89
424 3300045051 Ga0451576_0225154 Ga0451576_0225154_1070_1345 89
425 3300045051 Ga0451576_0263860 Ga0451576_0263860_1465_1740 89
426 3300046499 Ga0495594_0239046 Ga0495594_0239046_490_768 89
427 3300048903 Ga0496100_1168968 Ga0496100_1168968_173_451 89
428 3300048905 Ga0496102_0101668 Ga0496102_0101668_2128_2403 89
429 3300048905 Ga0496102_1185707 Ga0496102_1185707_261_539 89
430 3300048907 Ga0496104_1135177 Ga0496104_1135177_314_589 89
431 3300048909 Ga0496106_0012725 Ga0496106_0012725_5437_5715 89
432 3300048909 Ga0496106_0481310 Ga0496106_0481310_502_780 89
433 3300048910 Ga0496107_0169182 Ga0496107_0169182_513_791 89
434 3300048911 Ga0496108_0442272 Ga0496108_0442272_692_967 89
435 3300048915 Ga0496112_0104155 Ga0496112_0104155_1155_1430 89
436 3300049129 Ga0501309_030418 Ga0501309_030418_228_506 89
437 3300049522 Ga0501299_120183 Ga0501299_120183_254_532 89
438 3300049522 Ga0501299_174364 Ga0501299_174364_10_288 89
439 3300049568 Ga0501031_0191196 Ga0501031_0191196_202_531 89
440 3300049568 Ga0501031_0284217 Ga0501031_0284217_341_619 89
441 3300049569 Ga0501032_0259205 Ga0501032_0259205_571_849 89
442 3300049569 Ga0501032_0359753 Ga0501032_0359753_428_703 89
443 3300049570 Ga0501033_0030492 Ga0501033_0030492_3623_3901 89
444 3300049570 Ga0501033_0036137 Ga0501033_0036137_308_637 89
445 3300049570 Ga0501033_0140789 Ga0501033_0140789_270_599 89
446 3300049572 Ga0501036_0038426 Ga0501036_0038426_3070_3399 89
447 3300049572 Ga0501036_0113302 Ga0501036_0113302_653_931 89
448 3300049572 Ga0501036_0231144 Ga0501036_0231144_78_347 89
449 3300049572 Ga0501036_0573092 Ga0501036_0573092_399_674 89
450 3300049572 Ga0501036_0904762 Ga0501036_0904762_296_574 89
451 3300049572 Ga0501036_1073062 Ga0501036_1073062_139_417 89
452 3300049573 Ga0501037_0123077 Ga0501037_0123077_112_390 89
453 3300049574 Ga0501038_0029104 Ga0501038_0029104_2981_3310 89
454 3300049574 Ga0501038_0147601 Ga0501038_0147601_1557_1835 89
455 3300049574 Ga0501038_0581108 Ga0501038_0581108_340_669 89
456 3300049574 Ga0501038_0582981 Ga0501038_0582981_392_670 89
457 3300049574 Ga0501038_0938840 Ga0501038_0938840_120_398 89
458 3300049575 Ga0501039_0023016 Ga0501039_0023016_1227_1505 89
459 3300049575 Ga0501039_0045755 Ga0501039_0045755_1134_1463 89
460 3300049575 Ga0501039_0254450 Ga0501039_0254450_837_1151 89
461 3300049575 Ga0501039_0308011 Ga0501039_0308011_550_825 89
462 3300049575 Ga0501039_1212281 Ga0501039_1212281_179_508 89
463 3300049575 Ga0501039_1253949 Ga0501039_1253949_239_517 89
464 3300049576 Ga0501040_0003866 Ga0501040_0003866_5517_5846 89
465 3300049576 Ga0501040_0021147 Ga0501040_0021147_2631_2906 89
466 3300049576 Ga0501040_0177448 Ga0501040_0177448_1200_1478 89
467 3300049576 Ga0501040_0460982 Ga0501040_0460982_437_715 89
468 3300049576 Ga0501040_0504342 Ga0501040_0504342_234_509 89
469 3300049576 Ga0501040_1097577 Ga0501040_1097577_264_542 89
