F471662

General Info

Members Datasets Scaffolds Average Seq Length
640 320 1280 109

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100293167|Ga0070670_1002931673
Length 124
Sequence MASGGSAIRGSRVGSGPMGEQDRGYHADRVAISYWDALGNETVRYFAANLPTEEIPEVIDSPNSGLPAGRDKDNPPQLAKMEPYKTHLAYVKERRSDTEAEQLLEEALDQLRARRGTTAPSSKK

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
173 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
174 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
191 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
192 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
249 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
286 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
292 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
293 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
300 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
301 2643221616 Leifsonia sp. Root227 Isolate Unclassified
302 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
303 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
304 2808606372 Agromyces sp. 23-23 Isolate Unclassified
305 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
306 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
307 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
308 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
309 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
310 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
311 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
312 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
313 2928153084 Leifsonia sp. 563 Isolate Unclassified
314 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
315 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
316 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
317 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
318 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
319 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
320 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 8.59
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.38
Nodule 0
Rhizoplane 2.97
Rhizosphere 79.84
Stem 0
Stem Tuber 0.16
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100293167 3300005331 Bacteria 1422
2 LJQas_1000241 3300000549 Bacteria 10041
3 JGI24740J21852_10005425 3300001979 Bacteria 5392
4 JGI24740J21852_10113229 3300001979 Bacteria 683
5 JGI24739J22299_10009525 3300001989 Bacteria 3618
6 JGI24739J22299_10076629 3300001989 Bacteria 1032
7 JGI24739J22299_10136435 3300001989 Bacteria 728
8 JGI24737J22298_10059960 3300001990 Bacteria 1146
9 JGI24737J22298_10078447 3300001990 Bacteria 984
10 JGI24743J22301_10045189 3300001991 Bacteria 890
11 JGI24735J21928_10008300 3300002067 Bacteria 3363
12 JGI24735J21928_10014629 3300002067 Bacteria 2456
13 JGI24735J21928_10107581 3300002067 Bacteria 802
14 JGI24738J21930_10025363 3300002075 Bacteria 1218
15 JGI25165J46597_1000330 3300003214 Bacteria 56543
16 rootH2_10194546 3300003320 Bacteria 2223
17 Ga0006562J51391_1008545 3300003578 Bacteria 692
18 Ga0055539_1000008 3300003752 Bacteria 537665
19 Ga0055539_1010915 3300003752 Bacteria 1123
20 Ga0055533_1000001 3300003756 Bacteria 1863437
21 Ga0055525_1001411 3300003759 Bacteria 4503
22 Ga0055527_1000001 3300003760 Bacteria 850044
23 Ga0055529_1000018 3300003763 Bacteria 344344
24 Ga0055541_1002500 3300003841 Bacteria 3657
25 Ga0070658_10008837 3300005327 Bacteria 8099
26 Ga0070658_11456931 3300005327 Bacteria 594
27 Ga0070658_11750988 3300005327 Bacteria 538
28 Ga0070683_100776619 3300005329 Bacteria 918
29 Ga0070683_101415641 3300005329 Bacteria 668
30 Ga0070683_101834750 3300005329 Bacteria 583
31 Ga0070682_100283399 3300005337 Bacteria 1209
32 Ga0070682_100380695 3300005337 Bacteria 1061
33 Ga0070682_100750033 3300005337 Bacteria 788
34 Ga0068868_100110213 3300005338 Bacteria 2236
35 Ga0070660_100055570 3300005339 Bacteria 3059
36 Ga0070660_101201619 3300005339 Bacteria 643
37 Ga0070661_101168610 3300005344 Bacteria 643
38 Ga0070668_100233975 3300005347 Bacteria 1520
39 Ga0070668_100301075 3300005347 Bacteria 1345
40 Ga0070668_100755766 3300005347 Bacteria 861
41 Ga0070675_101518205 3300005354 Bacteria 618
42 Ga0070671_100115519 3300005355 Bacteria 2256
43 Ga0070674_100019182 3300005356 Bacteria 4341
44 Ga0070673_100454089 3300005364 Bacteria 1153
45 Ga0070659_100003361 3300005366 Bacteria 11386
46 Ga0070659_100125550 3300005366 Bacteria 2082
47 Ga0070659_101805678 3300005366 Bacteria 548
48 Ga0070667_100004757 3300005367 Bacteria 11377
49 Ga0070667_100134106 3300005367 Bacteria 2164
50 Ga0070714_100000006 3300005435 Bacteria 293311
51 Ga0070714_100506569 3300005435 Bacteria 1152
52 Ga0070710_10018243 3300005437 Bacteria 3607
53 Ga0070710_10351216 3300005437 Bacteria 976
54 Ga0070663_100125242 3300005455 Bacteria 1946
55 Ga0070663_100890786 3300005455 Bacteria 768
56 Ga0070663_101524096 3300005455 Bacteria 595
57 Ga0070678_100294454 3300005456 Bacteria 1377
58 Ga0070678_100687339 3300005456 Bacteria 921
59 Ga0070681_10349522 3300005458 Bacteria 1389
60 Ga0068867_100549643 3300005459 Bacteria 1000
61 Ga0070685_10170848 3300005466 Bacteria 1393
62 Ga0070699_100111607 3300005518 Bacteria 2401
63 Ga0070699_102137096 3300005518 Bacteria 511
64 Ga0068853_100010241 3300005539 Bacteria 7583
65 Ga0068853_100435882 3300005539 Bacteria 1231
66 Ga0070672_100024298 3300005543 Bacteria 4476
67 Ga0068855_100001400 3300005563 Bacteria 29906
68 Ga0068855_100084922 3300005563 Bacteria 3664
69 Ga0068855_100212438 3300005563 Bacteria 2173
70 Ga0068855_100974484 3300005563 Bacteria 892
71 Ga0068855_101208835 3300005563 Bacteria 786
72 Ga0068857_100002185 3300005577 Bacteria 15913
73 Ga0068857_100159913 3300005577 Bacteria 2043
74 Ga0068854_100254413 3300005578 Bacteria 1404
75 Ga0068856_100099272 3300005614 Bacteria 2902
76 Ga0068856_100100951 3300005614 Bacteria 2878
77 Ga0068856_100118210 3300005614 Bacteria 2652
