F471605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 639 | 282 | 638 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10001029|Ga0114129_1000102924 |
| Length | 111 |
| Sequence | MCVDKNRTTISKLQAMEELIPINVLIGDRTYRIRISPTDEEVVRKTLKLINDKIIEFKTTFAGKDMQDYVAMVVLWYATQQKAGDSQPLVDNETGEQIQAIEKLLDRMLLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 180 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 181 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 186 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 187 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 188 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 191 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 192 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 246 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 247 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 252 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 258 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 260 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 261 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 262 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 263 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 265 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 266 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 267 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 269 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 270 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 271 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 272 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 273 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 275 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 276 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 277 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 279 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.16 |
| Isolates | 0.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.42 |
| Nodule | 0 |
| Rhizoplane | 1.56 |
| Rhizosphere | 87.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F7QKVOU01D7WOY | 2088090003 | Unclassified | 501 |
| 2 | rootH1_10070623 | 3300003316 | Bacteria | 2081 |
| 3 | rootH1_10103792 | 3300003316 | Bacteria | 1492 |
| 4 | rootH2_10002129 | 3300003320 | Bacteria | 15324 |
| 5 | rootH2_10014840 | 3300003320 | Bacteria | 5335 |
| 6 | rootH2_10020813 | 3300003320 | Bacteria | 17478 |
| 7 | rootH2_10052864 | 3300003320 | Bacteria | 1505 |
| 8 | rootH2_10111024 | 3300003320 | Bacteria | 7865 |
| 9 | rootL2_10378854 | 3300003322 | Bacteria | 1390 |
| 10 | rootH1_10015941 | 3300003323 | Bacteria | 21181 |
| 11 | rootH1_10068884 | 3300003323 | Bacteria | 2117 |
| 12 | rootH1_10068885 | 3300003323 | Bacteria | 1528 |
| 13 | rootH1_10332917 | 3300003323 | Bacteria | 1531 |
| 14 | JGI25404J52841_10081937 | 3300003659 | Bacteria | 674 |
| 15 | Ga0065714_10287823 | 3300005288 | Bacteria | 713 |
| 16 | Ga0065712_10103457 | 3300005290 | Bacteria | 1984 |
| 17 | Ga0065712_10196191 | 3300005290 | Bacteria | 1127 |
| 18 | Ga0065712_10553212 | 3300005290 | Unclassified | 616 |
| 19 | Ga0070658_10011212 | 3300005327 | Bacteria | 7183 |
| 20 | Ga0070658_10751327 | 3300005327 | Bacteria | 847 |
| 21 | Ga0070676_10000238 | 3300005328 | Bacteria | 23718 |
| 22 | Ga0070676_10036554 | 3300005328 | Bacteria | 2830 |
| 23 | Ga0070676_10389533 | 3300005328 | Unclassified | 967 |
| 24 | Ga0070676_10729744 | 3300005328 | Bacteria | 726 |
| 25 | Ga0070683_101874058 | 3300005329 | Unclassified | 576 |
| 26 | Ga0070690_100236633 | 3300005330 | Bacteria | 1286 |
| 27 | Ga0070670_100154741 | 3300005331 | Bacteria | 1985 |
| 28 | Ga0070670_100445216 | 3300005331 | Unclassified | 1147 |
| 29 | Ga0070670_100778397 | 3300005331 | Unclassified | 863 |
| 30 | Ga0070670_100798344 | 3300005331 | Bacteria | 852 |
| 31 | Ga0070670_100846495 | 3300005331 | Unclassified | 827 |
| 32 | Ga0068869_100021181 | 3300005334 | Unclassified | 4469 |
| 33 | Ga0068869_100110204 | 3300005334 | Bacteria | 2093 |
| 34 | Ga0070666_10001496 | 3300005335 | Bacteria | 14201 |
| 35 | Ga0070666_10020916 | 3300005335 | Bacteria | 4236 |
| 36 | Ga0070666_10248842 | 3300005335 | Bacteria | 1258 |
| 37 | Ga0070680_100308915 | 3300005336 | Bacteria | 1341 |
| 38 | Ga0070682_100000393 | 3300005337 | Bacteria | 29135 |
| 39 | Ga0070682_100334817 | 3300005337 | Bacteria | 1123 |
| 40 | Ga0068868_100001065 | 3300005338 | Bacteria | 18795 |
| 41 | Ga0068868_100089776 | 3300005338 | Bacteria | 2474 |
| 42 | Ga0068868_100459852 | 3300005338 | Bacteria | 1108 |
| 43 | Ga0070660_100617455 | 3300005339 | Bacteria | 907 |
| 44 | Ga0070689_100714994 | 3300005340 | Bacteria | 875 |
| 45 | Ga0070691_10670626 | 3300005341 | Bacteria | 619 |
| 46 | Ga0070661_101204583 | 3300005344 | Bacteria | 633 |
| 47 | Ga0070668_100003447 | 3300005347 | Bacteria | 11678 |
| 48 | Ga0070668_102121622 | 3300005347 | Unclassified | 519 |
| 49 | Ga0070669_100043329 | 3300005353 | Bacteria | 3277 |
| 50 | Ga0070669_101140873 | 3300005353 | Unclassified | 672 |
| 51 | Ga0070675_100024172 | 3300005354 | Unclassified | 4866 |
| 52 | Ga0070675_100251913 | 3300005354 | Unclassified | 1546 |
| 53 | Ga0070671_100091589 | 3300005355 | Bacteria | 2547 |
| 54 | Ga0070671_100243705 | 3300005355 | Bacteria | 1526 |
| 55 | Ga0070674_100595813 | 3300005356 | Unclassified | 933 |
| 56 | Ga0070674_100768031 | 3300005356 | Bacteria | 830 |
| 57 | Ga0070673_100001402 | 3300005364 | Bacteria | 14099 |
| 58 | Ga0070673_100834923 | 3300005364 | Unclassified | 852 |
| 59 | Ga0070673_101715803 | 3300005364 | Bacteria | 594 |
| 60 | Ga0070688_100266026 | 3300005365 | Unclassified | 1226 |
| 61 | Ga0070688_100470671 | 3300005365 | Bacteria | 943 |
| 62 | Ga0070659_100755167 | 3300005366 | Unclassified | 844 |
| 63 | Ga0070667_100001589 | 3300005367 | Bacteria | 20342 |
| 64 | Ga0070667_100012426 | 3300005367 | Bacteria | 7046 |
| 65 | Ga0070667_100331808 | 3300005367 | Bacteria | 1374 |
| 66 | Ga0070667_101562627 | 3300005367 | Unclassified | 620 |
| 67 | Ga0070710_10558960 | 3300005437 | Bacteria | 791 |
| 68 | Ga0070711_101780656 | 3300005439 | Bacteria | 540 |
| 69 | Ga0070663_100263880 | 3300005455 | Bacteria | 1367 |
| 70 | Ga0070678_100074786 | 3300005456 | Bacteria | 2547 |
| 71 | Ga0070678_100277927 | 3300005456 | Bacteria | 1415 |
| 72 | Ga0070678_100292701 | 3300005456 | Bacteria | 1381 |
| 73 | Ga0070662_101150742 | 3300005457 | Bacteria | 666 |
| 74 | Ga0070662_101448592 | 3300005457 | Unclassified | 592 |
| 75 | Ga0070681_10039915 | 3300005458 | Bacteria | 4706 |
| 76 | Ga0070681_10734170 | 3300005458 | Bacteria | 904 |
| 77 | Ga0070681_11075410 | 3300005458 | Bacteria | 725 |
| 78 | Ga0068867_100003608 | 3300005459 | Bacteria | 10887 |
| 79 | Ga0068867_100077618 | 3300005459 | Bacteria | 2496 |
| 80 | Ga0068867_100081775 | 3300005459 | Bacteria | 2436 |
| 81 | Ga0068867_100104556 | 3300005459 | Bacteria | 2167 |
| 82 | Ga0068867_100120537 | 3300005459 | Bacteria | 2027 |
| 83 | Ga0068867_100249900 | 3300005459 | Bacteria | 1442 |
| 84 | Ga0068867_102310520 | 3300005459 | Bacteria | 511 |
| 85 | Ga0070685_10180536 | 3300005466 | Bacteria | 1358 |
| 86 | Ga0070679_100110609 | 3300005530 | Bacteria | 2734 |
| 87 | Ga0070684_101338620 | 3300005535 | Bacteria | 674 |
| 88 | Ga0070697_101980970 | 3300005536 | Bacteria | 521 |
| 89 | Ga0068853_100001266 | 3300005539 | Bacteria | 18098 |
| 90 | Ga0068853_100001323 | 3300005539 | Bacteria | 17818 |
| 91 | Ga0068853_100080995 | 3300005539 | Bacteria | 2842 |
| 92 | Ga0068853_100125341 | 3300005539 | Bacteria | 2294 |
| 93 | Ga0068853_100200406 | 3300005539 | Bacteria | 1816 |
| 94 | Ga0068853_101474469 | 3300005539 | Bacteria | 659 |
| 95 | Ga0070672_100008059 | 3300005543 | Bacteria | 7198 |
| 96 | Ga0070672_100048947 | 3300005543 | Bacteria | 3287 |
| 97 | Ga0070672_100332958 | 3300005543 | Bacteria | 1292 |
| 98 | Ga0070672_100357007 | 3300005543 | Unclassified | 1247 |
| 99 | Ga0070672_100659244 | 3300005543 | Bacteria | 914 |
| 100 | Ga0070672_100689907 | 3300005543 | Bacteria | 894 |
| 101 | Ga0070672_101201388 | 3300005543 | Unclassified | 676 |
| 102 | Ga0070686_100554436 | 3300005544 | Bacteria | 899 |
| 103 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 104 | Ga0070665_100551063 | 3300005548 | Bacteria | 1165 |
| 105 | Ga0070665_101258307 | 3300005548 | Unclassified | 750 |
| 106 | Ga0070665_101833898 | 3300005548 | Unclassified | 613 |
| 107 | Ga0070704_101693036 | 3300005549 | Bacteria | 584 |