470 3300049577 Ga0501041_0019623 Ga0501041_0019623_3329_3604 89
471 3300049577 Ga0501041_0047897 Ga0501041_0047897_325_600 89
472 3300049577 Ga0501041_0078068 Ga0501041_0078068_1444_1773 89
473 3300049577 Ga0501041_0093261 Ga0501041_0093261_472_801 89
474 3300049578 Ga0501042_0000478 Ga0501042_0000478_10833_11162 89
475 3300049578 Ga0501042_0017246 Ga0501042_0017246_2173_2502 89
476 3300049578 Ga0501042_0171073 Ga0501042_0171073_485_763 89
477 3300049578 Ga0501042_0653097 Ga0501042_0653097_277_585 89
478 3300049578 Ga0501042_0684994 Ga0501042_0684994_111_386 89
479 3300049578 Ga0501042_1329073 Ga0501042_1329073_34_360 89
480 3300049579 Ga0501043_0151069 Ga0501043_0151069_516_845 89
481 3300049579 Ga0501043_0219013 Ga0501043_0219013_371_649 89
482 3300049579 Ga0501043_0571621 Ga0501043_0571621_496_825 89
483 3300049580 Ga0501046_0000115 Ga0501046_0000115_53872_54201 89
484 3300049580 Ga0501046_0069930 Ga0501046_0069930_1682_2011 89
485 3300049580 Ga0501046_0534665 Ga0501046_0534665_67_345 89
486 3300049582 Ga0501048_0004927 Ga0501048_0004927_4517_4846 89
487 3300049582 Ga0501048_0062307 Ga0501048_0062307_1284_1562 89
488 3300049582 Ga0501048_0068115 Ga0501048_0068115_135_413 89
489 3300049582 Ga0501048_0157964 Ga0501048_0157964_484_813 89
490 3300049582 Ga0501048_0349342 Ga0501048_0349342_536_811 89
491 3300049583 Ga0501067_0043144 Ga0501067_0043144_1664_1939 89
492 3300049584 Ga0501068_0062457 Ga0501068_0062457_229_558 89
493 3300049585 Ga0501069_0194657 Ga0501069_0194657_555_863 89
494 3300049586 Ga0501070_1240019 Ga0501070_1240019_180_488 89
495 3300049587 Ga0501071_0286918 Ga0501071_0286918_259_537 89
496 3300049587 Ga0501071_0354077 Ga0501071_0354077_554_883 89
497 3300049587 Ga0501071_0389942 Ga0501071_0389942_98_376 89
498 3300049587 Ga0501071_0538360 Ga0501071_0538360_496_825 89
499 3300049587 Ga0501071_0892757 Ga0501071_0892757_292_561 89
500 3300049588 Ga0501072_0007495 Ga0501072_0007495_4186_4515 89
501 3300049588 Ga0501072_0010133 Ga0501072_0010133_5515_5793 89
502 3300049588 Ga0501072_0076053 Ga0501072_0076053_1942_2271 89
503 3300049588 Ga0501072_0096155 Ga0501072_0096155_895_1170 89
504 3300049588 Ga0501072_0249975 Ga0501072_0249975_217_525 89
505 3300049588 Ga0501072_0476264 Ga0501072_0476264_558_833 89
506 3300049589 Ga0501073_0252740 Ga0501073_0252740_781_1059 89
507 3300049589 Ga0501073_0489971 Ga0501073_0489971_241_570 89
508 3300049589 Ga0501073_0647770 Ga0501073_0647770_59_388 89
509 3300049590 Ga0501074_0036269 Ga0501074_0036269_1885_2214 89
510 3300049590 Ga0501074_0443316 Ga0501074_0443316_571_846 89
511 3300049591 Ga0501075_0000143 Ga0501075_0000143_11352_11681 89
512 3300049591 Ga0501075_0008042 Ga0501075_0008042_4977_5306 89
513 3300049591 Ga0501075_0021792 Ga0501075_0021792_950_1225 89
514 3300049591 Ga0501075_0038227 Ga0501075_0038227_3148_3423 89