78 Ga0068856_100393759 3300005614 Bacteria 1405
79 Ga0068852_100010191 3300005616 Bacteria 7006
80 Ga0068852_100018357 3300005616 Bacteria 5510
81 Ga0068852_100067521 3300005616 Bacteria 3126
82 Ga0068852_101510659 3300005616 Bacteria 694
83 Ga0068859_100436798 3300005617 Bacteria 1405
84 Ga0068864_100099110 3300005618 Bacteria 2581
85 Ga0068864_101497253 3300005618 Bacteria 678
86 Ga0068864_102617348 3300005618 Bacteria 510
87 Ga0068861_100679048 3300005719 Bacteria 955
88 Ga0068851_10000061 3300005834 Bacteria 60738
89 Ga0068851_10296377 3300005834 Bacteria 929
90 Ga0068870_10542235 3300005840 Bacteria 782
91 Ga0068863_100175105 3300005841 Bacteria 2059
92 Ga0068863_101662338 3300005841 Bacteria 648
93 Ga0068858_100000153 3300005842 Bacteria 72963
94 Ga0068860_100872465 3300005843 Bacteria 915
95 Ga0068860_102465382 3300005843 Bacteria 540
96 Ga0081455_10248429 3300005937 Bacteria 1303
97 Ga0081540_1074262 3300005983 Bacteria 1559
98 Ga0075365_10016366 3300006038 Bacteria 4509
99 Ga0075365_10482918 3300006038 Bacteria 875
100 Ga0075364_10029754 3300006051 Bacteria 3503
101 Ga0075364_10171315 3300006051 Bacteria 1467
102 Ga0075364_10178197 3300006051 Bacteria 1438
103 Ga0075364_10379649 3300006051 Bacteria 964
104 Ga0070716_100716967 3300006173 Bacteria 766
105 Ga0075367_10555833 3300006178 Bacteria 729
106 Ga0075369_10018936 3300006186 Bacteria 2807
107 Ga0075369_10279277 3300006186 Bacteria 778
108 Ga0075428_100472681 3300006844 Bacteria 1342
109 Ga0075428_101264051 3300006844 Bacteria 777
110 Ga0075430_100000083 3300006846 Bacteria 53416
111 Ga0068865_100672390 3300006881 Bacteria 882
112 Ga0097620_100436865 3300006931 Bacteria 1405
113 Ga0105240_10002502 3300009093 Bacteria 29534
114 Ga0105240_10101753 3300009093 Bacteria 3494
115 Ga0105240_10380909 3300009093 Bacteria 1593
116 Ga0105240_11260263 3300009093 Bacteria 781
117 Ga0105240_12118188 3300009093 Bacteria 584
118 Ga0111539_10975533 3300009094 Bacteria 985
119 Ga0105245_10061558 3300009098 Bacteria 3384
120 Ga0105245_10332890 3300009098 Bacteria 1499
121 Ga0105245_10392366 3300009098 Bacteria 1385
122 Ga0105247_10044500 3300009101 Bacteria 2723
123 Ga0105243_10401042 3300009148 Bacteria 1274
124 Ga0105243_12386040 3300009148 Bacteria 567
125 Ga0105241_10000229 3300009174 Bacteria 42324
126 Ga0105241_10484221 3300009174 Bacteria 1100
127 Ga0105241_12700271 3300009174 Bacteria 500
128 Ga0105248_10000378 3300009177 Bacteria 51937
129 Ga0105248_10057739 3300009177 Bacteria 4356
130 Ga0105248_10382819 3300009177 Bacteria 1584
131 Ga0105248_10810489 3300009177 Bacteria 1057
132 Ga0105237_10000827 3300009545 Bacteria 42359
133 Ga0105237_10198991 3300009545 Bacteria 2003
134 Ga0105237_10378047 3300009545 Bacteria 1421
135 Ga0105238_10000640 3300009551 Bacteria 36820
136 Ga0105238_10174965 3300009551 Bacteria 2123
137 Ga0105238_10394566 3300009551 Bacteria 1376
138 Ga0105249_10296165 3300009553 Bacteria 1621
139 Ga0105249_13072247 3300009553 Bacteria 536
140 Ga0105239_10012757 3300010375 Bacteria 9350
141 Ga0105239_10103430 3300010375 Bacteria 3152
142 Ga0105239_10219194 3300010375 Bacteria 2133
143 Ga0105239_10500295 3300010375 Bacteria 1382
144 Ga0105246_10106892 3300011119 Bacteria 2048
145 Ga0105246_10265662 3300011119 Bacteria 1369
146 Ga0105246_10840038 3300011119 Bacteria 818
147 Ga0157373_10465727 3300013100 Bacteria 911
148 Ga0157371_10428965 3300013102 Bacteria 970
149 Ga0157371_11421119 3300013102 Bacteria 539
150 Ga0157370_10068402 3300013104 Bacteria 3356
151 Ga0157370_10576949 3300013104 Bacteria 1031
152 Ga0157370_10713921 3300013104 Bacteria 915
153 Ga0157369_10000408 3300013105 Bacteria 57117
154 Ga0157369_10065022 3300013105 Bacteria 3927
155 Ga0157369_10152488 3300013105 Bacteria 2442
156 Ga0157369_10267389 3300013105 Bacteria 1782
157 Ga0157369_10477777 3300013105 Bacteria 1290
158 Ga0157369_11618681 3300013105 Bacteria 658
159 Ga0157369_11864789 3300013105 Bacteria 610
160 Ga0157369_11968639 3300013105 Bacteria 593
161 Ga0157374_10233148 3300013296 Bacteria 1809
162 Ga0157374_10466819 3300013296 Bacteria 1264
163 Ga0157372_10049656 3300013307 Bacteria 4666
164 Ga0157372_10336082 3300013307 Bacteria 1759
165 Ga0157372_10858790 3300013307 Bacteria 1053
166 Ga0157372_11193839 3300013307 Bacteria 879
167 Ga0157372_11539106 3300013307 Bacteria 766
168 Ga0163163_10031733 3300014325 Bacteria 5100
169 Ga0163163_10713457 3300014325 Bacteria 1066
170 Ga0157380_10438840 3300014326 Bacteria 1250
171 Ga0157380_11656737 3300014326 Bacteria 696
172 Ga0157377_10133401 3300014745 Bacteria 1519
173 Ga0157377_10286190 3300014745 Bacteria 1082
174 Ga0157379_10195233 3300014968 Bacteria 1829
175 Ga0157379_12620490 3300014968 Bacteria 505
176 Ga0157376_11730593 3300014969 Bacteria 661
177 Ga0197907_10019833 3300020069 Bacteria 767
178 Ga0197907_10975784 3300020069 Bacteria 699
179 Ga0197907_11219171 3300020069 Bacteria 1771
180 Ga0206356_10157821 3300020070 Bacteria 622
181 Ga0206356_10678705 3300020070 Bacteria 1790
182 Ga0206356_11064826 3300020070 Bacteria 718
183 Ga0206349_1082612 3300020075 Bacteria 718
184 Ga0206349_1254796 3300020075 Bacteria 1049
185 Ga0206349_1626649 3300020075 Bacteria 732
186 Ga0206355_1244916 3300020076 Bacteria 690
187 Ga0206355_1550670 3300020076 Bacteria 868
188 Ga0206355_1602147 3300020076 Bacteria 1104
189 Ga0206355_1640832 3300020076 Bacteria 1647
190 Ga0206351_10251480 3300020077 Bacteria 1008
191 Ga0206351_10536693 3300020077 Bacteria 1432
192 Ga0206351_10666136 3300020077 Bacteria 1088
193 Ga0206351_10730481 3300020077 Bacteria 800
194 Ga0206352_11353865 3300020078 Bacteria 926
195 Ga0206350_10001921 3300020080 Bacteria 912
196 Ga0206350_10047304 3300020080 Bacteria 981
197 Ga0206350_10458492 3300020080 Bacteria 883
198 Ga0206350_10922864 3300020080 Bacteria 602
199 Ga0206350_11626977 3300020080 Bacteria 680
200 Ga0206354_10578162 3300020081 Bacteria 1217
201 Ga0206354_10887471 3300020081 Bacteria 1650