| 108 | Ga0068855_100006123 | 3300005563 | Bacteria | 14673 |
| 109 | Ga0068855_100007114 | 3300005563 | Bacteria | 13574 |
| 110 | Ga0068855_100039314 | 3300005563 | Bacteria | 5616 |
| 111 | Ga0068855_100042044 | 3300005563 | Bacteria | 5416 |
| 112 | Ga0070664_101029227 | 3300005564 | Bacteria | 774 |
| 113 | Ga0068857_100000308 | 3300005577 | Bacteria | 33921 |
| 114 | Ga0068857_100239428 | 3300005577 | Bacteria | 1661 |
| 115 | Ga0068854_100217084 | 3300005578 | Bacteria | 1511 |
| 116 | Ga0068854_100251591 | 3300005578 | Bacteria | 1411 |
| 117 | Ga0068854_101223445 | 3300005578 | Bacteria | 674 |
| 118 | Ga0068854_101231842 | 3300005578 | Bacteria | 671 |
| 119 | Ga0068856_100004623 | 3300005614 | Bacteria | 13669 |
| 120 | Ga0068856_100029852 | 3300005614 | Bacteria | 5328 |
| 121 | Ga0068856_100194324 | 3300005614 | Bacteria | 2043 |
| 122 | Ga0068856_101719051 | 3300005614 | Bacteria | 640 |
| 123 | Ga0070702_101578300 | 3300005615 | Bacteria | 542 |
| 124 | Ga0068852_100000902 | 3300005616 | Bacteria | 19654 |
| 125 | Ga0068852_100075858 | 3300005616 | Bacteria | 2967 |
| 126 | Ga0068852_100539884 | 3300005616 | Bacteria | 1165 |
| 127 | Ga0068852_100999417 | 3300005616 | Bacteria | 855 |
| 128 | Ga0068852_101192781 | 3300005616 | Bacteria | 782 |
| 129 | Ga0068852_101956384 | 3300005616 | Bacteria | 608 |
| 130 | Ga0068852_102041184 | 3300005616 | Bacteria | 595 |
| 131 | Ga0068852_102202948 | 3300005616 | Bacteria | 573 |
| 132 | Ga0068859_100236208 | 3300005617 | Bacteria | 1917 |
| 133 | Ga0068859_100959009 | 3300005617 | Bacteria | 938 |
| 134 | Ga0068859_100974498 | 3300005617 | Unclassified | 931 |
| 135 | Ga0068859_102666392 | 3300005617 | Unclassified | 549 |
| 136 | Ga0068864_100001339 | 3300005618 | Bacteria | 20471 |
| 137 | Ga0068864_100147461 | 3300005618 | Bacteria | 2128 |
| 138 | Ga0068864_100215546 | 3300005618 | Bacteria | 1770 |
| 139 | Ga0068866_10017666 | 3300005718 | Unclassified | 3212 |
| 140 | Ga0068866_10312573 | 3300005718 | Bacteria | 985 |
| 141 | Ga0068861_100147948 | 3300005719 | Bacteria | 1924 |
| 142 | Ga0068861_101167616 | 3300005719 | Unclassified | 743 |
| 143 | Ga0068861_101366400 | 3300005719 | Bacteria | 691 |
| 144 | Ga0068861_101592253 | 3300005719 | Bacteria | 643 |
| 145 | Ga0068861_102471417 | 3300005719 | Unclassified | 523 |
| 146 | Ga0068851_10000433 | 3300005834 | Bacteria | 18684 |
| 147 | Ga0068851_10032370 | 3300005834 | Bacteria | 2602 |
| 148 | Ga0068851_10679138 | 3300005834 | Bacteria | 632 |
| 149 | Ga0068870_10355160 | 3300005840 | Bacteria | 942 |
| 150 | Ga0068870_10991859 | 3300005840 | Unclassified | 598 |
| 151 | Ga0068863_100015219 | 3300005841 | Bacteria | 7392 |
| 152 | Ga0068863_100542225 | 3300005841 | Bacteria | 1148 |
| 153 | Ga0068863_101006800 | 3300005841 | Bacteria | 836 |
| 154 | Ga0068858_100018401 | 3300005842 | Bacteria | 6540 |
| 155 | Ga0068858_100147646 | 3300005842 | Bacteria | 2209 |
| 156 | Ga0068860_100001323 | 3300005843 | Bacteria | 26880 |
| 157 | Ga0068860_100004955 | 3300005843 | Bacteria | 13573 |
| 158 | Ga0068860_100017463 | 3300005843 | Bacteria | 6991 |
| 159 | Ga0068860_100030211 | 3300005843 | Bacteria | 5211 |
| 160 | Ga0068860_100331406 | 3300005843 | Bacteria | 1495 |
| 161 | Ga0068860_101076962 | 3300005843 | Unclassified | 823 |
| 162 | Ga0068862_100498016 | 3300005844 | Bacteria | 1156 |
| 163 | Ga0081540_1005596 | 3300005983 | Bacteria | 9353 |
| 164 | Ga0070715_10119309 | 3300006163 | Bacteria | 1255 |
| 165 | Ga0075366_10129343 | 3300006195 | Bacteria | 1523 |
| 166 | Ga0075366_10301876 | 3300006195 | Bacteria | 979 |
| 167 | Ga0075366_10694277 | 3300006195 | Unclassified | 632 |
| 168 | Ga0075366_10761823 | 3300006195 | Bacteria | 602 |
| 169 | Ga0097621_100000427 | 3300006237 | Bacteria | 29385 |
| 170 | Ga0097621_100022689 | 3300006237 | Bacteria | 4875 |
| 171 | Ga0097621_100417224 | 3300006237 | Bacteria | 1204 |
| 172 | Ga0097621_100796894 | 3300006237 | Bacteria | 875 |
| 173 | Ga0097621_101888816 | 3300006237 | Bacteria | 570 |
| 174 | Ga0075370_10806042 | 3300006353 | Bacteria | 573 |
| 175 | Ga0068871_100000582 | 3300006358 | Bacteria | 25067 |
| 176 | Ga0068871_100005204 | 3300006358 | Bacteria | 9094 |
| 177 | Ga0068871_100021743 | 3300006358 | Bacteria | 4936 |
| 178 | Ga0068871_100335766 | 3300006358 | Bacteria | 1334 |
| 179 | Ga0068871_100348038 | 3300006358 | Bacteria | 1310 |
| 180 | Ga0068871_100477813 | 3300006358 | Bacteria | 1120 |
| 181 | Ga0075428_100103007 | 3300006844 | Bacteria | 3113 |
| 182 | Ga0075431_100004624 | 3300006847 | Bacteria | 13512 |
| 183 | Ga0075429_100069117 | 3300006880 | Bacteria | 3075 |
| 184 | Ga0068865_100169037 | 3300006881 | Bacteria | 1674 |
| 185 | Ga0097620_100236194 | 3300006931 | Bacteria | 1917 |
| 186 | Ga0097620_100959264 | 3300006931 | Bacteria | 938 |
| 187 | Ga0097620_100974348 | 3300006931 | Unclassified | 931 |
| 188 | Ga0097620_102666296 | 3300006931 | Unclassified | 549 |
| 189 | Ga0105240_10010363 | 3300009093 | Bacteria | 13114 |
| 190 | Ga0105240_10014456 | 3300009093 | Bacteria | 10778 |
| 191 | Ga0105240_10026640 | 3300009093 | Bacteria | 7586 |
| 192 | Ga0105240_10040454 | 3300009093 | Bacteria | 5961 |
| 193 | Ga0105240_10057728 | 3300009093 | Bacteria | 4847 |
| 194 | Ga0105240_10113772 | 3300009093 | Bacteria | 3270 |
| 195 | Ga0105240_10163495 | 3300009093 | Bacteria | 2642 |
| 196 | Ga0105240_10503751 | 3300009093 | Bacteria | 1346 |
| 197 | Ga0105240_10506520 | 3300009093 | Bacteria | 1342 |
| 198 | Ga0111539_10181440 | 3300009094 | Bacteria | 2458 |
| 199 | Ga0111539_12679931 | 3300009094 | Bacteria | 578 |
| 200 | Ga0105245_10738772 | 3300009098 | Bacteria | 1019 |
| 201 | Ga0105247_10128752 | 3300009101 | Bacteria | 1648 |
| 202 | Ga0114129_10001029 | 3300009147 | Bacteria | 36430 |
| 203 | Ga0114129_10035352 | 3300009147 | Bacteria | 7058 |
| 204 | Ga0105243_10792888 | 3300009148 | Bacteria | 933 |
| 205 | Ga0105241_10015527 | 3300009174 | Bacteria | 5582 |
| 206 | Ga0105241_10241279 | 3300009174 | Bacteria | 1528 |
| 207 | Ga0105241_10651034 | 3300009174 | Bacteria | 957 |
| 208 | Ga0105241_10796304 | 3300009174 | Bacteria | 870 |
| 209 | Ga0105241_11234135 | 3300009174 | Bacteria | 709 |
| 210 | Ga0105241_12575849 | 3300009174 | Unclassified | 510 |
| 211 | Ga0105242_10078923 | 3300009176 | Bacteria | 2748 |
| 212 | Ga0105242_10236935 | 3300009176 | Bacteria | 1638 |
| 213 | Ga0105242_10485928 | 3300009176 | Bacteria | 1171 |
| 214 | Ga0105242_10692482 | 3300009176 | Bacteria | 996 |
| 215 | Ga0105242_11378478 | 3300009176 | Unclassified | 732 |
| 216 | Ga0105248_10105707 | 3300009177 | Bacteria | 3174 |
| 217 | Ga0105248_10215588 | 3300009177 | Bacteria | 2162 |
| 218 | Ga0105237_10002084 | 3300009545 | Bacteria | 25287 |
| 219 | Ga0105237_10022388 | 3300009545 | Bacteria | 6484 |
| 220 | Ga0105237_10054325 | 3300009545 | Bacteria | 4013 |
| 221 | Ga0105237_10111962 | 3300009545 | Bacteria | 2721 |
| 222 | Ga0105237_12636225 | 3300009545 | Unclassified | 513 |
| 223 | Ga0105238_10028860 | 3300009551 | Bacteria | 5651 |
| 224 | Ga0105238_10286040 | 3300009551 | Bacteria | 1631 |
| 225 | Ga0105238_12817882 | 3300009551 | Unclassified | 522 |
| 226 | Ga0105249_10000349 | 3300009553 | Bacteria | 46353 |
| 227 | Ga0105249_10036337 | 3300009553 | Unclassified | 4468 |
| 228 | Ga0105249_10156150 | 3300009553 | Bacteria | 2201 |
| 229 | Ga0105249_10853770 | 3300009553 | Bacteria | 976 |
| 230 | Ga0105239_10024227 | 3300010375 | Bacteria | 6684 |
| 231 | Ga0105239_10045483 | 3300010375 | Bacteria | 4811 |
| 232 | Ga0105239_10101610 | 3300010375 | Bacteria | 3181 |
| 233 | Ga0105239_10115101 | 3300010375 | Bacteria | 2983 |
| 234 | Ga0105239_10289194 | 3300010375 | Bacteria | 1846 |
| 235 | Ga0105239_10560562 | 3300010375 | Bacteria | 1301 |
| 236 | Ga0105239_10568430 | 3300010375 | Bacteria | 1292 |
| 237 | Ga0105239_13644838 | 3300010375 | Bacteria | 500 |
| 238 | Ga0105246_10718055 | 3300011119 | Unclassified | 878 |
| 239 | Ga0105246_10887371 | 3300011119 | Bacteria | 798 |
| 240 | Ga0157373_10083773 | 3300013100 | Bacteria | 2248 |
| 241 | Ga0157373_10161279 | 3300013100 | Bacteria | 1578 |
| 242 | Ga0157373_11013944 | 3300013100 | Bacteria | 620 |
| 243 | Ga0157371_10277757 | 3300013102 | Bacteria | 1210 |
| 244 | Ga0157370_10024115 | 3300013104 | Bacteria | 6030 |
| 245 | Ga0157370_10112289 | 3300013104 | Bacteria | 2547 |
| 246 | Ga0157370_10557954 | 3300013104 | Bacteria | 1050 |
| 247 | Ga0157370_11543916 | 3300013104 | Bacteria | 597 |