515 3300049591 Ga0501075_0061567 Ga0501075_0061567_1214_1492 89
516 3300049591 Ga0501075_0173362 Ga0501075_0173362_806_1084 89
517 3300049591 Ga0501075_0183149 Ga0501075_0183149_1028_1306 89
518 3300049591 Ga0501075_0423340 Ga0501075_0423340_146_454 89
519 3300049591 Ga0501075_0607929 Ga0501075_0607929_458_787 89
520 3300049592 Ga0501076_0005597 Ga0501076_0005597_1975_2304 89
521 3300049592 Ga0501076_0006074 Ga0501076_0006074_4370_4699 89
522 3300049592 Ga0501076_0135832 Ga0501076_0135832_1514_1789 89
523 3300049592 Ga0501076_0148837 Ga0501076_0148837_1353_1631 89
524 3300049592 Ga0501076_0151981 Ga0501076_0151981_1046_1321 89
525 3300049592 Ga0501076_0335126 Ga0501076_0335126_506_781 89
526 3300049593 Ga0501077_0020563 Ga0501077_0020563_3595_3873 89
527 3300049593 Ga0501077_0037087 Ga0501077_0037087_226_501 89
528 3300049593 Ga0501077_0044495 Ga0501077_0044495_564_842 89
529 3300049593 Ga0501077_0044873 Ga0501077_0044873_2515_2784 89
530 3300049593 Ga0501077_0072508 Ga0501077_0072508_1233_1562 89
531 3300049593 Ga0501077_0116959 Ga0501077_0116959_210_539 89
532 3300049593 Ga0501077_0625212 Ga0501077_0625212_243_551 89
533 3300049705 Ga0501225_0209263 Ga0501225_0209263_214_492 89
534 3300049707 Ga0501234_057341 Ga0501234_057341_71_349 89
535 3300049741 Ga0501079_0002407 Ga0501079_0002407_1496_1825 89
536 3300049741 Ga0501079_0005017 Ga0501079_0005017_4081_4356 89
537 3300049741 Ga0501079_0015441 Ga0501079_0015441_2180_2458 89
538 3300049741 Ga0501079_0015801 Ga0501079_0015801_1717_1992 89
539 3300049741 Ga0501079_0018848 Ga0501079_0018848_3371_3700 89
540 3300049741 Ga0501079_0061444 Ga0501079_0061444_1760_2038 89
541 3300049741 Ga0501079_0222386 Ga0501079_0222386_833_1162 89
542 3300049741 Ga0501079_0364557 Ga0501079_0364557_748_1023 89
543 3300049741 Ga0501079_1209308 Ga0501079_1209308_58_336 89
544 3300049742 Ga0501080_0001618 Ga0501080_0001618_2149_2478 89
545 3300049742 Ga0501080_0052107 Ga0501080_0052107_1139_1468 89
546 3300049742 Ga0501080_0132422 Ga0501080_0132422_1567_1845 89
547 3300049742 Ga0501080_0139189 Ga0501080_0139189_34_312 89
548 3300049742 Ga0501080_0211939 Ga0501080_0211939_1197_1472 89
549 3300049742 Ga0501080_0215836 Ga0501080_0215836_310_585 89
550 3300049742 Ga0501080_1135773 Ga0501080_1135773_336_659 89
551 3300049743 Ga0501081_0009979 Ga0501081_0009979_5081_5410 89
552 3300049743 Ga0501081_0020851 Ga0501081_0020851_119_394 89
553 3300049743 Ga0501081_0026034 Ga0501081_0026034_1845_2123 89
554 3300049743 Ga0501081_0026773 Ga0501081_0026773_3520_3849 89
555 3300049743 Ga0501081_0046408 Ga0501081_0046408_1000_1275 89
556 3300049743 Ga0501081_0102421 Ga0501081_0102421_502_780 89
557 3300049743 Ga0501081_0224295 Ga0501081_0224295_756_1034 89
558 3300049743 Ga0501081_0465812 Ga0501081_0465812_476_751 89
559 3300049743 Ga0501081_0889350 Ga0501081_0889350_111_389 89
560 3300049743 Ga0501081_0943615 Ga0501081_0943615_181_456 89