202 Ga0206354_11336432 3300020081 Bacteria 757
203 Ga0206354_11415175 3300020081 Bacteria 1428
204 Ga0206354_11451085 3300020081 Bacteria 1000
205 Ga0206353_10248489 3300020082 Bacteria 7023
206 Ga0206353_10528410 3300020082 Bacteria 658
207 Ga0206353_10548002 3300020082 Bacteria 1321
208 Ga0206353_10806493 3300020082 Bacteria 802
209 Ga0206353_11192585 3300020082 Bacteria 728
210 Ga0154015_1052983 3300020610 Bacteria 679
211 Ga0154015_1238244 3300020610 Bacteria 599
212 Ga0154015_1422135 3300020610 Bacteria 699
213 Ga0154015_1438710 3300020610 Bacteria 1055
214 Ga0224712_10008069 3300022467 Bacteria 3097
215 Ga0224712_10025989 3300022467 Bacteria 2064
216 Ga0224712_10121510 3300022467 Bacteria 1132
217 Ga0224712_10246088 3300022467 Bacteria 825
218 Ga0209566_100050 3300025225 Bacteria 234653
219 Ga0209674_100001 3300025226 Bacteria 4013750
220 Ga0209672_100006 3300025228 Bacteria 1004497
221 Ga0209147_100484 3300025229 Bacteria 23911
222 Ga0209563_100001 3300025230 Bacteria 4013775
223 Ga0209563_101336 3300025230 Bacteria 6712
224 Ga0207427_100052 3300025231 Bacteria 218228
225 Ga0209437_100484 3300025233 Bacteria 29919
226 Ga0209258_101993 3300025242 Bacteria 5916
227 Ga0209677_100001 3300025253 Bacteria 4013787
228 Ga0209677_104154 3300025253 Bacteria 4315
229 Ga0209677_127268 3300025253 Bacteria 603
230 Ga0209148_1000015 3300025254 Bacteria 850103
231 Ga0209148_1000498 3300025254 Bacteria 40127
232 Ga0209233_1000001 3300025261 Bacteria 2992747
233 Ga0209455_1000013 3300025272 Bacteria 850103
234 Ga0207656_10000012 3300025321 Bacteria 190545
235 Ga0207656_10435500 3300025321 Bacteria 662
236 Ga0207692_10038683 3300025898 Bacteria 2342
237 Ga0207692_10560435 3300025898 Bacteria 731
238 Ga0207680_10176826 3300025903 Bacteria 1441
239 Ga0207647_10013143 3300025904 Bacteria 5751
240 Ga0207643_10445278 3300025908 Bacteria 824
241 Ga0207705_10015580 3300025909 Bacteria 5457
242 Ga0207705_10099804 3300025909 Bacteria 2135
243 Ga0207705_11528967 3300025909 Bacteria 505
244 Ga0207654_10000003 3300025911 Bacteria 1030378
245 Ga0207707_10379371 3300025912 Bacteria 1215
246 Ga0207695_10002929 3300025913 Bacteria 24640
247 Ga0207695_10008719 3300025913 Bacteria 12643
248 Ga0207695_10081893 3300025913 Bacteria 3265
249 Ga0207695_10730407 3300025913 Bacteria 870
250 Ga0207671_10000002 3300025914 Bacteria 1144816
251 Ga0207671_10018860 3300025914 Bacteria 5286
252 Ga0207671_10055195 3300025914 Bacteria 2943
253 Ga0207662_10906963 3300025918 Bacteria 624
254 Ga0207657_10006607 3300025919 Bacteria 12003
255 Ga0207657_10561687 3300025919 Bacteria 892
256 Ga0207657_11196254 3300025919 Bacteria 578
257 Ga0207649_10105480 3300025920 Bacteria 1873
258 Ga0207694_10000061 3300025924 Bacteria 141236
259 Ga0207694_10477723 3300025924 Bacteria 1042
260 Ga0207694_10573636 3300025924 Bacteria 948
261 Ga0207687_10052415 3300025927 Bacteria 2847
262 Ga0207687_10070399 3300025927 Bacteria 2497
263 Ga0207687_10648905 3300025927 Bacteria 893
264 Ga0207664_11659367 3300025929 Bacteria 561
265 Ga0207690_10001116 3300025932 Bacteria 17117
266 Ga0207690_10174668 3300025932 Bacteria 1612
267 Ga0207709_11284031 3300025935 Bacteria 605
268 Ga0207711_10004464 3300025941 Bacteria 11926
269 Ga0207711_10014533 3300025941 Bacteria 6543
270 Ga0207661_11830810 3300025944 Bacteria 553
271 Ga0207667_10002706 3300025949 Bacteria 21925
272 Ga0207667_10027757 3300025949 Bacteria 6156
273 Ga0207667_10031039 3300025949 Bacteria 5772
274 Ga0207667_10044192 3300025949 Bacteria 4722
275 Ga0207667_10598596 3300025949 Bacteria 1112
276 Ga0207667_11171893 3300025949 Bacteria 749
277 Ga0207651_10798270 3300025960 Bacteria 837
278 Ga0207712_10114017 3300025961 Bacteria 2032
279 Ga0207668_10223673 3300025972 Bacteria 1513
280 Ga0207640_10137534 3300025981 Bacteria 1776
281 Ga0207658_10009408 3300025986 Bacteria 6627
282 Ga0207658_10565837 3300025986 Bacteria 1018
283 Ga0207658_11889439 3300025986 Bacteria 544
284 Ga0207677_10014508 3300026023 Bacteria 4603
285 Ga0207703_10000044 3300026035 Bacteria 158471
286 Ga0207639_10010758 3300026041 Bacteria 6340
287 Ga0207639_10359556 3300026041 Bacteria 1302
288 Ga0207678_10102695 3300026067 Bacteria 2441
289 Ga0207678_10134498 3300026067 Bacteria 2110
290 Ga0207678_11813514 3300026067 Bacteria 534
291 Ga0207708_10127684 3300026075 Bacteria 1986
292 Ga0207702_10062773 3300026078 Bacteria 3174
293 Ga0207702_10932620 3300026078 Bacteria 861
294 Ga0207641_10149094 3300026088 Bacteria 2117
295 Ga0207641_10910391 3300026088 Bacteria 874
296 Ga0207676_10062834 3300026095 Bacteria 2947
297 Ga0207674_10009570 3300026116 Bacteria 11056
298 Ga0207674_10050419 3300026116 Bacteria 4252
299 Ga0207674_10228083 3300026116 Bacteria 1811
300 Ga0207675_101345449 3300026118 Bacteria 735
301 Ga0207683_10318612 3300026121 Bacteria 1424
302 Ga0207683_10469986 3300026121 Bacteria 1160
303 Ga0207698_10046118 3300026142 Bacteria 3289
304 Ga0207698_10066505 3300026142 Bacteria 2837
305 Ga0207698_11364894 3300026142 Bacteria 724
306 Ga0268266_10225611 3300028379 Bacteria 1724
307 Ga0268265_11112911 3300028380 Bacteria 784
308 Ga0268264_11392135 3300028381 Bacteria 712
309 Ga0268264_12085455 3300028381 Bacteria 576
310 Ga0307515_10313369 3300028794 Bacteria 1242
311 Ga0307515_10673104 3300028794 Bacteria 649
312 Ga0307513_10140344 3300031456 Bacteria 2344
313 Ga0307509_10915896 3300031507 Bacteria 542
314 Ga0307514_10074891 3300031649 Bacteria 2526
315 Ga0307514_10149823 3300031649 Bacteria 1568
316 Ga0316575_10011462 3300031665 Bacteria 3283
317 Ga0316576_10644046 3300031727 Bacteria 771
318 Ga0307516_10870268 3300031730 Bacteria 566
319 Ga0307405_10684470 3300031731 Bacteria 847
320 Ga0316577_10132908 3300031733 Bacteria 1400
321 Ga0307413_10376157 3300031824 Bacteria 1105
322 Ga0307413_10915336 3300031824 Bacteria 746
323 Ga0307518_10138860 3300031838 Bacteria 1698
324 Ga0307406_10125273 3300031901 Bacteria 1794
325 Ga0307406_10275384 3300031901 Bacteria 1281