| 248 | Ga0157370_11684750 | 3300013104 | Bacteria | 569 |
| 249 | Ga0157369_10414082 | 3300013105 | Bacteria | 1397 |
| 250 | Ga0157369_10430931 | 3300013105 | Bacteria | 1367 |
| 251 | Ga0157369_10899353 | 3300013105 | Bacteria | 908 |
| 252 | Ga0157369_11161193 | 3300013105 | Bacteria | 788 |
| 253 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 254 | Ga0157374_10016290 | 3300013296 | Bacteria | 6531 |
| 255 | Ga0157374_10251304 | 3300013296 | Bacteria | 1740 |
| 256 | Ga0157374_10279670 | 3300013296 | Bacteria | 1647 |
| 257 | Ga0157374_10580127 | 3300013296 | Bacteria | 1130 |
| 258 | Ga0157374_10972355 | 3300013296 | Bacteria | 868 |
| 259 | Ga0157374_11996546 | 3300013296 | Unclassified | 606 |
| 260 | Ga0157374_12687502 | 3300013296 | Bacteria | 525 |
| 261 | Ga0157378_10015576 | 3300013297 | Bacteria | 6659 |
| 262 | Ga0157378_10116932 | 3300013297 | Bacteria | 2453 |
| 263 | Ga0157378_10176468 | 3300013297 | Bacteria | 2007 |
| 264 | Ga0157378_11479715 | 3300013297 | Unclassified | 723 |
| 265 | Ga0157378_12098183 | 3300013297 | Unclassified | 616 |
| 266 | Ga0163162_10001002 | 3300013306 | Bacteria | 26238 |
| 267 | Ga0163162_10002343 | 3300013306 | Bacteria | 17790 |
| 268 | Ga0163162_10033628 | 3300013306 | Bacteria | 5096 |
| 269 | Ga0163162_10073821 | 3300013306 | Bacteria | 3468 |
| 270 | Ga0163162_11197459 | 3300013306 | Bacteria | 862 |
| 271 | Ga0163162_11694895 | 3300013306 | Bacteria | 722 |
| 272 | Ga0163162_11752364 | 3300013306 | Bacteria | 710 |
| 273 | Ga0157372_10000080 | 3300013307 | Bacteria | 100216 |
| 274 | Ga0157372_10046053 | 3300013307 | Bacteria | 4840 |
| 275 | Ga0157372_10276210 | 3300013307 | Bacteria | 1953 |
| 276 | Ga0157372_10710690 | 3300013307 | Bacteria | 1169 |
| 277 | Ga0157372_10854654 | 3300013307 | Bacteria | 1056 |
| 278 | Ga0157372_10996772 | 3300013307 | Unclassified | 970 |
| 279 | Ga0157372_11496628 | 3300013307 | Bacteria | 778 |
| 280 | Ga0157372_12397438 | 3300013307 | Bacteria | 606 |
| 281 | Ga0157372_13146468 | 3300013307 | Bacteria | 527 |
| 282 | Ga0157375_10000186 | 3300013308 | Bacteria | 58217 |
| 283 | Ga0157375_10000827 | 3300013308 | Bacteria | 27101 |
| 284 | Ga0157375_10310507 | 3300013308 | Bacteria | 1741 |
| 285 | Ga0163163_10071141 | 3300014325 | Unclassified | 3465 |
| 286 | Ga0163163_10544484 | 3300014325 | Archaea | 1223 |
| 287 | Ga0157380_10249246 | 3300014326 | Bacteria | 1606 |
| 288 | Ga0157380_10497350 | 3300014326 | Bacteria | 1183 |
| 289 | Ga0157380_12983045 | 3300014326 | Bacteria | 539 |
| 290 | Ga0157377_10141335 | 3300014745 | Bacteria | 1480 |
| 291 | Ga0157379_10006059 | 3300014968 | Bacteria | 10413 |
| 292 | Ga0157379_10014679 | 3300014968 | Bacteria | 6871 |
| 293 | Ga0157379_10938378 | 3300014968 | Bacteria | 822 |
| 294 | Ga0157379_11332084 | 3300014968 | Bacteria | 694 |
| 295 | Ga0157376_10000101 | 3300014969 | Bacteria | 62612 |
| 296 | Ga0157376_10000106 | 3300014969 | Bacteria | 60118 |
| 297 | Ga0157376_10000650 | 3300014969 | Bacteria | 22495 |
| 298 | Ga0157376_10635325 | 3300014969 | Bacteria | 1066 |
| 299 | Ga0182006_1193940 | 3300015261 | Bacteria | 674 |
| 300 | Ga0163161_10016541 | 3300017792 | Bacteria | 5150 |
| 301 | Ga0163161_10209651 | 3300017792 | Bacteria | 1505 |
| 302 | Ga0206352_11229666 | 3300020078 | Bacteria | 1229 |
| 303 | Ga0213876_10007925 | 3300021384 | Bacteria | 5764 |
| 304 | Ga0213876_10090628 | 3300021384 | Unclassified | 1619 |
| 305 | Ga0209258_116824 | 3300025242 | Bacteria | 811 |
| 306 | Ga0209646_1004961 | 3300025246 | Bacteria | 2372 |
| 307 | Ga0207656_10090117 | 3300025321 | Bacteria | 1391 |
| 308 | Ga0207656_10111589 | 3300025321 | Bacteria | 1264 |
| 309 | Ga0207642_10010211 | 3300025899 | Unclassified | 3298 |
| 310 | Ga0207642_10243405 | 3300025899 | Bacteria | 1017 |
| 311 | Ga0207680_10001074 | 3300025903 | Bacteria | 12895 |
| 312 | Ga0207680_10069908 | 3300025903 | Bacteria | 2171 |
| 313 | Ga0207647_10008966 | 3300025904 | Bacteria | 7126 |
| 314 | Ga0207647_10424916 | 3300025904 | Bacteria | 747 |
| 315 | Ga0207645_10003472 | 3300025907 | Bacteria | 11943 |
| 316 | Ga0207643_10145614 | 3300025908 | Bacteria | 1417 |
| 317 | Ga0207705_10014017 | 3300025909 | Bacteria | 5777 |
| 318 | Ga0207705_10298815 | 3300025909 | Bacteria | 1235 |
| 319 | Ga0207654_10051471 | 3300025911 | Bacteria | 2370 |
| 320 | Ga0207654_10149979 | 3300025911 | Bacteria | 1495 |
| 321 | Ga0207707_10073935 | 3300025912 | Bacteria | 2972 |
| 322 | Ga0207707_10451160 | 3300025912 | Bacteria | 1100 |
| 323 | Ga0207707_11612588 | 3300025912 | Bacteria | 511 |
| 324 | Ga0207695_10000146 | 3300025913 | Bacteria | 209416 |
| 325 | Ga0207695_10000248 | 3300025913 | Bacteria | 140288 |
| 326 | Ga0207695_10003218 | 3300025913 | Bacteria | 23245 |
| 327 | Ga0207695_10015113 | 3300025913 | Bacteria | 9108 |
| 328 | Ga0207695_10018745 | 3300025913 | Bacteria | 7989 |
| 329 | Ga0207695_10052136 | 3300025913 | Bacteria | 4288 |
| 330 | Ga0207695_10061832 | 3300025913 | Bacteria | 3868 |
| 331 | Ga0207695_10139963 | 3300025913 | Bacteria | 2369 |
| 332 | Ga0207695_10154091 | 3300025913 | Bacteria | 2234 |
| 333 | Ga0207695_10730028 | 3300025913 | Bacteria | 871 |
| 334 | Ga0207671_10001661 | 3300025914 | Bacteria | 25296 |
| 335 | Ga0207671_10020429 | 3300025914 | Bacteria | 5040 |
| 336 | Ga0207671_10150150 | 3300025914 | Bacteria | 1800 |
| 337 | Ga0207671_11517087 | 3300025914 | Unclassified | 517 |
| 338 | Ga0207663_11420920 | 3300025916 | Unclassified | 559 |
| 339 | Ga0207660_10242324 | 3300025917 | Bacteria | 1421 |
| 340 | Ga0207649_10434596 | 3300025920 | Bacteria | 988 |
| 341 | Ga0207649_11015709 | 3300025920 | Bacteria | 653 |
| 342 | Ga0207652_10122515 | 3300025921 | Bacteria | 2314 |
| 343 | Ga0207681_10276840 | 3300025923 | Bacteria | 1320 |
| 344 | Ga0207681_11127383 | 3300025923 | Bacteria | 659 |
| 345 | Ga0207694_10284236 | 3300025924 | Bacteria | 1359 |
| 346 | Ga0207694_10596242 | 3300025924 | Bacteria | 929 |
| 347 | Ga0207650_10127474 | 3300025925 | Bacteria | 1988 |
| 348 | Ga0207650_10153052 | 3300025925 | Bacteria | 1822 |
| 349 | Ga0207650_10652750 | 3300025925 | Unclassified | 887 |
| 350 | Ga0207650_11598069 | 3300025925 | Bacteria | 553 |
| 351 | Ga0207659_10105800 | 3300025926 | Bacteria | 2129 |
| 352 | Ga0207659_10186722 | 3300025926 | Bacteria | 1647 |
| 353 | Ga0207659_10452958 | 3300025926 | Bacteria | 1081 |
| 354 | Ga0207687_10518968 | 3300025927 | Bacteria | 996 |
| 355 | Ga0207644_10077904 | 3300025931 | Bacteria | 2442 |
| 356 | Ga0207644_10124235 | 3300025931 | Bacteria | 1968 |
| 357 | Ga0207644_10310126 | 3300025931 | Bacteria | 1274 |
| 358 | Ga0207686_10052274 | 3300025934 | Bacteria | 2549 |
| 359 | Ga0207686_10263922 | 3300025934 | Bacteria | 1264 |
| 360 | Ga0207669_10401549 | 3300025937 | Bacteria | 1074 |
| 361 | Ga0207704_10006582 | 3300025938 | Bacteria | 5433 |
| 362 | Ga0207704_10466975 | 3300025938 | Bacteria | 1010 |
| 363 | Ga0207691_10000076 | 3300025940 | Bacteria | 83005 |
| 364 | Ga0207691_10033525 | 3300025940 | Bacteria | 4780 |
| 365 | Ga0207691_10165875 | 3300025940 | Bacteria | 1936 |
| 366 | Ga0207691_10717495 | 3300025940 | Bacteria | 843 |
| 367 | Ga0207691_11037087 | 3300025940 | Bacteria | 684 |
| 368 | Ga0207711_10134535 | 3300025941 | Bacteria | 2219 |
| 369 | Ga0207689_10058218 | 3300025942 | Bacteria | 3178 |
| 370 | Ga0207689_10119101 | 3300025942 | Bacteria | 2172 |
| 371 | Ga0207689_10392348 | 3300025942 | Bacteria | 1156 |
| 372 | Ga0207689_10512509 | 3300025942 | Bacteria | 1005 |
| 373 | Ga0207661_10009210 | 3300025944 | Bacteria | 7075 |
| 374 | Ga0207679_12096722 | 3300025945 | Bacteria | 514 |
| 375 | Ga0207667_10000270 | 3300025949 | Bacteria | 71998 |
| 376 | Ga0207667_10000445 | 3300025949 | Bacteria | 55443 |
| 377 | Ga0207667_10019461 | 3300025949 | Bacteria | 7578 |
| 378 | Ga0207667_10032466 | 3300025949 | Bacteria | 5626 |
| 379 | Ga0207667_10090406 | 3300025949 | Bacteria | 3164 |
| 380 | Ga0207651_10055807 | 3300025960 | Bacteria | 2715 |
| 381 | Ga0207651_10958492 | 3300025960 | Unclassified | 763 |
| 382 | Ga0207712_10004215 | 3300025961 | Bacteria | 9073 |
| 383 | Ga0207712_10020658 | 3300025961 | Unclassified | 4316 |
| 384 | Ga0207712_10095109 | 3300025961 | Bacteria | 2202 |
| 385 | Ga0207712_11444223 | 3300025961 | Bacteria | 616 |
| 386 | Ga0207668_10005078 | 3300025972 | Bacteria | 7745 |
| 387 | Ga0207668_10182274 | 3300025972 | Bacteria | 1658 |
| 388 | Ga0207668_11720440 | 3300025972 | Unclassified | 566 |