561 3300049744 Ga0501083_0014076 Ga0501083_0014076_5151_5480 89
562 3300049744 Ga0501083_0044283 Ga0501083_0044283_2350_2679 89
563 3300049744 Ga0501083_0139766 Ga0501083_0139766_696_974 89
564 3300049744 Ga0501083_0330712 Ga0501083_0330712_72_350 89
565 3300049822 Ga0501035_0041447 Ga0501035_0041447_3439_3768 89
566 3300049822 Ga0501035_0567352 Ga0501035_0567352_129_455 89
567 3300049824 Ga0501045_0001069 Ga0501045_0001069_6281_6559 89
568 3300049824 Ga0501045_0003469 Ga0501045_0003469_4998_5327 89
569 3300049824 Ga0501045_0041722 Ga0501045_0041722_156_467 89
570 3300049824 Ga0501045_0052413 Ga0501045_0052413_2611_2943 89
571 3300049824 Ga0501045_0062802 Ga0501045_0062802_425_754 89
572 3300049824 Ga0501045_0068810 Ga0501045_0068810_1713_1988 89
573 3300049824 Ga0501045_0147033 Ga0501045_0147033_557_835 89
574 3300049824 Ga0501045_0244661 Ga0501045_0244661_787_1062 89
575 3300049824 Ga0501045_0355480 Ga0501045_0355480_710_1018 89
576 3300050507 nmdc:mga05p37_110911_c1 nmdc:mga05p37_110911_c1_829_1143 89
577 3300050507 nmdc:mga05p37_114229_c1 nmdc:mga05p37_114229_c1_2098_2373 89
578 3300050507 nmdc:mga05p37_232223_c1 nmdc:mga05p37_232223_c1_1337_1612 89
579 3300050507 nmdc:mga05p37_29443_c1 nmdc:mga05p37_29443_c1_5115_5429 89
580 3300050507 nmdc:mga05p37_2_c1 nmdc:mga05p37_2_c1_87873_88151 89
581 3300050507 nmdc:mga05p37_515013_c1 nmdc:mga05p37_515013_c1_756_1070 89
582 3300050507 nmdc:mga05p37_522927_c1 nmdc:mga05p37_522927_c1_236_514 89
583 3300050507 nmdc:mga05p37_828547_c1 nmdc:mga05p37_828547_c1_688_966 89
584 3300050507 nmdc:mga05p37_844240_c1 nmdc:mga05p37_844240_c1_536_814 89
585 3300050508 nmdc:mga09592_54253_c1 nmdc:mga09592_54253_c1_1446_1724 89
586 3300050508 nmdc:mga09592_55509_c1 nmdc:mga09592_55509_c1_881_1195 89
587 3300050508 nmdc:mga09592_902088_c1 nmdc:mga09592_902088_c1_258_566 89
588 3300050508 nmdc:mga09592_959_c1 nmdc:mga09592_959_c1_4797_5075 89
589 3300050509 nmdc:mga0qj67_109060_c2 nmdc:mga0qj67_109060_c2_675_953 89
590 3300050509 nmdc:mga0qj67_183231_c1 nmdc:mga0qj67_183231_c1_832_1146 89
591 3300050509 nmdc:mga0qj67_64225_c1 nmdc:mga0qj67_64225_c1_2161_2439 89
592 3300050510 nmdc:mga06r32_101849_c1 nmdc:mga06r32_101849_c1_139_417 89
593 3300050510 nmdc:mga06r32_116859_c1 nmdc:mga06r32_116859_c1_87_365 89
594 3300050510 nmdc:mga06r32_1317738_c1 nmdc:mga06r32_1317738_c1_114_392 89
595 3300050510 nmdc:mga06r32_163181_c1 nmdc:mga06r32_163181_c1_701_1015 89
596 3300050510 nmdc:mga06r32_673070_c1 nmdc:mga06r32_673070_c1_551_865 89
597 3300050510 nmdc:mga06r32_695_c1 nmdc:mga06r32_695_c1_2152_2430 89
598 3300050511 nmdc:mga08y16_254871_c1 nmdc:mga08y16_254871_c1_1186_1464 89
599 3300050512 nmdc:mga0n895_207725_c1 nmdc:mga0n895_207725_c1_709_987 89
600 3300050512 nmdc:mga0n895_226753_c2 nmdc:mga0n895_226753_c2_326_634 89
601 3300050512 nmdc:mga0n895_667055_c1 nmdc:mga0n895_667055_c1_705_980 89