326 Ga0307406_10528137 3300031901 Bacteria 961
327 Ga0307407_10030499 3300031903 Bacteria 2910
328 Ga0307407_10303265 3300031903 Bacteria 1114
329 Ga0307407_11025176 3300031903 Bacteria 639
330 Ga0307412_11461869 3300031911 Bacteria 620
331 Ga0307412_11795364 3300031911 Bacteria 564
332 Ga0307409_100040532 3300031995 Bacteria 3469
333 Ga0307409_100067390 3300031995 Bacteria 2826
334 Ga0307409_100236002 3300031995 Bacteria 1661
335 Ga0307409_102407733 3300031995 Bacteria 555
336 Ga0307416_100050276 3300032002 Bacteria 3322
337 Ga0307416_100326387 3300032002 Bacteria 1540
338 Ga0307416_101305071 3300032002 Bacteria 832
339 Ga0307416_102342608 3300032002 Bacteria 634
340 Ga0307414_10256791 3300032004 Bacteria 1456
341 Ga0307414_10744893 3300032004 Bacteria 890
342 Ga0307414_10925297 3300032004 Bacteria 800
343 Ga0307414_11371023 3300032004 Bacteria 657
344 Ga0307414_11393834 3300032004 Bacteria 651
345 Ga0307411_10071179 3300032005 Bacteria 2356
346 Ga0307415_100029261 3300032126 Bacteria 3518
347 Ga0307415_100354708 3300032126 Bacteria 1236
348 Ga0307415_101070506 3300032126 Bacteria 753
349 Ga0307415_101530814 3300032126 Bacteria 639
350 Ga0316583_10001048 3300032133 Bacteria 8962
351 Ga0316585_10023485 3300032137 Bacteria 1902
352 Ga0316580_10003225 3300032139 Bacteria 4611
353 Ga0316593_10181968 3300032168 Bacteria 773
354 Ga0316592_1044521 3300033524 Bacteria 986
355 Ga0316588_1006170 3300033528 Bacteria 2381
356 Ga0316596_1094689 3300033541 Bacteria 806
357 Ga0316582_0022822 3300036647 Bacteria 3721
358 Ga0316584_0027297 3300036712 Bacteria 4201
359 Ga0395899_0034342 3300037312 Bacteria 3807
360 Ga0395899_0043221 3300037312 Bacteria 3362
361 Ga0395900_0049137 3300037418 Bacteria 4345
362 Ga0395900_0147514 3300037418 Bacteria 2405
363 Ga0395900_0173188 3300037418 Bacteria 2196
364 Ga0395898_0000131 3300037466 Bacteria 192369
365 Ga0395898_0560646 3300037466 Bacteria 1085
366 Ga0395898_1458237 3300037466 Bacteria 611
367 Ga0316581_0002723 3300037588 Bacteria 4280
368 Ga0439465_0025856 3300041413 Bacteria 1854
369 Ga0451791_0452991 3300041451 Bacteria 511
370 Ga0451795_0556107 3300041456 Bacteria 1061
371 Ga0451798_0573251 3300041458 Bacteria 530
372 Ga0451800_1352764 3300041459 Bacteria 2098
373 Ga0451802_0593341 3300041460 Bacteria 719
374 Ga0451804_0780753 3300041463 Bacteria 578
375 Ga0451837_0251532 3300041494 Bacteria 2706
376 Ga0451845_0245193 3300041501 Bacteria 515
377 Ga0451853_0197664 3300041512 Bacteria 5249
378 Ga0451853_2200920 3300041512 Bacteria 1506
379 Ga0451853_2367098 3300041512 Bacteria 1409
380 Ga0439462_0099956 3300042015 Bacteria 799
381 Ga0439446_0115582 3300042156 Bacteria 860
382 Ga0466969_0200363 3300044656 Bacteria 911
383 Ga0466972_0014888 3300044658 Bacteria 3891
384 Ga0466972_0039420 3300044658 Bacteria 2305
385 Ga0466972_0039560 3300044658 Bacteria 2301
386 Ga0466972_0063252 3300044658 Bacteria 1772
387 Ga0466965_0019072 3300044683 Bacteria 3293
388 Ga0466965_0104860 3300044683 Bacteria 1448
389 Ga0466965_0105509 3300044683 Bacteria 1444
390 Ga0466966_0077316 3300044684 Bacteria 2077
391 Ga0466966_0119160 3300044684 Bacteria 1622
392 Ga0466961_0052116 3300044693 Bacteria 2611
393 Ga0466961_0217502 3300044693 Bacteria 1178
394 Ga0466961_0240286 3300044693 Bacteria 1113
395 Ga0466961_0719864 3300044693 Bacteria 597
396 Ga0466963_0014491 3300044694 Bacteria 4862
397 Ga0466963_0526210 3300044694 Bacteria 835
398 Ga0466968_0031116 3300044735 Bacteria 2213
399 Ga0466968_0339193 3300044735 Bacteria 728
400 Ga0466970_0091685 3300044765 Bacteria 1649
401 Ga0466970_0127265 3300044765 Bacteria 1397
402 Ga0466957_0018378 3300044842 Bacteria 4105
403 Ga0466957_0124650 3300044842 Bacteria 1645
404 Ga0466960_0042262 3300044901 Bacteria 2163
405 Ga0466960_0072844 3300044901 Bacteria 1713
406 Ga0466959_0028197 3300045049 Bacteria 4163
407 Ga0466959_0130461 3300045049 Bacteria 1781
408 Ga0466958_0004878 3300045836 Bacteria 7139
409 Ga0466958_0359173 3300045836 Bacteria 938
410 Ga0466967_0795825 3300045976 Bacteria 939
411 Ga0495590_0000234 3300046457 Bacteria 30439
412 Ga0495638_0138760 3300046460 Bacteria 1421
413 Ga0495638_0320352 3300046460 Bacteria 829
414 Ga0495653_0532625 3300046463 Bacteria 729
415 Ga0495582_0293885 3300046473 Bacteria 934
416 Ga0495582_0415914 3300046473 Bacteria 776
417 Ga0495605_0198725 3300046474 Bacteria 875
418 Ga0495585_0122297 3300046492 Bacteria 1376
419 Ga0495583_0180050 3300046506 Bacteria 866
420 Ga0495606_0302718 3300046507 Bacteria 866
421 Ga0495665_0682147 3300046531 Bacteria 510
422 Ga0495656_0025623 3300046615 Bacteria 2340
423 Ga0495656_0300746 3300046615 Bacteria 822
424 Ga0495656_0660816 3300046615 Bacteria 561
425 Ga0495668_0436004 3300046616 Bacteria 721
426 Ga0495611_0134287 3300046648 Bacteria 1155
427 Ga0495625_0103708 3300046660 Bacteria 1950
428 Ga0495613_0196797 3300046689 Bacteria 1423
429 Ga0495624_0471798 3300046690 Bacteria 752
430 Ga0495670_0801654 3300046691 Bacteria 514
431 Ga0495672_0090509 3300047320 Bacteria 1681
432 Ga0495672_0111311 3300047320 Bacteria 1469
433 Ga0495672_0183665 3300047320 Bacteria 1057
434 Ga0495677_0296467 3300047445 Bacteria 636
435 Ga0495686_0042817 3300047472 Bacteria 2876
436 Ga0495686_0096346 3300047472 Bacteria 1791
437 Ga0496100_0032993 3300048903 Bacteria 3235
438 Ga0496101_0013283 3300048904 Bacteria 5515
439 Ga0496102_0072178 3300048905 Bacteria 3171
440 Ga0496102_0190030 3300048905 Bacteria 1935
441 Ga0496103_0278991 3300048906 Bacteria 1075
442 Ga0496104_0016970 3300048907 Bacteria 6623
443 Ga0496105_0935466 3300048908 Bacteria 651
444 Ga0496110_1039090 3300048913 Bacteria 727
445 Ga0496113_0244756 3300048916 Bacteria 1431
446 Ga0496114_0035980 3300048917 Bacteria 4091
447 Ga0496114_0105126 3300048917 Bacteria 2415
448 Ga0496114_1486980 3300048917 Bacteria 565
449 Ga0496115_0275569 3300048918 Bacteria 1381
450 Ga0496116_0401149 3300048919 Bacteria 607