| 389 | Ga0207640_10006821 | 3300025981 | Bacteria | 6281 |
| 390 | Ga0207640_10227275 | 3300025981 | Bacteria | 1433 |
| 391 | Ga0207640_10294711 | 3300025981 | Bacteria | 1280 |
| 392 | Ga0207640_10613544 | 3300025981 | Bacteria | 922 |
| 393 | Ga0207640_11334486 | 3300025981 | Bacteria | 641 |
| 394 | Ga0207640_11402382 | 3300025981 | Unclassified | 626 |
| 395 | Ga0207658_10004289 | 3300025986 | Bacteria | 9936 |
| 396 | Ga0207658_10022044 | 3300025986 | Bacteria | 4430 |
| 397 | Ga0207658_10380405 | 3300025986 | Bacteria | 1236 |
| 398 | Ga0207658_10866683 | 3300025986 | Bacteria | 821 |
| 399 | Ga0207677_10054044 | 3300026023 | Bacteria | 2738 |
| 400 | Ga0207703_10216645 | 3300026035 | Bacteria | 1710 |
| 401 | Ga0207703_10466559 | 3300026035 | Bacteria | 1181 |
| 402 | Ga0207639_10012165 | 3300026041 | Bacteria | 5987 |
| 403 | Ga0207639_10031875 | 3300026041 | Bacteria | 3876 |
| 404 | Ga0207639_10053121 | 3300026041 | Bacteria | 3090 |
| 405 | Ga0207639_10157504 | 3300026041 | Bacteria | 1910 |
| 406 | Ga0207639_11031768 | 3300026041 | Bacteria | 770 |
| 407 | Ga0207639_12306295 | 3300026041 | Bacteria | 500 |
| 408 | Ga0207678_10329049 | 3300026067 | Bacteria | 1315 |
| 409 | Ga0207678_11177985 | 3300026067 | Unclassified | 678 |
| 410 | Ga0207702_10162137 | 3300026078 | Bacteria | 2043 |
| 411 | Ga0207702_10197512 | 3300026078 | Bacteria | 1863 |
| 412 | Ga0207702_11432715 | 3300026078 | Bacteria | 684 |
| 413 | Ga0207641_10025588 | 3300026088 | Unclassified | 4867 |
| 414 | Ga0207641_10030766 | 3300026088 | Bacteria | 4447 |
| 415 | Ga0207641_10373000 | 3300026088 | Bacteria | 1365 |
| 416 | Ga0207641_10395709 | 3300026088 | Bacteria | 1326 |
| 417 | Ga0207641_10904047 | 3300026088 | Bacteria | 877 |
| 418 | Ga0207641_12146484 | 3300026088 | Bacteria | 559 |
| 419 | Ga0207648_10010617 | 3300026089 | Bacteria | 8706 |
| 420 | Ga0207648_10023153 | 3300026089 | Bacteria | 5571 |
| 421 | Ga0207648_10023926 | 3300026089 | Bacteria | 5460 |
| 422 | Ga0207648_10052560 | 3300026089 | Bacteria | 3563 |
| 423 | Ga0207648_10122941 | 3300026089 | Bacteria | 2282 |
| 424 | Ga0207648_10178766 | 3300026089 | Archaea | 1877 |
| 425 | Ga0207648_10365359 | 3300026089 | Unclassified | 1303 |
| 426 | Ga0207648_10399288 | 3300026089 | Bacteria | 1245 |
| 427 | Ga0207676_10042450 | 3300026095 | Bacteria | 3498 |
| 428 | Ga0207676_10259123 | 3300026095 | Unclassified | 1569 |
| 429 | Ga0207676_11463483 | 3300026095 | Bacteria | 680 |
| 430 | Ga0207676_11523448 | 3300026095 | Bacteria | 666 |
| 431 | Ga0207674_10001573 | 3300026116 | Bacteria | 29387 |
| 432 | Ga0207674_10069258 | 3300026116 | Bacteria | 3549 |
| 433 | Ga0207674_10752839 | 3300026116 | Bacteria | 940 |
| 434 | Ga0207675_100191873 | 3300026118 | Bacteria | 1960 |
| 435 | Ga0207675_100256249 | 3300026118 | Bacteria | 1695 |
| 436 | Ga0207675_100514416 | 3300026118 | Bacteria | 1193 |
| 437 | Ga0207675_101333339 | 3300026118 | Bacteria | 738 |
| 438 | Ga0207675_102330024 | 3300026118 | Unclassified | 549 |
| 439 | Ga0207683_10243011 | 3300026121 | Bacteria | 1642 |
| 440 | Ga0207683_10337941 | 3300026121 | Bacteria | 1381 |
| 441 | Ga0207698_10000987 | 3300026142 | Bacteria | 16491 |
| 442 | Ga0207698_10313756 | 3300026142 | Bacteria | 1465 |
| 443 | Ga0207698_10598549 | 3300026142 | Bacteria | 1087 |
| 444 | Ga0207698_10651217 | 3300026142 | Bacteria | 1043 |
| 445 | Ga0207698_11147594 | 3300026142 | Bacteria | 790 |
| 446 | Ga0207698_11815958 | 3300026142 | Unclassified | 625 |
| 447 | Ga0209974_10032756 | 3300027876 | Bacteria | 1723 |
| 448 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 449 | Ga0268266_10144888 | 3300028379 | Bacteria | 2135 |
| 450 | Ga0268266_10520302 | 3300028379 | Unclassified | 1137 |
| 451 | Ga0268265_10389499 | 3300028380 | Bacteria | 1285 |
| 452 | Ga0268264_10008251 | 3300028381 | Bacteria | 8650 |
| 453 | Ga0268264_10018324 | 3300028381 | Bacteria | 5724 |
| 454 | Ga0268264_10022556 | 3300028381 | Bacteria | 5138 |
| 455 | Ga0268264_10046776 | 3300028381 | Bacteria | 3595 |
| 456 | Ga0268264_10819251 | 3300028381 | Bacteria | 931 |
| 457 | Ga0307517_10507214 | 3300028786 | Unclassified | 612 |
| 458 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 459 | Ga0307511_10000509 | 3300030521 | Bacteria | 41790 |
| 460 | Ga0265332_10371319 | 3300031238 | Unclassified | 591 |
| 461 | Ga0265340_10203877 | 3300031247 | Bacteria | 889 |
| 462 | Ga0265327_10115167 | 3300031251 | Bacteria | 1280 |
| 463 | Ga0307513_10645887 | 3300031456 | Bacteria | 765 |
| 464 | Ga0265313_10108421 | 3300031595 | Bacteria | 1224 |
| 465 | Ga0265314_10211141 | 3300031711 | Bacteria | 1140 |
| 466 | Ga0307413_10610866 | 3300031824 | Unclassified | 894 |
| 467 | Ga0307410_11296601 | 3300031852 | Bacteria | 637 |
| 468 | Ga0307414_11737893 | 3300032004 | Bacteria | 582 |
| 469 | Ga0307411_11391725 | 3300032005 | Unclassified | 642 |
| 470 | Ga0307510_10002732 | 3300033180 | Bacteria | 20188 |
| 471 | Ga0307510_10104605 | 3300033180 | Bacteria | 2603 |
| 472 | Ga0373927_1199713 | 3300035695 | Bacteria | 500 |
| 473 | Ga0373937_0972334 | 3300036401 | Unclassified | 798 |
| 474 | Ga0436365_1777169 | 3300039437 | Bacteria | 24248 |
| 475 | Ga0439436_0000727 | 3300041404 | Bacteria | 8875 |
| 476 | Ga0439439_0013927 | 3300041406 | Bacteria | 1954 |
| 477 | Ga0439439_0076545 | 3300041406 | Bacteria | 901 |
| 478 | Ga0451789_0151170 | 3300041443 | Unclassified | 580 |
| 479 | Ga0451793_0775308 | 3300041452 | Bacteria | 512 |
| 480 | Ga0451793_1543048 | 3300041452 | Bacteria | 550 |
| 481 | Ga0451800_1122242 | 3300041459 | Bacteria | 598 |
| 482 | Ga0451807_0297254 | 3300041486 | Bacteria | 549 |
| 483 | Ga0451841_1070416 | 3300041498 | Bacteria | 843 |
| 484 | Ga0451849_1451831 | 3300041505 | Bacteria | 696 |
| 485 | Ga0451851_0769739 | 3300041507 | Bacteria | 585 |
| 486 | Ga0451843_1188429 | 3300041509 | Bacteria | 564 |
| 487 | Ga0451853_1888255 | 3300041512 | Bacteria | 803 |
| 488 | Ga0439449_0019598 | 3300042007 | Bacteria | 2536 |
| 489 | Ga0439449_0238131 | 3300042007 | Bacteria | 683 |
| 490 | Ga0439449_0375570 | 3300042007 | Bacteria | 539 |
| 491 | Ga0439457_031465 | 3300042014 | Bacteria | 1176 |
| 492 | Ga0439462_0000406 | 3300042015 | Bacteria | 8332 |
| 493 | Ga0451577_0170800 | 3300042876 | Bacteria | 1959 |
| 494 | Ga0466969_0000004 | 3300044656 | Bacteria | 168068 |
| 495 | Ga0466969_0091596 | 3300044656 | Bacteria | 1440 |
| 496 | Ga0466969_0169237 | 3300044656 | Bacteria | 1002 |
| 497 | Ga0466972_0000395 | 3300044658 | Bacteria | 23176 |
| 498 | Ga0466972_0107997 | 3300044658 | Bacteria | 1315 |
| 499 | Ga0466966_0104212 | 3300044684 | Bacteria | 1752 |
| 500 | Ga0466966_0792863 | 3300044684 | Bacteria | 571 |
| 501 | Ga0466961_0049986 | 3300044693 | Bacteria | 2671 |
| 502 | Ga0466961_0208839 | 3300044693 | Bacteria | 1206 |
| 503 | Ga0466961_0432779 | 3300044693 | Bacteria | 797 |
| 504 | Ga0466964_0043385 | 3300044706 | Bacteria | 1824 |
| 505 | Ga0453684_0295910 | 3300044712 | Bacteria | 1841 |
| 506 | Ga0453684_0335704 | 3300044712 | Bacteria | 1708 |
| 507 | Ga0453684_0877297 | 3300044712 | Bacteria | 962 |
| 508 | Ga0466971_0028881 | 3300044719 | Bacteria | 2480 |
| 509 | Ga0466971_0580598 | 3300044719 | Bacteria | 558 |
| 510 | Ga0466968_0036066 | 3300044735 | Bacteria | 2071 |
| 511 | Ga0466957_0004957 | 3300044842 | Bacteria | 7449 |
| 512 | Ga0466957_0046684 | 3300044842 | Bacteria | 2630 |
| 513 | Ga0466957_0308564 | 3300044842 | Bacteria | 1065 |
| 514 | Ga0466960_0325194 | 3300044901 | Bacteria | 872 |
| 515 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 516 | Ga0466959_0005944 | 3300045049 | Bacteria | 8415 |
| 517 | Ga0466958_0020671 | 3300045836 | Bacteria | 3841 |
| 518 | Ga0495606_0005088 | 3300046507 | Bacteria | 12792 |
| 519 | Ga0495632_0471791 | 3300046519 | Bacteria | 543 |
| 520 | Ga0495668_0000685 | 3300046616 | Bacteria | 40831 |
| 521 | Ga0495611_0000079 | 3300046648 | Bacteria | 68471 |
| 522 | Ga0495625_0436765 | 3300046660 | Bacteria | 811 |
| 523 | Ga0495625_0911790 | 3300046660 | Unclassified | 503 |
| 524 | Ga0495649_0045422 | 3300046694 | Bacteria | 2395 |
| 525 | Ga0495672_0060488 | 3300047320 | Bacteria | 2188 |
| 526 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 527 | Ga0495686_0628074 | 3300047472 | Bacteria | 554 |
| 528 | Ga0496101_0030909 | 3300048904 | Bacteria | 3760 |
| 529 | Ga0496106_0046633 | 3300048909 | Bacteria | 3259 |
| 530 | Ga0496108_0202635 | 3300048911 | Bacteria | 1722 |
| 531 | Ga0496109_1820014 | 3300048912 | Bacteria | 542 |