602 3300050512 nmdc:mga0n895_7354_c1 nmdc:mga0n895_7354_c1_1392_1670 89
603 3300050513 nmdc:mga0rr50_1125703_c1 nmdc:mga0rr50_1125703_c1_181_456 89
604 3300050513 nmdc:mga0rr50_184072_c1 nmdc:mga0rr50_184072_c1_647_922 89
605 3300050513 nmdc:mga0rr50_305441_c1 nmdc:mga0rr50_305441_c1_546_821 89
606 3300050513 nmdc:mga0rr50_466143_c1 nmdc:mga0rr50_466143_c1_25_303 89
607 3300050513 nmdc:mga0rr50_70814_c1 nmdc:mga0rr50_70814_c1_1126_1404 89
608 3300050513 nmdc:mga0rr50_813048_c1 nmdc:mga0rr50_813048_c1_344_658 89
609 3300050514 nmdc:mga08x19_114603_c1 nmdc:mga08x19_114603_c1_935_1243 89
610 3300050514 nmdc:mga08x19_1284594_c1 nmdc:mga08x19_1284594_c1_107_385 89
611 3300050514 nmdc:mga08x19_158420_c1 nmdc:mga08x19_158420_c1_669_944 89
612 3300050514 nmdc:mga08x19_20105_c1 nmdc:mga08x19_20105_c1_2462_2737 89
613 3300050515 nmdc:mga0a205_312010_c1 nmdc:mga0a205_312010_c1_522_836 89
614 3300050515 nmdc:mga0a205_348483_c1 nmdc:mga0a205_348483_c1_17_295 89
615 3300050515 nmdc:mga0a205_41704_c1 nmdc:mga0a205_41704_c1_3214_3522 89
616 3300050515 nmdc:mga0a205_7120_c1 nmdc:mga0a205_7120_c1_423_698 89
617 3300050515 nmdc:mga0a205_805658_c1 nmdc:mga0a205_805658_c1_384_698 89
618 3300054114 Ga0501084_0012422 Ga0501084_0012422_5362_5691 89
619 3300054114 Ga0501084_0018019 Ga0501084_0018019_1694_1972 89
620 3300054114 Ga0501084_0022793 Ga0501084_0022793_568_897 89
621 3300054114 Ga0501084_0101974 Ga0501084_0101974_1144_1419 89
622 3300054114 Ga0501084_0124719 Ga0501084_0124719_1374_1703 89
623 3300054114 Ga0501084_0223534 Ga0501084_0223534_49_363 89
624 3300059421 Ga0590071_087421 Ga0590071_087421_309_587 89
625 3300060353 Ga0501082_0001107 Ga0501082_0001107_5290_5619 89
626 3300060353 Ga0501082_0058304 Ga0501082_0058304_1273_1551 89
627 3300060353 Ga0501082_0116747 Ga0501082_0116747_496_825 89
628 3300060353 Ga0501082_0150954 Ga0501082_0150954_475_750 89
629 3300060353 Ga0501082_0181043 Ga0501082_0181043_800_1075 89
630 3300060353 Ga0501082_0302735 Ga0501082_0302735_306_584 89
631 3300060353 Ga0501082_0518908 Ga0501082_0518908_238_513 89
632 3300060353 Ga0501082_0575423 Ga0501082_0575423_511_789 89
633 3300060353 Ga0501082_0999712 Ga0501082_0999712_104_379 89
634 3300061734 Ga0530510_0005890 Ga0530510_0005890_3466_3795 89
635 3300061734 Ga0530510_0013587 Ga0530510_0013587_1440_1754 89
636 3300061734 Ga0530510_0037417 Ga0530510_0037417_2417_2692 89
637 3300061734 Ga0530510_0043068 Ga0530510_0043068_1014_1292 89
638 3300061734 Ga0530510_0239184 Ga0530510_0239184_852_1130 89
639 3300061734 Ga0530510_0274035 Ga0530510_0274035_830_1138 89
640 3300061734 Ga0530510_0296212 Ga0530510_0296212_181_459 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

90

0.97

PF08534

Redoxin

Redoxin

3

109

0.85

Feature Viewer

pLDDT pTM Quality
68.95 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map