451 Ga0496117_0042157 3300048920 Bacteria 3334
452 Ga0496117_0050250 3300048920 Bacteria 2957
453 Ga0496117_0056747 3300048920 Bacteria 2725
454 Ga0496117_0134606 3300048920 Bacteria 1491
455 Ga0496117_0343159 3300048920 Bacteria 774
456 Ga0496118_0039710 3300048921 Bacteria 3752
457 Ga0496118_0057994 3300048921 Bacteria 2898
458 Ga0496118_0160517 3300048921 Bacteria 1391
459 Ga0496118_0556141 3300048921 Bacteria 558
460 Ga0496119_0002971 3300048922 Bacteria 18017
461 Ga0496119_0019555 3300048922 Bacteria 4981
462 Ga0496119_0215688 3300048922 Bacteria 985
463 Ga0496119_0231039 3300048922 Bacteria 941
464 Ga0496120_0000566 3300048923 Bacteria 56431
465 Ga0496120_0008372 3300048923 Bacteria 7520
466 Ga0496120_0029814 3300048923 Bacteria 3326
467 Ga0496121_0000040 3300048924 Bacteria 348494
468 Ga0496122_0338757 3300048925 Bacteria 791
469 Ga0496125_0447168 3300048928 Bacteria 741
470 Ga0496125_0520262 3300048928 Bacteria 665
471 Ga0496126_0001388 3300048929 Bacteria 38310
472 Ga0496126_0041025 3300048929 Bacteria 4287
473 Ga0496126_0248272 3300048929 Bacteria 1484
474 Ga0496126_0297796 3300048929 Bacteria 1332
475 Ga0496126_0450242 3300048929 Bacteria 1036
476 Ga0501306_036075 3300049127 Bacteria 752
477 Ga0501291_088791 3300049514 Bacteria 628
478 Ga0501313_034313 3300049529 Bacteria 666
479 Ga0501315_023327 3300049531 Bacteria 849
480 Ga0501315_034313 3300049531 Bacteria 744
481 Ga0501317_014697 3300049533 Bacteria 995
482 Ga0501318_024852 3300049534 Bacteria 782
483 Ga0501319_008942 3300049535 Bacteria 778
484 Ga0501321_008326 3300049537 Bacteria 1098
485 Ga0501324_043742 3300049540 Bacteria 517
486 Ga0501031_0001110 3300049568 Bacteria 16424
487 Ga0501031_0633701 3300049568 Bacteria 687
488 Ga0501031_0812995 3300049568 Bacteria 599
489 Ga0501032_0056645 3300049569 Bacteria 2634
490 Ga0501032_0058850 3300049569 Bacteria 2579
491 Ga0501032_0159582 3300049569 Bacteria 1481
492 Ga0501032_0500469 3300049569 Bacteria 777
493 Ga0501033_0015073 3300049570 Bacteria 5865
494 Ga0501033_0018589 3300049570 Bacteria 5253
495 Ga0501033_0068616 3300049570 Bacteria 2606
496 Ga0501033_0140088 3300049570 Bacteria 1749
497 Ga0501033_0156054 3300049570 Bacteria 1645
498 Ga0501033_0342995 3300049570 Bacteria 1047
499 Ga0501034_0002208 3300049571 Bacteria 24087
500 Ga0501034_0003937 3300049571 Bacteria 16693
501 Ga0501034_0027070 3300049571 Bacteria 5834
502 Ga0501034_0058481 3300049571 Bacteria 3875
503 Ga0501034_0123069 3300049571 Bacteria 2580
504 Ga0501034_0154723 3300049571 Bacteria 2267
505 Ga0501034_0168992 3300049571 Bacteria 2155
506 Ga0501034_1016449 3300049571 Bacteria 712
507 Ga0501036_0031633 3300049572 Bacteria 4472
508 Ga0501036_0063373 3300049572 Bacteria 3130
509 Ga0501036_0218346 3300049572 Bacteria 1601
510 Ga0501036_0906738 3300049572 Bacteria 723
511 Ga0501037_0045659 3300049573 Bacteria 3215
512 Ga0501037_0090909 3300049573 Bacteria 2207
513 Ga0501037_0105616 3300049573 Bacteria 2030
514 Ga0501037_0177071 3300049573 Bacteria 1514
515 Ga0501037_0207875 3300049573 Bacteria 1381
516 Ga0501037_0593750 3300049573 Bacteria 744
517 Ga0501037_0753947 3300049573 Bacteria 645
518 Ga0501038_0007512 3300049574 Bacteria 10051
519 Ga0501038_0026233 3300049574 Bacteria 5190
520 Ga0501038_0081758 3300049574 Bacteria 2721
521 Ga0501038_0512283 3300049574 Bacteria 916
522 Ga0501038_0926284 3300049574 Bacteria 642
523 Ga0501039_0091379 3300049575 Bacteria 2372
524 Ga0501039_0353247 3300049575 Bacteria 1155
525 Ga0501039_1012549 3300049575 Bacteria 645
526 Ga0501042_0000599 3300049578 Bacteria 19202
527 Ga0501043_0015674 3300049579 Bacteria 5941
528 Ga0501043_0015950 3300049579 Bacteria 5889
529 Ga0501043_0071770 3300049579 Bacteria 2719
530 Ga0501043_0092856 3300049579 Bacteria 2372
531 Ga0501043_0429727 3300049579 Bacteria 995
532 Ga0501046_0004565 3300049580 Bacteria 12534
533 Ga0501046_0061621 3300049580 Bacteria 2932
534 Ga0501047_0000913 3300049581 Bacteria 30178
535 Ga0501047_0006876 3300049581 Bacteria 10689
536 Ga0501047_0087809 3300049581 Bacteria 2987
537 Ga0501047_0183774 3300049581 Bacteria 1956
538 Ga0501047_0192100 3300049581 Bacteria 1904
539 Ga0501047_1455011 3300049581 Bacteria 501
540 Ga0501048_0000085 3300049582 Bacteria 48910
541 Ga0501048_0021776 3300049582 Bacteria 4691
542 Ga0501048_0140023 3300049582 Bacteria 1711
543 Ga0501068_0202108 3300049584 Bacteria 1260
544 Ga0501069_0122610 3300049585 Bacteria 1485
545 Ga0501069_0740973 3300049585 Bacteria 594
546 Ga0501070_0000300 3300049586 Bacteria 45950
547 Ga0501070_0001151 3300049586 Bacteria 23680
548 Ga0501070_0014528 3300049586 Bacteria 6625
549 Ga0501070_0018888 3300049586 Bacteria 5782
550 Ga0501070_0042484 3300049586 Bacteria 3787
551 Ga0501070_0400656 3300049586 Bacteria 1110
552 Ga0501070_0926247 3300049586 Bacteria 679
553 Ga0501070_1182120 3300049586 Bacteria 587
554 Ga0501071_0169780 3300049587 Bacteria 1633
555 Ga0501072_0053846 3300049588 Bacteria 3169
556 Ga0501072_0616274 3300049588 Bacteria 855
557 Ga0501072_1166730 3300049588 Bacteria 599
558 Ga0501073_0017823 3300049589 Bacteria 5139
559 Ga0501073_0317939 3300049589 Bacteria 1074
560 Ga0501073_1092493 3300049589 Bacteria 548
561 Ga0501074_0451303 3300049590 Bacteria 912
562 Ga0501076_1124812 3300049592 Bacteria 647
563 Ga0501077_0318534 3300049593 Bacteria 991
564 Ga0501079_0155109 3300049741 Bacteria 1785
565 Ga0501079_1184589 3300049741 Bacteria 602
566 Ga0501079_1678238 3300049741 Bacteria 500
567 Ga0501080_0001097 3300049742 Bacteria 22311
568 Ga0501080_1458836 3300049742 Bacteria 582
569 Ga0501080_1580061 3300049742 Bacteria 556
570 Ga0501083_0000169 3300049744 Bacteria 42763
571 Ga0501083_0137941 3300049744 Bacteria 1597
572 Ga0501083_0300163 3300049744 Bacteria 1045
573 Ga0501035_0003098 3300049822 Bacteria 15973
574 Ga0501035_0043257 3300049822 Bacteria 4059
575 Ga0501035_0049940 3300049822 Bacteria 3750
576 Ga0501035_0053188 3300049822 Bacteria 3622
577 Ga0501035_0097313 3300049822 Bacteria 2585