| 532 | Ga0496114_0104385 | 3300048917 | Bacteria | 2423 |
| 533 | Ga0501291_168640 | 3300049514 | Unclassified | 504 |
| 534 | Ga0501032_0006965 | 3300049569 | Bacteria | 8288 |
| 535 | Ga0501032_0038126 | 3300049569 | Bacteria | 3274 |
| 536 | Ga0501033_0011263 | 3300049570 | Bacteria | 6846 |
| 537 | Ga0501033_0688616 | 3300049570 | Bacteria | 696 |
| 538 | Ga0501033_0926165 | 3300049570 | Bacteria | 585 |
| 539 | Ga0501034_0001891 | 3300049571 | Bacteria | 26519 |
| 540 | Ga0501034_0024251 | 3300049571 | Bacteria | 6169 |
| 541 | Ga0501034_0111926 | 3300049571 | Bacteria | 2720 |
| 542 | Ga0501034_0609167 | 3300049571 | Bacteria | 997 |
| 543 | Ga0501036_0030850 | 3300049572 | Bacteria | 4529 |
| 544 | Ga0501036_0289209 | 3300049572 | Unclassified | 1371 |
| 545 | Ga0501037_0004781 | 3300049573 | Bacteria | 9845 |
| 546 | Ga0501037_0007419 | 3300049573 | Bacteria | 8017 |
| 547 | Ga0501037_0215761 | 3300049573 | Bacteria | 1352 |
| 548 | Ga0501038_0030182 | 3300049574 | Bacteria | 4800 |
| 549 | Ga0501038_0513286 | 3300049574 | Bacteria | 915 |
| 550 | Ga0501038_0665501 | 3300049574 | Unclassified | 783 |
| 551 | Ga0501039_0095622 | 3300049575 | Bacteria | 2316 |
| 552 | Ga0501043_0009692 | 3300049579 | Bacteria | 7546 |
| 553 | Ga0501043_0019373 | 3300049579 | Bacteria | 5342 |
| 554 | Ga0501043_0442803 | 3300049579 | Bacteria | 977 |
| 555 | Ga0501043_0780700 | 3300049579 | Bacteria | 692 |
| 556 | Ga0501046_0003336 | 3300049580 | Bacteria | 14755 |
| 557 | Ga0501046_1026497 | 3300049580 | Bacteria | 572 |
| 558 | Ga0501047_0002513 | 3300049581 | Bacteria | 17487 |
| 559 | Ga0501047_0003037 | 3300049581 | Bacteria | 15919 |
| 560 | Ga0501047_1246314 | 3300049581 | Bacteria | 557 |
| 561 | Ga0501048_0101204 | 3300049582 | Bacteria | 2033 |
| 562 | Ga0501048_0616881 | 3300049582 | Bacteria | 779 |
| 563 | Ga0501067_0002016 | 3300049583 | Bacteria | 11196 |
| 564 | Ga0501067_0005028 | 3300049583 | Bacteria | 7343 |
| 565 | Ga0501068_0088935 | 3300049584 | Bacteria | 1903 |
| 566 | Ga0501068_0216776 | 3300049584 | Bacteria | 1216 |
| 567 | Ga0501069_0117805 | 3300049585 | Unclassified | 1515 |
| 568 | Ga0501070_0075994 | 3300049586 | Bacteria | 2780 |
| 569 | Ga0501072_0350103 | 3300049588 | Bacteria | 1173 |
| 570 | Ga0501073_0058667 | 3300049589 | Bacteria | 2689 |
| 571 | Ga0501074_0005676 | 3300049590 | Bacteria | 8990 |
| 572 | Ga0501074_0753985 | 3300049590 | Unclassified | 686 |
| 573 | Ga0501076_0153833 | 3300049592 | Bacteria | 1872 |
| 574 | Ga0501077_0865200 | 3300049593 | Bacteria | 581 |
| 575 | Ga0501209_269311 | 3300049656 | Bacteria | 534 |
| 576 | Ga0501258_069604 | 3300049687 | Bacteria | 521 |
| 577 | Ga0501219_000066 | 3300049703 | Bacteria | 17566 |
| 578 | Ga0501079_0101000 | 3300049741 | Bacteria | 2237 |
| 579 | Ga0501079_0302360 | 3300049741 | Bacteria | 1252 |
| 580 | Ga0501083_0007950 | 3300049744 | Bacteria | 7509 |
| 581 | Ga0501083_0270470 | 3300049744 | Bacteria | 1105 |
| 582 | Ga0501241_018782 | 3300049758 | Bacteria | 1267 |
| 583 | Ga0501268_051824 | 3300049765 | Unclassified | 796 |
| 584 | Ga0501270_067199 | 3300049767 | Unclassified | 686 |
| 585 | Ga0501035_0014156 | 3300049822 | Bacteria | 7359 |
| 586 | Ga0501035_0065490 | 3300049822 | Bacteria | 3227 |
| 587 | Ga0501035_0615308 | 3300049822 | Unclassified | 884 |
| 588 | Ga0501035_0795376 | 3300049822 | Bacteria | 756 |
| 589 | Ga0501044_0004121 | 3300049823 | Bacteria | 16310 |
| 590 | Ga0501044_0004145 | 3300049823 | Bacteria | 16280 |
| 591 | Ga0501044_0005264 | 3300049823 | Bacteria | 14391 |
| 592 | Ga0501044_1005732 | 3300049823 | Bacteria | 705 |
| 593 | Ga0501045_0629780 | 3300049824 | Bacteria | 793 |
| 594 | Ga0501284_00018 | 3300050005 | Bacteria | 93729 |
| 595 | Ga0501284_02238 | 3300050005 | Bacteria | 1061 |
| 596 | nmdc:mga0k408_343249_c1 | 3300050493 | Bacteria | 890 |
| 597 | nmdc:mga0k408_353356_c1 | 3300050493 | Bacteria | 876 |
| 598 | nmdc:mga0k408_630225_c1 | 3300050493 | Bacteria | 631 |
| 599 | nmdc:mga05p37_1343_c1 | 3300050507 | Bacteria | 28597 |
| 600 | nmdc:mga09592_38283_c1 | 3300050508 | Bacteria | 4025 |
| 601 | nmdc:mga06r32_7793_c1 | 3300050510 | Bacteria | 9624 |
| 602 | nmdc:mga08y16_64205_c1 | 3300050511 | Bacteria | 3834 |
| 603 | Ga0500578_0000037 | 3300053086 | Bacteria | 134901 |
| 604 | Ga0500578_0253116 | 3300053086 | Bacteria | 1060 |
| 605 | Ga0500644_0051565 | 3300053088 | Bacteria | 1413 |
| 606 | Ga0500646_0003987 | 3300053090 | Bacteria | 3755 |
| 607 | Ga0500646_0009166 | 3300053090 | Bacteria | 2533 |
| 608 | Ga0500583_0000089 | 3300053092 | Bacteria | 51075 |
| 609 | Ga0500583_0006034 | 3300053092 | Bacteria | 4124 |
| 610 | Ga0500583_0206625 | 3300053092 | Bacteria | 975 |
| 611 | Ga0500651_0378178 | 3300053093 | Bacteria | 799 |
| 612 | Ga0500641_0181978 | 3300053096 | Bacteria | 902 |
| 613 | Ga0500555_016078 | 3300053103 | Bacteria | 2157 |
| 614 | Ga0500556_0086798 | 3300053104 | Bacteria | 1190 |
| 615 | Ga0500628_247282 | 3300053129 | Bacteria | 524 |
| 616 | Ga0500642_0064098 | 3300053130 | Bacteria | 1658 |
| 617 | Ga0500658_0126247 | 3300053134 | Bacteria | 1138 |
| 618 | Ga0500559_0059922 | 3300053136 | Unclassified | 1695 |
| 619 | Ga0500559_0467521 | 3300053136 | Bacteria | 582 |
| 620 | Ga0500561_0134710 | 3300053137 | Bacteria | 762 |
| 621 | Ga0500573_0297183 | 3300053140 | Bacteria | 809 |
| 622 | Ga0500588_0079748 | 3300053146 | Unclassified | 1092 |
| 623 | Ga0500589_049400 | 3300053147 | Bacteria | 1954 |
| 624 | Ga0500589_209137 | 3300053147 | Bacteria | 743 |
| 625 | Ga0500604_0127854 | 3300053151 | Bacteria | 853 |
| 626 | Ga0500622_0033454 | 3300053156 | Bacteria | 2695 |
| 627 | Ga0500633_0186406 | 3300053160 | Bacteria | 778 |
| 628 | Ga0500639_048361 | 3300053163 | Bacteria | 2220 |
| 629 | Ga0500636_0035574 | 3300053177 | Bacteria | 2947 |
| 630 | Ga0500636_0069011 | 3300053177 | Bacteria | 2052 |
| 631 | Ga0500637_0016380 | 3300053178 | Bacteria | 3951 |
| 632 | Ga0500637_0279934 | 3300053178 | Bacteria | 919 |
| 633 | Ga0500637_0410391 | 3300053178 | Bacteria | 700 |
| 634 | Ga0500611_009565 | 3300053727 | Bacteria | 1541 |
| 635 | Ga0501084_0039744 | 3300054114 | Bacteria | 3934 |
| 636 | Ga0501082_0083200 | 3300060353 | Bacteria | 2761 |
| 637 | Ga0466962_0001216 | 3300061719 | Bacteria | 11838 |
| 638 | Ga0466962_0396685 | 3300061719 | Bacteria | 691 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041505 | Ga0451849_1451831 | Ga0451849_1451831_383_685 | 80 |
| 2 | 3300044693 | Ga0466961_0208839 | Ga0466961_0208839_814_1107 | 84 |
| 3 | 3300049514 | Ga0501291_168640 | Ga0501291_168640_227_493 | 88 |
| 4 | 3300005616 | Ga0068852_100000902 | Ga0068852_10000090215 | 90 |
| 5 | 3300025913 | Ga0207695_10018745 | Ga0207695_100187452 | 90 |
| 6 | 3300026142 | Ga0207698_10000987 | Ga0207698_100009878 | 90 |
| 7 | 3300044842 | Ga0466957_0308564 | Ga0466957_0308564_563_835 | 90 |
| 8 | 3300005539 | Ga0068853_100001323 | Ga0068853_10000132313 | 91 |
| 9 | 3300005578 | Ga0068854_101231842 | Ga0068854_1012318421 | 91 |
| 10 | 3300005616 | Ga0068852_101192781 | Ga0068852_1011927812 | 91 |
| 11 | 3300005834 | Ga0068851_10679138 | Ga0068851_106791381 | 91 |
| 12 | 3300009093 | Ga0105240_10010363 | Ga0105240_1001036312 | 91 |
| 13 | 3300009093 | Ga0105240_10040454 | Ga0105240_100404545 | 91 |
| 14 | 3300010375 | Ga0105239_10045483 | Ga0105239_100454831 | 91 |
| 15 | 3300013307 | Ga0157372_10276210 | Ga0157372_102762104 | 91 |
| 16 | 3300025904 | Ga0207647_10424916 | Ga0207647_104249162 | 91 |
| 17 | 3300025913 | Ga0207695_10000146 | Ga0207695_1000014622 | 91 |
| 18 | 3300025913 | Ga0207695_10003218 | Ga0207695_1000321812 | 91 |
| 19 | 3300025913 | Ga0207695_10015113 | Ga0207695_100151134 | 91 |
| 20 | 3300025981 | Ga0207640_11402382 | Ga0207640_114023821 | 91 |
| 21 | 3300025986 | Ga0207658_10866683 | Ga0207658_108666832 | 91 |
| 22 | 3300026041 | Ga0207639_10012165 | Ga0207639_100121656 | 91 |
| 23 | 3300053090 | Ga0500646_0003987 | Ga0500646_0003987_979_1269 | 91 |
| 24 | 3300005288 | Ga0065714_10287823 | Ga0065714_102878232 | 92 |
| 25 | 3300005331 | Ga0070670_100798344 | Ga0070670_1007983441 | 92 |
| 26 | 3300009174 | Ga0105241_12575849 | Ga0105241_125758491 | 92 |
| 27 | 3300025925 | Ga0207650_11598069 | Ga0207650_115980692 | 92 |
| 28 | 3300025931 | Ga0207644_10310126 | Ga0207644_103101262 | 92 |
| 29 | 3300036401 | Ga0373937_0972334 | Ga0373937_0972334_373_651 | 92 |
| 30 | iso_pu_bacteria | 2738541278 | 2738724580 | 92 |