578 Ga0501035_0378790 3300049822 Bacteria 1180
579 Ga0501035_0672100 3300049822 Bacteria 838
580 Ga0501044_0015446 3300049823 Bacteria 8223
581 Ga0501044_0080615 3300049823 Bacteria 3296
582 Ga0501044_0159925 3300049823 Bacteria 2230
583 Ga0501044_0191412 3300049823 Bacteria 2008
584 Ga0501044_0484334 3300049823 Bacteria 1140
585 Ga0501044_0588065 3300049823 Bacteria 1007
586 Ga0501044_0650714 3300049823 Bacteria 943
587 Ga0501044_0709584 3300049823 Bacteria 891
588 nmdc:mga00v17_205419_c1 3300050491 Bacteria 1274
589 nmdc:mga00v17_275465_c1 3300050491 Bacteria 1092
590 nmdc:mga00v17_706485_c1 3300050491 Bacteria 646
591 nmdc:mga0yw44_20302_c1 3300050492 Bacteria 3685
592 nmdc:mga0yw44_266780_c1 3300050492 Bacteria 1142
593 nmdc:mga0yw44_399880_c1 3300050492 Bacteria 929
594 nmdc:mga0sz30_372977_c1 3300050516 Bacteria 638
595 Ga0500635_0086342 3300053080 Bacteria 1135
596 Ga0500651_0000314 3300053093 Bacteria 27815
597 Ga0500628_045217 3300053129 Bacteria 1022
598 Ga0500559_0059249 3300053136 Bacteria 1704
599 Ga0500568_0001140 3300053139 Bacteria 17832
600 Ga0500568_0029067 3300053139 Bacteria 2297
601 Ga0500573_0004598 3300053140 Bacteria 7295
602 Ga0500573_0011384 3300053140 Bacteria 4976
603 Ga0500573_0025081 3300053140 Bacteria 3429
604 Ga0500573_0038663 3300053140 Bacteria 2757
605 Ga0500573_0081013 3300053140 Bacteria 1844
606 Ga0500573_0119532 3300053140 Bacteria 1468
607 Ga0500573_0149718 3300053140 Bacteria 1279
608 Ga0500573_0154723 3300053140 Bacteria 1252
609 Ga0500573_0364106 3300053140 Bacteria 697
610 Ga0500588_0056614 3300053146 Bacteria 1241
611 Ga0500590_010865 3300053148 Bacteria 4605
612 Ga0500616_0000021 3300053153 Bacteria 484527
613 Ga0500616_0000125 3300053153 Bacteria 135146
614 Ga0500620_000008 3300053155 Bacteria 52879
615 Ga0501084_0404162 3300054114 Bacteria 1154
616 Ga0501084_1346762 3300054114 Bacteria 598
617 Ga0501082_1079501 3300060353 Bacteria 702
618 Ga0466962_0263313 3300061719 Bacteria 849
619 Ga0530510_0351641 3300061734 Bacteria 1107
620 2587862837 2585428094 Bacteria 3604039
621 2644096114 2643221616 Bacteria 4066575
622 2644183534 2643221632 Bacteria 3406696
623 2644199302 2643221635 Bacteria 2632343
624 2808902006 2808606372 Bacteria 4649509
625 2816426200 2816332119 Bacteria 8120218
626 2844842527 2844841374 Bacteria 3917147
627 2857737383 2857737099 Bacteria 3104305
628 2862996283 2862993130 Bacteria 3860849
629 2884765480 2884763398 Bacteria 4091164
630 2906800355 2906799679 Bacteria 4031749
631 2919058212 2919055335 Bacteria 3875751
632 2919524586 2919523602 Bacteria 3788128
633 2928156491 2928153084 Bacteria 4020257
634 2935411378 2935409751 Bacteria 4179611
635 2966922764 2966921586 Bacteria 3092803
636 8002812588 8002811521 Bacteria 2942897
637 8004214091 8004212874 Bacteria 2861420
638 8046356440 8046352972 Bacteria 3613806
639 8055035901 8055034563 Bacteria 3562128
640 8055038545 8055037949 Bacteria 3337834
641 Ga0070670_100293167
642 LJQas_1000241
643 JGI24740J21852_10005425
644 JGI24740J21852_10113229
645 JGI24739J22299_10009525
646 JGI24739J22299_10076629
647 JGI24739J22299_10136435
648 JGI24737J22298_10059960
649 JGI24737J22298_10078447
650 JGI24743J22301_10045189
651 JGI24735J21928_10008300
652 JGI24735J21928_10014629
653 JGI24735J21928_10107581
654 JGI24738J21930_10025363
655 JGI25165J46597_1000330
656 rootH2_10194546
657 Ga0006562J51391_1008545
658 Ga0055539_1000008
659 Ga0055539_1010915
660 Ga0055533_1000001
661 Ga0055525_1001411
662 Ga0055527_1000001
663 Ga0055529_1000018
664 Ga0055541_1002500
665 Ga0070658_10008837
666 Ga0070658_11456931
667 Ga0070658_11750988
668 Ga0070683_100776619
669 Ga0070683_101415641
670 Ga0070683_101834750
671 Ga0070682_100283399
672 Ga0070682_100380695
673 Ga0070682_100750033
674 Ga0068868_100110213
675 Ga0070660_100055570
676 Ga0070660_101201619
677 Ga0070661_101168610
678 Ga0070668_100233975
679 Ga0070668_100301075
680 Ga0070668_100755766
681 Ga0070675_101518205
682 Ga0070671_100115519
683 Ga0070674_100019182
684 Ga0070673_100454089
685 Ga0070659_100003361
686 Ga0070659_100125550
687 Ga0070659_101805678
688 Ga0070667_100004757
689 Ga0070667_100134106
690 Ga0070714_100000006
691 Ga0070714_100506569
692 Ga0070710_10018243
693 Ga0070710_10351216
694 Ga0070663_100125242
695 Ga0070663_100890786
696 Ga0070663_101524096
697 Ga0070678_100294454
698 Ga0070678_100687339
699 Ga0070681_10349522
700 Ga0068867_100549643
701 Ga0070685_10170848
702 Ga0070699_100111607
703 Ga0070699_102137096
704 Ga0068853_100010241
705 Ga0068853_100435882
706 Ga0070672_100024298
707 Ga0068855_100001400
708 Ga0068855_100084922
709 Ga0068855_100212438
710 Ga0068855_100974484
711 Ga0068855_101208835
712 Ga0068857_100002185
713 Ga0068857_100159913
714 Ga0068854_100254413
715 Ga0068856_100099272
716 Ga0068856_100100951
717 Ga0068856_100118210
718 Ga0068856_100393759
719 Ga0068852_100010191
720 Ga0068852_100018357
721 Ga0068852_100067521
722 Ga0068852_101510659
723 Ga0068859_100436798
724 Ga0068864_100099110
725 Ga0068864_101497253
726 Ga0068864_102617348
727 Ga0068861_100679048
728 Ga0068851_10000061
729 Ga0068851_10296377
730 Ga0068870_10542235
731 Ga0068863_100175105
732 Ga0068863_101662338
733 Ga0068858_100000153
734 Ga0068860_100872465
735 Ga0068860_102465382
736 Ga0081455_10248429
737 Ga0081540_1074262
738 Ga0075365_10016366
739 Ga0075365_10482918
740 Ga0075364_10029754
741 Ga0075364_10171315
742 Ga0075364_10178197
743 Ga0075364_10379649
744 Ga0070716_100716967
745 Ga0075367_10555833
746 Ga0075369_10018936
747 Ga0075369_10279277
748 Ga0075428_100472681
749 Ga0075428_101264051
750 Ga0075430_100000083
751 Ga0068865_100672390
752 Ga0097620_100436865
753 Ga0105240_10002502
754 Ga0105240_10101753
755 Ga0105240_10380909
756 Ga0105240_11260263
757 Ga0105240_12118188
758 Ga0111539_10975533
759 Ga0105245_10061558
760 Ga0105245_10332890
761 Ga0105245_10392366
762 Ga0105247_10044500
763 Ga0105243_10401042
764 Ga0105243_12386040
765 Ga0105241_10000229