| 31 | 3300003316 | rootH1_10103792 | rootH1_101037923 | 93 |
| 32 | 3300003320 | rootH2_10014840 | rootH2_100148405 | 93 |
| 33 | 3300003320 | rootH2_10052864 | rootH2_100528644 | 93 |
| 34 | 3300003323 | rootH1_10332917 | rootH1_103329172 | 93 |
| 35 | 3300003659 | JGI25404J52841_10081937 | JGI25404J52841_100819371 | 93 |
| 36 | 3300005290 | Ga0065712_10196191 | Ga0065712_101961911 | 93 |
| 37 | 3300005290 | Ga0065712_10553212 | Ga0065712_105532122 | 93 |
| 38 | 3300005327 | Ga0070658_10011212 | Ga0070658_100112126 | 93 |
| 39 | 3300005328 | Ga0070676_10000238 | Ga0070676_1000023820 | 93 |
| 40 | 3300005330 | Ga0070690_100236633 | Ga0070690_1002366331 | 93 |
| 41 | 3300005331 | Ga0070670_100445216 | Ga0070670_1004452161 | 93 |
| 42 | 3300005334 | Ga0068869_100110204 | Ga0068869_1001102041 | 93 |
| 43 | 3300005335 | Ga0070666_10001496 | Ga0070666_100014968 | 93 |
| 44 | 3300005337 | Ga0070682_100000393 | Ga0070682_1000003938 | 93 |
| 45 | 3300005337 | Ga0070682_100334817 | Ga0070682_1003348172 | 93 |
| 46 | 3300005338 | Ga0068868_100001065 | Ga0068868_10000106511 | 93 |
| 47 | 3300005347 | Ga0070668_100003447 | Ga0070668_1000034476 | 93 |
| 48 | 3300005354 | Ga0070675_100024172 | Ga0070675_1000241722 | 93 |
| 49 | 3300005356 | Ga0070674_100595813 | Ga0070674_1005958132 | 93 |
| 50 | 3300005364 | Ga0070673_100001402 | Ga0070673_10000140210 | 93 |
| 51 | 3300005366 | Ga0070659_100755167 | Ga0070659_1007551671 | 93 |
| 52 | 3300005367 | Ga0070667_100001589 | Ga0070667_1000015894 | 93 |
| 53 | 3300005456 | Ga0070678_100292701 | Ga0070678_1002927012 | 93 |
| 54 | 3300005458 | Ga0070681_10039915 | Ga0070681_100399154 | 93 |
| 55 | 3300005459 | Ga0068867_100003608 | Ga0068867_1000036087 | 93 |
| 56 | 3300005466 | Ga0070685_10180536 | Ga0070685_101805361 | 93 |
| 57 | 3300005536 | Ga0070697_101980970 | Ga0070697_1019809701 | 93 |
| 58 | 3300005539 | Ga0068853_100001266 | Ga0068853_1000012666 | 93 |
| 59 | 3300005543 | Ga0070672_100008059 | Ga0070672_1000080591 | 93 |
| 60 | 3300005543 | Ga0070672_101201388 | Ga0070672_1012013881 | 93 |
| 61 | 3300005548 | Ga0070665_100000018 | Ga0070665_100000018211 | 93 |
| 62 | 3300005548 | Ga0070665_100551063 | Ga0070665_1005510632 | 93 |
| 63 | 3300005563 | Ga0068855_100039314 | Ga0068855_1000393142 | 93 |
| 64 | 3300005563 | Ga0068855_100042044 | Ga0068855_1000420443 | 93 |
| 65 | 3300005578 | Ga0068854_100217084 | Ga0068854_1002170844 | 93 |
| 66 | 3300005616 | Ga0068852_101956384 | Ga0068852_1019563842 | 93 |
| 67 | 3300005617 | Ga0068859_100236208 | Ga0068859_1002362083 | 93 |
| 68 | 3300005617 | Ga0068859_102666392 | Ga0068859_1026663922 | 93 |
| 69 | 3300005618 | Ga0068864_100001339 | Ga0068864_10000133919 | 93 |
| 70 | 3300005719 | Ga0068861_100147948 | Ga0068861_1001479483 | 93 |
| 71 | 3300005719 | Ga0068861_101167616 | Ga0068861_1011676162 | 93 |
| 72 | 3300005834 | Ga0068851_10000433 | Ga0068851_100004334 | 93 |
| 73 | 3300005834 | Ga0068851_10032370 | Ga0068851_100323703 | 93 |
| 74 | 3300005840 | Ga0068870_10991859 | Ga0068870_109918591 | 93 |
| 75 | 3300005841 | Ga0068863_100015219 | Ga0068863_1000152196 | 93 |
| 76 | 3300005842 | Ga0068858_100018401 | Ga0068858_1000184015 | 93 |
| 77 | 3300005843 | Ga0068860_100004955 | Ga0068860_1000049552 | 93 |
| 78 | 3300005983 | Ga0081540_1005596 | Ga0081540_10055967 | 93 |
| 79 | 3300006163 | Ga0070715_10119309 | Ga0070715_101193092 | 93 |
| 80 | 3300006237 | Ga0097621_100022689 | Ga0097621_1000226894 | 93 |
| 81 | 3300006358 | Ga0068871_100000582 | Ga0068871_10000058215 | 93 |
| 82 | 3300006881 | Ga0068865_100169037 | Ga0068865_1001690373 | 93 |
| 83 | 3300006931 | Ga0097620_100236194 | Ga0097620_1002361943 | 93 |
| 84 | 3300006931 | Ga0097620_102666296 | Ga0097620_1026662962 | 93 |
| 85 | 3300009093 | Ga0105240_10057728 | Ga0105240_100577283 | 93 |
| 86 | 3300009093 | Ga0105240_10163495 | Ga0105240_101634952 | 93 |
| 87 | 3300009098 | Ga0105245_10738772 | Ga0105245_107387721 | 93 |
| 88 | 3300009174 | Ga0105241_10241279 | Ga0105241_102412791 | 93 |
| 89 | 3300009174 | Ga0105241_10796304 | Ga0105241_107963041 | 93 |
| 90 | 3300009177 | Ga0105248_10105707 | Ga0105248_101057072 | 93 |
| 91 | 3300009545 | Ga0105237_10022388 | Ga0105237_100223885 | 93 |
| 92 | 3300009551 | Ga0105238_10028860 | Ga0105238_100288606 | 93 |
| 93 | 3300009553 | Ga0105249_10036337 | Ga0105249_100363371 | 93 |
| 94 | 3300009553 | Ga0105249_10853770 | Ga0105249_108537701 | 93 |
| 95 | 3300010375 | Ga0105239_10101610 | Ga0105239_101016102 | 93 |
| 96 | 3300010375 | Ga0105239_10568430 | Ga0105239_105684301 | 93 |
| 97 | 3300011119 | Ga0105246_10718055 | Ga0105246_107180551 | 93 |
| 98 | 3300013296 | Ga0157374_10000025 | Ga0157374_10000025148 | 93 |
| 99 | 3300013296 | Ga0157374_10016290 | Ga0157374_100162904 | 93 |
| 100 | 3300013297 | Ga0157378_10116932 | Ga0157378_101169322 | 93 |
| 101 | 3300013306 | Ga0163162_10033628 | Ga0163162_100336284 | 93 |
| 102 | 3300013306 | Ga0163162_10073821 | Ga0163162_100738212 | 93 |
| 103 | 3300013307 | Ga0157372_10046053 | Ga0157372_100460535 | 93 |
| 104 | 3300013308 | Ga0157375_10000827 | Ga0157375_100008274 | 93 |
| 105 | 3300014325 | Ga0163163_10071141 | Ga0163163_100711414 | 93 |
| 106 | 3300014968 | Ga0157379_10014679 | Ga0157379_100146791 | 93 |
| 107 | 3300014969 | Ga0157376_10000106 | Ga0157376_1000010648 | 93 |
| 108 | 3300014969 | Ga0157376_10000650 | Ga0157376_1000065017 | 93 |
| 109 | 3300025321 | Ga0207656_10090117 | Ga0207656_100901172 | 93 |
| 110 | 3300025321 | Ga0207656_10111589 | Ga0207656_101115891 | 93 |
| 111 | 3300025903 | Ga0207680_10001074 | Ga0207680_100010746 | 93 |
| 112 | 3300025907 | Ga0207645_10003472 | Ga0207645_1000347210 | 93 |
| 113 | 3300025909 | Ga0207705_10014017 | Ga0207705_100140171 | 93 |
| 114 | 3300025912 | Ga0207707_10073935 | Ga0207707_100739354 | 93 |
| 115 | 3300025913 | Ga0207695_10139963 | Ga0207695_101399634 | 93 |
| 116 | 3300025913 | Ga0207695_10154091 | Ga0207695_101540912 | 93 |
| 117 | 3300025914 | Ga0207671_10020429 | Ga0207671_100204293 | 93 |
| 118 | 3300025914 | Ga0207671_11517087 | Ga0207671_115170871 | 93 |
| 119 | 3300025926 | Ga0207659_10186722 | Ga0207659_101867224 | 93 |
| 120 | 3300025927 | Ga0207687_10518968 | Ga0207687_105189681 | 93 |
| 121 | 3300025938 | Ga0207704_10006582 | Ga0207704_100065821 | 93 |
| 122 | 3300025940 | Ga0207691_10000076 | Ga0207691_100000767 | 93 |
| 123 | 3300025940 | Ga0207691_10165875 | Ga0207691_101658753 | 93 |
| 124 | 3300025940 | Ga0207691_11037087 | Ga0207691_110370871 | 93 |
| 125 | 3300025941 | Ga0207711_10134535 | Ga0207711_101345354 | 93 |
| 126 | 3300025942 | Ga0207689_10058218 | Ga0207689_100582184 | 93 |
| 127 | 3300025942 | Ga0207689_10512509 | Ga0207689_105125092 | 93 |
| 128 | 3300025949 | Ga0207667_10032466 | Ga0207667_100324665 | 93 |
| 129 | 3300025949 | Ga0207667_10090406 | Ga0207667_100904061 | 93 |
| 130 | 3300025960 | Ga0207651_10055807 | Ga0207651_100558074 | 93 |
| 131 | 3300025961 | Ga0207712_10020658 | Ga0207712_100206581 | 93 |
| 132 | 3300025961 | Ga0207712_11444223 | Ga0207712_114442231 | 93 |
| 133 | 3300025972 | Ga0207668_10005078 | Ga0207668_100050785 | 93 |
| 134 | 3300025981 | Ga0207640_10227275 | Ga0207640_102272753 | 93 |
| 135 | 3300025986 | Ga0207658_10004289 | Ga0207658_100042899 | 93 |
| 136 | 3300026023 | Ga0207677_10054044 | Ga0207677_100540444 | 93 |
| 137 | 3300026035 | Ga0207703_10466559 | Ga0207703_104665594 | 93 |
| 138 | 3300026041 | Ga0207639_10157504 | Ga0207639_101575044 | 93 |
| 139 | 3300026088 | Ga0207641_10030766 | Ga0207641_100307662 | 93 |
| 140 | 3300026088 | Ga0207641_12146484 | Ga0207641_121464841 | 93 |
| 141 | 3300026089 | Ga0207648_10010617 | Ga0207648_100106174 | 93 |
| 142 | 3300026095 | Ga0207676_10042450 | Ga0207676_100424502 | 93 |
| 143 | 3300026118 | Ga0207675_100191873 | Ga0207675_1001918733 | 93 |
| 144 | 3300026121 | Ga0207683_10337941 | Ga0207683_103379412 | 93 |
| 145 | 3300026142 | Ga0207698_10651217 | Ga0207698_106512172 | 93 |
| 146 | 3300026142 | Ga0207698_11815958 | Ga0207698_118159581 | 93 |
| 147 | 3300028379 | Ga0268266_10000026 | Ga0268266_10000026150 | 93 |
| 148 | 3300028379 | Ga0268266_10144888 | Ga0268266_101448884 | 93 |
| 149 | 3300028379 | Ga0268266_10520302 | Ga0268266_105203023 | 93 |
| 150 | 3300028381 | Ga0268264_10022556 | Ga0268264_100225565 | 93 |
| 151 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012181 | 93 |
| 152 | 3300031238 | Ga0265332_10371319 | Ga0265332_103713191 | 93 |
| 153 | 3300031247 | Ga0265340_10203877 | Ga0265340_102038771 | 93 |
| 154 | 3300031595 | Ga0265313_10108421 | Ga0265313_101084213 | 93 |
| 155 | 3300031711 | Ga0265314_10211141 | Ga0265314_102111412 | 93 |
| 156 | 3300032004 | Ga0307414_11737893 | Ga0307414_117378931 | 93 |
| 157 | 3300041452 | Ga0451793_0775308 | Ga0451793_0775308_209_490 | 93 |
| 158 | 3300041509 | Ga0451843_1188429 | Ga0451843_1188429_49_330 | 93 |
| 159 | 3300044656 | Ga0466969_0169237 | Ga0466969_0169237_252_533 | 93 |
| 160 | 3300044684 | Ga0466966_0792863 | Ga0466966_0792863_83_364 | 93 |
| 161 | 3300044693 | Ga0466961_0049986 | Ga0466961_0049986_13_294 | 93 |
| 162 | 3300044712 | Ga0453684_0877297 | Ga0453684_0877297_508_789 | 93 |
| 163 | 3300044719 | Ga0466971_0028881 | Ga0466971_0028881_98_379 | 93 |
| 164 | 3300045049 | Ga0466959_0005944 | Ga0466959_0005944_5028_5309 | 93 |
| 165 | 3300045836 | Ga0466958_0020671 | Ga0466958_0020671_3122_3403 | 93 |
| 166 | 3300046660 | Ga0495625_0436765 | Ga0495625_0436765_80_361 | 93 |
| 167 | 3300046694 | Ga0495649_0045422 | Ga0495649_0045422_659_940 | 93 |
| 168 | 3300047320 | Ga0495672_0060488 | Ga0495672_0060488_237_518 | 93 |
| 169 | 3300048911 | Ga0496108_0202635 | Ga0496108_0202635_636_917 | 93 |
| 170 | 3300050005 | Ga0501284_02238 | Ga0501284_02238_155_439 | 93 |
| 171 | 3300053096 | Ga0500641_0181978 | Ga0500641_0181978_163_444 | 93 |
| 172 | 3300053140 | Ga0500573_0297183 | Ga0500573_0297183_69_350 | 93 |
| 173 | 3300061719 | Ga0466962_0001216 | Ga0466962_0001216_4558_4839 | 93 |
| 174 | 3300003320 | rootH2_10002129 | rootH2_1000212911 | 94 |
| 175 | 3300003320 | rootH2_10020813 | rootH2_100208139 | 94 |
| 176 | 3300005290 | Ga0065712_10103457 | Ga0065712_101034572 | 94 |
| 177 | 3300005327 | Ga0070658_10751327 | Ga0070658_107513271 | 94 |
| 178 | 3300005328 | Ga0070676_10389533 | Ga0070676_103895332 | 94 |
| 179 | 3300005331 | Ga0070670_100778397 | Ga0070670_1007783972 | 94 |
| 180 | 3300005336 | Ga0070680_100308915 | Ga0070680_1003089152 | 94 |
| 181 | 3300005338 | Ga0068868_100089776 | Ga0068868_1000897762 | 94 |
| 182 | 3300005339 | Ga0070660_100617455 | Ga0070660_1006174551 | 94 |
| 183 | 3300005340 | Ga0070689_100714994 | Ga0070689_1007149943 | 94 |
| 184 | 3300005341 | Ga0070691_10670626 | Ga0070691_106706261 | 94 |
| 185 | 3300005344 | Ga0070661_101204583 | Ga0070661_1012045831 | 94 |
| 186 | 3300005353 | Ga0070669_100043329 | Ga0070669_1000433291 | 94 |
| 187 | 3300005354 | Ga0070675_100251913 | Ga0070675_1002519133 | 94 |
| 188 | 3300005364 | Ga0070673_100834923 | Ga0070673_1008349231 | 94 |
| 189 | 3300005365 | Ga0070688_100266026 | Ga0070688_1002660262 | 94 |
| 190 | 3300005365 | Ga0070688_100470671 | Ga0070688_1004706711 | 94 |
| 191 | 3300005439 | Ga0070711_101780656 | Ga0070711_1017806561 | 94 |
| 192 | 3300005457 | Ga0070662_101448592 | Ga0070662_1014485922 | 94 |
| 193 | 3300005458 | Ga0070681_10734170 | Ga0070681_107341701 | 94 |
| 194 | 3300005458 | Ga0070681_11075410 | Ga0070681_110754101 | 94 |
| 195 | 3300005459 | Ga0068867_100120537 | Ga0068867_1001205372 | 94 |
| 196 | 3300005530 | Ga0070679_100110609 | Ga0070679_1001106092 | 94 |
| 197 | 3300005535 | Ga0070684_101338620 | Ga0070684_1013386201 | 94 |
| 198 | 3300005539 | Ga0068853_100125341 | Ga0068853_1001253414 | 94 |
| 199 | 3300005543 | Ga0070672_100689907 | Ga0070672_1006899071 | 94 |
| 200 | 3300005549 | Ga0070704_101693036 | Ga0070704_1016930362 | 94 |
| 201 | 3300005563 | Ga0068855_100006123 | Ga0068855_10000612311 | 94 |
| 202 | 3300005577 | Ga0068857_100000308 | Ga0068857_10000030822 | 94 |
| 203 | 3300005578 | Ga0068854_100251591 | Ga0068854_1002515912 | 94 |
| 204 | 3300005614 | Ga0068856_100029852 | Ga0068856_1000298524 | 94 |
| 205 | 3300005614 | Ga0068856_100194324 | Ga0068856_1001943243 | 94 |
| 206 | 3300005614 | Ga0068856_101719051 | Ga0068856_1017190511 | 94 |
| 207 | 3300005616 | Ga0068852_100075858 | Ga0068852_1000758584 | 94 |
| 208 | 3300005617 | Ga0068859_100959009 | Ga0068859_1009590093 | 94 |
| 209 | 3300005719 | Ga0068861_101366400 | Ga0068861_1013664002 | 94 |
| 210 | 3300005843 | Ga0068860_100017463 | Ga0068860_1000174632 | 94 |
| 211 | 3300005844 | Ga0068862_100498016 | Ga0068862_1004980162 | 94 |
| 212 | 3300006237 | Ga0097621_100417224 | Ga0097621_1004172242 | 94 |
| 213 | 3300006358 | Ga0068871_100335766 | Ga0068871_1003357662 | 94 |
| 214 | 3300006358 | Ga0068871_100477813 | Ga0068871_1004778133 | 94 |
| 215 | 3300006844 | Ga0075428_100103007 | Ga0075428_1001030071 | 94 |
| 216 | 3300006847 | Ga0075431_100004624 | Ga0075431_10000462412 | 94 |
| 217 | 3300006880 | Ga0075429_100069117 | Ga0075429_1000691172 | 94 |
| 218 | 3300006931 | Ga0097620_100959264 | Ga0097620_1009592643 | 94 |
| 219 | 3300009093 | Ga0105240_10014456 | Ga0105240_100144564 | 94 |
| 220 | 3300009093 | Ga0105240_10026640 | Ga0105240_100266402 | 94 |
| 221 | 3300009093 | Ga0105240_10113772 | Ga0105240_101137725 | 94 |
| 222 | 3300009093 | Ga0105240_10506520 | Ga0105240_105065202 | 94 |
| 223 | 3300009094 | Ga0111539_10181440 | Ga0111539_101814402 | 94 |
| 224 | 3300009101 | Ga0105247_10128752 | Ga0105247_101287522 | 94 |
| 225 | 3300009147 | Ga0114129_10035352 | Ga0114129_100353522 | 94 |
| 226 | 3300009174 | Ga0105241_11234135 | Ga0105241_112341351 | 94 |
| 227 | 3300009176 | Ga0105242_10485928 | Ga0105242_104859282 | 94 |
| 228 | 3300009176 | Ga0105242_10692482 | Ga0105242_106924823 | 94 |
| 229 | 3300009176 | Ga0105242_11378478 | Ga0105242_113784781 | 94 |
| 230 | 3300009545 | Ga0105237_10002084 | Ga0105237_100020845 | 94 |
| 231 | 3300009545 | Ga0105237_10054325 | Ga0105237_100543252 | 94 |
| 232 | 3300009545 | Ga0105237_12636225 | Ga0105237_126362251 | 94 |
| 233 | 3300009551 | Ga0105238_10286040 | Ga0105238_102860402 | 94 |
| 234 | 3300009551 | Ga0105238_12817882 | Ga0105238_128178821 | 94 |
| 235 | 3300010375 | Ga0105239_10024227 | Ga0105239_100242276 | 94 |
| 236 | 3300010375 | Ga0105239_10115101 | Ga0105239_101151012 | 94 |
| 237 | 3300013100 | Ga0157373_10083773 | Ga0157373_100837732 | 94 |
| 238 | 3300013100 | Ga0157373_10161279 | Ga0157373_101612793 | 94 |
| 239 | 3300013102 | Ga0157371_10277757 | Ga0157371_102777572 | 94 |
| 240 | 3300013104 | Ga0157370_10024115 | Ga0157370_100241155 | 94 |
| 241 | 3300013104 | Ga0157370_10112289 | Ga0157370_101122892 | 94 |
| 242 | 3300013104 | Ga0157370_10557954 | Ga0157370_105579543 | 94 |
| 243 | 3300013104 | Ga0157370_11543916 | Ga0157370_115439162 | 94 |
| 244 | 3300013105 | Ga0157369_10414082 | Ga0157369_104140822 | 94 |
| 245 | 3300013105 | Ga0157369_10430931 | Ga0157369_104309313 | 94 |
| 246 | 3300013105 | Ga0157369_10899353 | Ga0157369_108993532 | 94 |
| 247 | 3300013296 | Ga0157374_10580127 | Ga0157374_105801271 | 94 |
| 248 | 3300013296 | Ga0157374_11996546 | Ga0157374_119965461 | 94 |
| 249 | 3300013296 | Ga0157374_12687502 | Ga0157374_126875022 | 94 |
| 250 | 3300013297 | Ga0157378_12098183 | Ga0157378_120981831 | 94 |
| 251 | 3300013306 | Ga0163162_11694895 | Ga0163162_116948951 | 94 |
| 252 | 3300013306 | Ga0163162_11752364 | Ga0163162_117523642 | 94 |
| 253 | 3300013307 | Ga0157372_10000080 | Ga0157372_1000008060 | 94 |
| 254 | 3300013307 | Ga0157372_10710690 | Ga0157372_107106902 | 94 |
| 255 | 3300013307 | Ga0157372_11496628 | Ga0157372_114966281 | 94 |
| 256 | 3300014325 | Ga0163163_10544484 | Ga0163163_105444843 | 94 |
| 257 | 3300014326 | Ga0157380_10497350 | Ga0157380_104973502 | 94 |
| 258 | 3300014968 | Ga0157379_10938378 | Ga0157379_109383782 | 94 |
| 259 | 3300014968 | Ga0157379_11332084 | Ga0157379_113320842 | 94 |
| 260 | 3300014969 | Ga0157376_10635325 | Ga0157376_106353251 | 94 |
| 261 | 3300017792 | Ga0163161_10209651 | Ga0163161_102096512 | 94 |
| 262 | 3300020078 | Ga0206352_11229666 | Ga0206352_112296661 | 94 |
| 263 | 3300021384 | Ga0213876_10007925 | Ga0213876_100079253 | 94 |
| 264 | 3300021384 | Ga0213876_10090628 | Ga0213876_100906282 | 94 |
| 265 | 3300025904 | Ga0207647_10008966 | Ga0207647_100089664 | 94 |
| 266 | 3300025909 | Ga0207705_10298815 | Ga0207705_102988152 | 94 |
| 267 | 3300025911 | Ga0207654_10149979 | Ga0207654_101499794 | 94 |
| 268 | 3300025912 | Ga0207707_10451160 | Ga0207707_104511603 | 94 |
| 269 | 3300025912 | Ga0207707_11612588 | Ga0207707_116125882 | 94 |
| 270 | 3300025913 | Ga0207695_10000248 | Ga0207695_10000248123 | 94 |
| 271 | 3300025913 | Ga0207695_10052136 | Ga0207695_100521365 | 94 |
| 272 | 3300025913 | Ga0207695_10061832 | Ga0207695_100618323 | 94 |
| 273 | 3300025914 | Ga0207671_10001661 | Ga0207671_1000166120 | 94 |
| 274 | 3300025917 | Ga0207660_10242324 | Ga0207660_102423243 | 94 |
| 275 | 3300025920 | Ga0207649_10434596 | Ga0207649_104345962 | 94 |