766 Ga0105241_10484221
767 Ga0105241_12700271
768 Ga0105248_10000378
769 Ga0105248_10057739
770 Ga0105248_10382819
771 Ga0105248_10810489
772 Ga0105237_10000827
773 Ga0105237_10198991
774 Ga0105237_10378047
775 Ga0105238_10000640
776 Ga0105238_10174965
777 Ga0105238_10394566
778 Ga0105249_10296165
779 Ga0105249_13072247
780 Ga0105239_10012757
781 Ga0105239_10103430
782 Ga0105239_10219194
783 Ga0105239_10500295
784 Ga0105246_10106892
785 Ga0105246_10265662
786 Ga0105246_10840038
787 Ga0157373_10465727
788 Ga0157371_10428965
789 Ga0157371_11421119
790 Ga0157370_10068402
791 Ga0157370_10576949
792 Ga0157370_10713921
793 Ga0157369_10000408
794 Ga0157369_10065022
795 Ga0157369_10152488
796 Ga0157369_10267389
797 Ga0157369_10477777
798 Ga0157369_11618681
799 Ga0157369_11864789
800 Ga0157369_11968639
801 Ga0157374_10233148
802 Ga0157374_10466819
803 Ga0157372_10049656
804 Ga0157372_10336082
805 Ga0157372_10858790
806 Ga0157372_11193839
807 Ga0157372_11539106
808 Ga0163163_10031733
809 Ga0163163_10713457
810 Ga0157380_10438840
811 Ga0157380_11656737
812 Ga0157377_10133401
813 Ga0157377_10286190
814 Ga0157379_10195233
815 Ga0157379_12620490
816 Ga0157376_11730593
817 Ga0197907_10019833
818 Ga0197907_10975784
819 Ga0197907_11219171
820 Ga0206356_10157821
821 Ga0206356_10678705
822 Ga0206356_11064826
823 Ga0206349_1082612
824 Ga0206349_1254796
825 Ga0206349_1626649
826 Ga0206355_1244916
827 Ga0206355_1550670
828 Ga0206355_1602147
829 Ga0206355_1640832
830 Ga0206351_10251480
831 Ga0206351_10536693
832 Ga0206351_10666136
833 Ga0206351_10730481
834 Ga0206352_11353865
835 Ga0206350_10001921
836 Ga0206350_10047304
837 Ga0206350_10458492
838 Ga0206350_10922864
839 Ga0206350_11626977
840 Ga0206354_10578162
841 Ga0206354_10887471
842 Ga0206354_11336432
843 Ga0206354_11415175
844 Ga0206354_11451085
845 Ga0206353_10248489
846 Ga0206353_10528410
847 Ga0206353_10548002
848 Ga0206353_10806493
849 Ga0206353_11192585
850 Ga0154015_1052983
851 Ga0154015_1238244
852 Ga0154015_1422135
853 Ga0154015_1438710
854 Ga0224712_10008069
855 Ga0224712_10025989
856 Ga0224712_10121510
857 Ga0224712_10246088
858 Ga0209566_100050
859 Ga0209674_100001
860 Ga0209672_100006
861 Ga0209147_100484
862 Ga0209563_100001
863 Ga0209563_101336
864 Ga0207427_100052
865 Ga0209437_100484
866 Ga0209258_101993
867 Ga0209677_100001
868 Ga0209677_104154
869 Ga0209677_127268
870 Ga0209148_1000015
871 Ga0209148_1000498
872 Ga0209233_1000001
873 Ga0209455_1000013
874 Ga0207656_10000012
875 Ga0207656_10435500
876 Ga0207692_10038683
877 Ga0207692_10560435
878 Ga0207680_10176826
879 Ga0207647_10013143
880 Ga0207643_10445278
881 Ga0207705_10015580
882 Ga0207705_10099804
883 Ga0207705_11528967
884 Ga0207654_10000003
885 Ga0207707_10379371
886 Ga0207695_10002929
887 Ga0207695_10008719
888 Ga0207695_10081893
889 Ga0207695_10730407
890 Ga0207671_10000002
891 Ga0207671_10018860
892 Ga0207671_10055195
893 Ga0207662_10906963
894 Ga0207657_10006607
895 Ga0207657_10561687
896 Ga0207657_11196254
897 Ga0207649_10105480
898 Ga0207694_10000061
899 Ga0207694_10477723
900 Ga0207694_10573636
901 Ga0207687_10052415
902 Ga0207687_10070399
903 Ga0207687_10648905
904 Ga0207664_11659367
905 Ga0207690_10001116
906 Ga0207690_10174668
907 Ga0207709_11284031
908 Ga0207711_10004464
909 Ga0207711_10014533
910 Ga0207661_11830810
911 Ga0207667_10002706
912 Ga0207667_10027757
913 Ga0207667_10031039
914 Ga0207667_10044192
915 Ga0207667_10598596
916 Ga0207667_11171893
917 Ga0207651_10798270
918 Ga0207712_10114017
919 Ga0207668_10223673
920 Ga0207640_10137534
921 Ga0207658_10009408
922 Ga0207658_10565837
923 Ga0207658_11889439
924 Ga0207677_10014508
925 Ga0207703_10000044
926 Ga0207639_10010758
927 Ga0207639_10359556
928 Ga0207678_10102695
929 Ga0207678_10134498
930 Ga0207678_11813514
931 Ga0207708_10127684
932 Ga0207702_10062773
933 Ga0207702_10932620
934 Ga0207641_10149094
935 Ga0207641_10910391
936 Ga0207676_10062834
937 Ga0207674_10009570
938 Ga0207674_10050419
939 Ga0207674_10228083
940 Ga0207675_101345449
941 Ga0207683_10318612
942 Ga0207683_10469986
943 Ga0207698_10046118
944 Ga0207698_10066505
945 Ga0207698_11364894
946 Ga0268266_10225611
947 Ga0268265_11112911
948 Ga0268264_11392135
949 Ga0268264_12085455
950 Ga0307515_10313369
951 Ga0307515_10673104
952 Ga0307513_10140344
953 Ga0307509_10915896
954 Ga0307514_10074891
955 Ga0307514_10149823
956 Ga0316575_10011462
957 Ga0316576_10644046
958 Ga0307516_10870268
959 Ga0307405_10684470
960 Ga0316577_10132908
961 Ga0307413_10376157
962 Ga0307413_10915336
963 Ga0307518_10138860
964 Ga0307406_10125273
965 Ga0307406_10275384
966 Ga0307406_10528137
967 Ga0307407_10030499
968 Ga0307407_10303265
969 Ga0307407_11025176
970 Ga0307412_11461869
971 Ga0307412_11795364
972 Ga0307409_100040532
973 Ga0307409_100067390
974 Ga0307409_100236002
975 Ga0307409_102407733
976 Ga0307416_100050276
977 Ga0307416_100326387
978 Ga0307416_101305071
979 Ga0307416_102342608
980 Ga0307414_10256791
981 Ga0307414_10744893
982 Ga0307414_10925297
983 Ga0307414_11371023
984 Ga0307414_11393834
985 Ga0307411_10071179
986 Ga0307415_100029261
987 Ga0307415_100354708
988 Ga0307415_101070506
989 Ga0307415_101530814
990 Ga0316583_10001048
991 Ga0316585_10023485
992 Ga0316580_10003225
993 Ga0316593_10181968
994 Ga0316592_1044521
995 Ga0316588_1006170
996 Ga0316596_1094689
997 Ga0316582_0022822
998 Ga0316584_0027297
999 Ga0395899_0034342
1000 Ga0395899_0043221
1001 Ga0395900_0049137
1002 Ga0395900_0147514
1003 Ga0395900_0173188
1004 Ga0395898_0000131
1005 Ga0395898_0560646
1006 Ga0395898_1458237
1007 Ga0316581_0002723
1008 Ga0439465_0025856
1009 Ga0451791_0452991
1010 Ga0451795_0556107
1011 Ga0451798_0573251
1012 Ga0451800_1352764
1013 Ga0451802_0593341
1014 Ga0451804_0780753
1015 Ga0451837_0251532
1016 Ga0451845_0245193
1017 Ga0451853_0197664
1018 Ga0451853_2200920
1019 Ga0451853_2367098
1020 Ga0439462_0099956
1021 Ga0439446_0115582
1022 Ga0466969_0200363
1023 Ga0466972_0014888
1024 Ga0466972_0039420
1025 Ga0466972_0039560
1026 Ga0466972_0063252
1027 Ga0466965_0019072
1028 Ga0466965_0104860
1029 Ga0466965_0105509
1030 Ga0466966_0077316
1031 Ga0466966_0119160
1032 Ga0466961_0052116
1033 Ga0466961_0217502
1034 Ga0466961_0240286
1035 Ga0466961_0719864
1036 Ga0466963_0014491
1037 Ga0466963_0526210
1038 Ga0466968_0031116
1039 Ga0466968_0339193
1040 Ga0466970_0091685
1041 Ga0466970_0127265
1042 Ga0466957_0018378
1043 Ga0466957_0124650
1044 Ga0466960_0042262
1045 Ga0466960_0072844
1046 Ga0466959_0028197
1047 Ga0466959_0130461
1048 Ga0466958_0004878
1049 Ga0466958_0359173
1050 Ga0466967_0795825
1051 Ga0495590_0000234
1052 Ga0495638_0138760
1053 Ga0495638_0320352
1054 Ga0495653_0532625
1055 Ga0495582_0293885
1056 Ga0495582_0415914
1057 Ga0495605_0198725
1058 Ga0495585_0122297
1059 Ga0495583_0180050
1060 Ga0495606_0302718
1061 Ga0495665_0682147
1062 Ga0495656_0025623
1063 Ga0495656_0300746
1064 Ga0495656_0660816
1065 Ga0495668_0436004
1066 Ga0495611_0134287
1067 Ga0495625_0103708
1068 Ga0495613_0196797
1069 Ga0495624_0471798
1070 Ga0495670_0801654
1071 Ga0495672_0090509
1072 Ga0495672_0111311
1073 Ga0495672_0183665
1074 Ga0495677_0296467
1075 Ga0495686_0042817
1076 Ga0495686_0096346
1077 Ga0496100_0032993
1078 Ga0496101_0013283
1079 Ga0496102_0072178
1080 Ga0496102_0190030
1081 Ga0496103_0278991
1082 Ga0496104_0016970
1083 Ga0496105_0935466
1084 Ga0496110_1039090
1085 Ga0496113_0244756
1086 Ga0496114_0035980
1087 Ga0496114_0105126
1088 Ga0496114_1486980
1089 Ga0496115_0275569
1090 Ga0496116_0401149
1091 Ga0496117_0042157
1092 Ga0496117_0050250
1093 Ga0496117_0056747
1094 Ga0496117_0134606
1095 Ga0496117_0343159
1096 Ga0496118_0039710
1097 Ga0496118_0057994
1098 Ga0496118_0160517
1099 Ga0496118_0556141
1100 Ga0496119_0002971
1101 Ga0496119_0019555
1102 Ga0496119_0215688
1103 Ga0496119_0231039
1104 Ga0496120_0000566
1105 Ga0496120_0008372
1106 Ga0496120_0029814
1107 Ga0496121_0000040
1108 Ga0496122_0338757
1109 Ga0496125_0447168
1110 Ga0496125_0520262
1111 Ga0496126_0001388
1112 Ga0496126_0041025
1113 Ga0496126_0248272
1114 Ga0496126_0297796
1115 Ga0496126_0450242
1116 Ga0501306_036075
1117 Ga0501291_088791
1118 Ga0501313_034313
1119 Ga0501315_023327
1120 Ga0501315_034313
1121 Ga0501317_014697
1122 Ga0501318_024852
1123 Ga0501319_008942
1124 Ga0501321_008326
1125 Ga0501324_043742
1126 Ga0501031_0001110
1127 Ga0501031_0633701
1128 Ga0501031_0812995
1129 Ga0501032_0056645
1130 Ga0501032_0058850
1131 Ga0501032_0159582
1132 Ga0501032_0500469
1133 Ga0501033_0015073
1134 Ga0501033_0018589
1135 Ga0501033_0068616
1136 Ga0501033_0140088
1137 Ga0501033_0156054
1138 Ga0501033_0342995
1139 Ga0501034_0002208
1140 Ga0501034_0003937
1141 Ga0501034_0027070
1142 Ga0501034_0058481
1143 Ga0501034_0123069
1144 Ga0501034_0154723
1145 Ga0501034_0168992
1146 Ga0501034_1016449
1147 Ga0501036_0031633
1148 Ga0501036_0063373
1149 Ga0501036_0218346
1150 Ga0501036_0906738
1151 Ga0501037_0045659
1152 Ga0501037_0090909
1153 Ga0501037_0105616
1154 Ga0501037_0177071
1155 Ga0501037_0207875
1156 Ga0501037_0593750
1157 Ga0501037_0753947
1158 Ga0501038_0007512
1159 Ga0501038_0026233
1160 Ga0501038_0081758
1161 Ga0501038_0512283
1162 Ga0501038_0926284
1163 Ga0501039_0091379
1164 Ga0501039_0353247
1165 Ga0501039_1012549
1166 Ga0501042_0000599
1167 Ga0501043_0015674
1168 Ga0501043_0015950
1169 Ga0501043_0071770
1170 Ga0501043_0092856
1171 Ga0501043_0429727
1172 Ga0501046_0004565
1173 Ga0501046_0061621
1174 Ga0501047_0000913
1175 Ga0501047_0006876
1176 Ga0501047_0087809
1177 Ga0501047_0183774
1178 Ga0501047_0192100
1179 Ga0501047_1455011
1180 Ga0501048_0000085
1181 Ga0501048_0021776
1182 Ga0501048_0140023
1183 Ga0501068_0202108
1184 Ga0501069_0122610
1185 Ga0501069_0740973
1186 Ga0501070_0000300
1187 Ga0501070_0001151
1188 Ga0501070_0014528
1189 Ga0501070_0018888
1190 Ga0501070_0042484
1191 Ga0501070_0400656
1192 Ga0501070_0926247
1193 Ga0501070_1182120
1194 Ga0501071_0169780
1195 Ga0501072_0053846
1196 Ga0501072_0616274
1197 Ga0501072_1166730
1198 Ga0501073_0017823
1199 Ga0501073_0317939
1200 Ga0501073_1092493
1201 Ga0501074_0451303
1202 Ga0501076_1124812
1203 Ga0501077_0318534
1204 Ga0501079_0155109
1205 Ga0501079_1184589
1206 Ga0501079_1678238
1207 Ga0501080_0001097
1208 Ga0501080_1458836
1209 Ga0501080_1580061
1210 Ga0501083_0000169
1211 Ga0501083_0137941
1212 Ga0501083_0300163
1213 Ga0501035_0003098
1214 Ga0501035_0043257
1215 Ga0501035_0049940
1216 Ga0501035_0053188
1217 Ga0501035_0097313
1218 Ga0501035_0378790
1219 Ga0501035_0672100
1220 Ga0501044_0015446
1221 Ga0501044_0080615
1222 Ga0501044_0159925
1223 Ga0501044_0191412
1224 Ga0501044_0484334
1225 Ga0501044_0588065
1226 Ga0501044_0650714
1227 Ga0501044_0709584
1228 nmdc:mga00v17_205419_c1
1229 nmdc:mga00v17_275465_c1
1230 nmdc:mga00v17_706485_c1
1231 nmdc:mga0yw44_20302_c1
1232 nmdc:mga0yw44_266780_c1
1233 nmdc:mga0yw44_399880_c1
1234 nmdc:mga0sz30_372977_c1
1235 Ga0500635_0086342
1236 Ga0500651_0000314
1237 Ga0500628_045217
1238 Ga0500559_0059249
1239 Ga0500568_0001140
1240 Ga0500568_0029067
1241 Ga0500573_0004598
1242 Ga0500573_0011384
1243 Ga0500573_0025081
1244 Ga0500573_0038663
1245 Ga0500573_0081013
1246 Ga0500573_0119532
1247 Ga0500573_0149718
1248 Ga0500573_0154723
1249 Ga0500573_0364106
1250 Ga0500588_0056614
1251 Ga0500590_010865
1252 Ga0500616_0000021
1253 Ga0500616_0000125
1254 Ga0500620_000008
1255 Ga0501084_0404162
1256 Ga0501084_1346762
1257 Ga0501082_1079501
1258 Ga0466962_0263313
1259 Ga0530510_0351641
1260 2587862837
1261 2644096114
1262 2644183534
1263 2644199302
1264 2808902006
1265 2816426200
1266 2844842527
1267 2857737383
1268 2862996283
1269 2884765480
1270 2906800355
1271 2919058212
1272 2919524586
1273 2928156491
1274 2935411378
1275 2966922764
1276 8002812588
1277 8004214091
1278 8046356440
1279 8055035901
1280 8055038545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13397

RbpA

RNA polymerase-binding protein

6

112

0.97

Map