| 276 | 3300025920 | Ga0207649_11015709 | Ga0207649_110157092 | 94 |
| 277 | 3300025921 | Ga0207652_10122515 | Ga0207652_101225152 | 94 |
| 278 | 3300025924 | Ga0207694_10284236 | Ga0207694_102842362 | 94 |
| 279 | 3300025924 | Ga0207694_10596242 | Ga0207694_105962422 | 94 |
| 280 | 3300025925 | Ga0207650_10652750 | Ga0207650_106527502 | 94 |
| 281 | 3300025926 | Ga0207659_10105800 | Ga0207659_101058002 | 94 |
| 282 | 3300025944 | Ga0207661_10009210 | Ga0207661_100092107 | 94 |
| 283 | 3300025949 | Ga0207667_10000270 | Ga0207667_1000027011 | 94 |
| 284 | 3300025949 | Ga0207667_10000445 | Ga0207667_1000044538 | 94 |
| 285 | 3300025960 | Ga0207651_10958492 | Ga0207651_109584922 | 94 |
| 286 | 3300025981 | Ga0207640_10006821 | Ga0207640_100068216 | 94 |
| 287 | 3300025981 | Ga0207640_10294711 | Ga0207640_102947112 | 94 |
| 288 | 3300025986 | Ga0207658_10380405 | Ga0207658_103804053 | 94 |
| 289 | 3300026041 | Ga0207639_10031875 | Ga0207639_100318752 | 94 |
| 290 | 3300026078 | Ga0207702_10162137 | Ga0207702_101621373 | 94 |
| 291 | 3300026078 | Ga0207702_11432715 | Ga0207702_114327151 | 94 |
| 292 | 3300026088 | Ga0207641_10395709 | Ga0207641_103957093 | 94 |
| 293 | 3300026089 | Ga0207648_10052560 | Ga0207648_100525603 | 94 |
| 294 | 3300026089 | Ga0207648_10178766 | Ga0207648_101787664 | 94 |
| 295 | 3300026116 | Ga0207674_10001573 | Ga0207674_1000157322 | 94 |
| 296 | 3300026142 | Ga0207698_10598549 | Ga0207698_105985492 | 94 |
| 297 | 3300026142 | Ga0207698_11147594 | Ga0207698_111475942 | 94 |
| 298 | 3300027876 | Ga0209974_10032756 | Ga0209974_100327563 | 94 |
| 299 | 3300028380 | Ga0268265_10389499 | Ga0268265_103894992 | 94 |
| 300 | 3300028381 | Ga0268264_10018324 | Ga0268264_100183245 | 94 |
| 301 | 3300028786 | Ga0307517_10507214 | Ga0307517_105072141 | 94 |
| 302 | 3300030521 | Ga0307511_10000509 | Ga0307511_1000050914 | 94 |
| 303 | 3300031852 | Ga0307410_11296601 | Ga0307410_112966011 | 94 |
| 304 | 3300033180 | Ga0307510_10002732 | Ga0307510_100027322 | 94 |
| 305 | 3300033180 | Ga0307510_10104605 | Ga0307510_101046053 | 94 |
| 306 | 3300039437 | Ga0436365_1777169 | Ga0436365_1777169_23414_23698 | 94 |
| 307 | 3300041452 | Ga0451793_1543048 | Ga0451793_1543048_36_320 | 94 |
| 308 | 3300046507 | Ga0495606_0005088 | Ga0495606_0005088_4576_4860 | 94 |
| 309 | 3300046648 | Ga0495611_0000079 | Ga0495611_0000079_40536_40820 | 94 |
| 310 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_90311_90595 | 94 |
| 311 | 3300048912 | Ga0496109_1820014 | Ga0496109_1820014_72_356 | 94 |
| 312 | 3300049570 | Ga0501033_0688616 | Ga0501033_0688616_87_371 | 94 |
| 313 | 3300049580 | Ga0501046_1026497 | Ga0501046_1026497_203_487 | 94 |
| 314 | 3300049581 | Ga0501047_1246314 | Ga0501047_1246314_65_349 | 94 |
| 315 | 3300049582 | Ga0501048_0616881 | Ga0501048_0616881_62_346 | 94 |
| 316 | 3300049583 | Ga0501067_0005028 | Ga0501067_0005028_1823_2107 | 94 |
| 317 | 3300049584 | Ga0501068_0216776 | Ga0501068_0216776_678_962 | 94 |
| 318 | 3300049585 | Ga0501069_0117805 | Ga0501069_0117805_554_838 | 94 |
| 319 | 3300049586 | Ga0501070_0075994 | Ga0501070_0075994_1770_2054 | 94 |
| 320 | 3300049588 | Ga0501072_0350103 | Ga0501072_0350103_831_1115 | 94 |
| 321 | 3300049589 | Ga0501073_0058667 | Ga0501073_0058667_2075_2359 | 94 |
| 322 | 3300049592 | Ga0501076_0153833 | Ga0501076_0153833_1292_1576 | 94 |
| 323 | 3300049656 | Ga0501209_269311 | Ga0501209_269311_122_409 | 94 |
| 324 | 3300049741 | Ga0501079_0101000 | Ga0501079_0101000_1144_1428 | 94 |
| 325 | 3300049744 | Ga0501083_0270470 | Ga0501083_0270470_715_999 | 94 |
| 326 | 3300049765 | Ga0501268_051824 | Ga0501268_051824_158_445 | 94 |
| 327 | 3300049767 | Ga0501270_067199 | Ga0501270_067199_276_563 | 94 |
| 328 | 3300050508 | nmdc:mga09592_38283_c1 | nmdc:mga09592_38283_c1_877_1164 | 94 |
| 329 | 3300050510 | nmdc:mga06r32_7793_c1 | nmdc:mga06r32_7793_c1_8312_8599 | 94 |
| 330 | 3300050511 | nmdc:mga08y16_64205_c1 | nmdc:mga08y16_64205_c1_1605_1892 | 94 |
| 331 | 3300053092 | Ga0500583_0206625 | Ga0500583_0206625_447_731 | 94 |
| 332 | 3300053129 | Ga0500628_247282 | Ga0500628_247282_218_502 | 94 |
| 333 | 3300053146 | Ga0500588_0079748 | Ga0500588_0079748_430_714 | 94 |
| 334 | 3300053178 | Ga0500637_0016380 | Ga0500637_0016380_653_937 | 94 |
| 335 | 3300054114 | Ga0501084_0039744 | Ga0501084_0039744_1760_2044 | 94 |
| 336 | 3300060353 | Ga0501082_0083200 | Ga0501082_0083200_1221_1505 | 94 |
| 337 | 3300005328 | Ga0070676_10729744 | Ga0070676_107297441 | 95 |
| 338 | 3300005334 | Ga0068869_100021181 | Ga0068869_1000211815 | 95 |
| 339 | 3300005335 | Ga0070666_10020916 | Ga0070666_100209164 | 95 |
| 340 | 3300005338 | Ga0068868_100459852 | Ga0068868_1004598521 | 95 |
| 341 | 3300005353 | Ga0070669_101140873 | Ga0070669_1011408731 | 95 |
| 342 | 3300005355 | Ga0070671_100091589 | Ga0070671_1000915894 | 95 |
| 343 | 3300005367 | Ga0070667_100012426 | Ga0070667_1000124267 | 95 |
| 344 | 3300005367 | Ga0070667_100331808 | Ga0070667_1003318082 | 95 |
| 345 | 3300005367 | Ga0070667_101562627 | Ga0070667_1015626271 | 95 |
| 346 | 3300005456 | Ga0070678_100074786 | Ga0070678_1000747862 | 95 |
| 347 | 3300005459 | Ga0068867_100077618 | Ga0068867_1000776181 | 95 |
| 348 | 3300005459 | Ga0068867_100104556 | Ga0068867_1001045562 | 95 |
| 349 | 3300005539 | Ga0068853_100200406 | Ga0068853_1002004062 | 95 |
| 350 | 3300005543 | Ga0070672_100357007 | Ga0070672_1003570071 | 95 |
| 351 | 3300005543 | Ga0070672_100659244 | Ga0070672_1006592443 | 95 |
| 352 | 3300005544 | Ga0070686_100554436 | Ga0070686_1005544361 | 95 |
| 353 | 3300005548 | Ga0070665_101258307 | Ga0070665_1012583072 | 95 |
| 354 | 3300005548 | Ga0070665_101833898 | Ga0070665_1018338981 | 95 |
| 355 | 3300005578 | Ga0068854_101223445 | Ga0068854_1012234452 | 95 |
| 356 | 3300005615 | Ga0070702_101578300 | Ga0070702_1015783001 | 95 |
| 357 | 3300005616 | Ga0068852_100999417 | Ga0068852_1009994172 | 95 |
| 358 | 3300005617 | Ga0068859_100974498 | Ga0068859_1009744982 | 95 |
| 359 | 3300005718 | Ga0068866_10017666 | Ga0068866_100176665 | 95 |
| 360 | 3300005718 | Ga0068866_10312573 | Ga0068866_103125732 | 95 |
| 361 | 3300005719 | Ga0068861_102471417 | Ga0068861_1024714171 | 95 |
| 362 | 3300005842 | Ga0068858_100147646 | Ga0068858_1001476462 | 95 |
| 363 | 3300005843 | Ga0068860_101076962 | Ga0068860_1010769622 | 95 |
| 364 | 3300006195 | Ga0075366_10694277 | Ga0075366_106942772 | 95 |
| 365 | 3300006237 | Ga0097621_100000427 | Ga0097621_10000042715 | 95 |
| 366 | 3300006358 | Ga0068871_100005204 | Ga0068871_1000052046 | 95 |
| 367 | 3300006931 | Ga0097620_100974348 | Ga0097620_1009743482 | 95 |
| 368 | 3300009148 | Ga0105243_10792888 | Ga0105243_107928883 | 95 |
| 369 | 3300009176 | Ga0105242_10078923 | Ga0105242_100789232 | 95 |
| 370 | 3300009176 | Ga0105242_10236935 | Ga0105242_102369353 | 95 |
| 371 | 3300009177 | Ga0105248_10215588 | Ga0105248_102155883 | 95 |
| 372 | 3300013296 | Ga0157374_10279670 | Ga0157374_102796704 | 95 |
| 373 | 3300013297 | Ga0157378_10015576 | Ga0157378_100155765 | 95 |
| 374 | 3300013297 | Ga0157378_10176468 | Ga0157378_101764683 | 95 |
| 375 | 3300013297 | Ga0157378_11479715 | Ga0157378_114797152 | 95 |
| 376 | 3300013306 | Ga0163162_10001002 | Ga0163162_1000100222 | 95 |
| 377 | 3300013308 | Ga0157375_10000186 | Ga0157375_1000018625 | 95 |
| 378 | 3300014968 | Ga0157379_10006059 | Ga0157379_100060594 | 95 |
| 379 | 3300014969 | Ga0157376_10000101 | Ga0157376_1000010147 | 95 |
| 380 | 3300017792 | Ga0163161_10016541 | Ga0163161_100165411 | 95 |
| 381 | 3300025899 | Ga0207642_10010211 | Ga0207642_100102112 | 95 |
| 382 | 3300025899 | Ga0207642_10243405 | Ga0207642_102434051 | 95 |
| 383 | 3300025903 | Ga0207680_10069908 | Ga0207680_100699082 | 95 |
| 384 | 3300025923 | Ga0207681_10276840 | Ga0207681_102768402 | 95 |
| 385 | 3300025931 | Ga0207644_10077904 | Ga0207644_100779042 | 95 |
| 386 | 3300025934 | Ga0207686_10052274 | Ga0207686_100522742 | 95 |
| 387 | 3300025934 | Ga0207686_10263922 | Ga0207686_102639222 | 95 |
| 388 | 3300025940 | Ga0207691_10717495 | Ga0207691_107174951 | 95 |
| 389 | 3300025942 | Ga0207689_10119101 | Ga0207689_101191012 | 95 |
| 390 | 3300025972 | Ga0207668_10182274 | Ga0207668_101822743 | 95 |
| 391 | 3300025981 | Ga0207640_10613544 | Ga0207640_106135441 | 95 |
| 392 | 3300025986 | Ga0207658_10022044 | Ga0207658_100220445 | 95 |
| 393 | 3300026035 | Ga0207703_10216645 | Ga0207703_102166452 | 95 |
| 394 | 3300026067 | Ga0207678_11177985 | Ga0207678_111779851 | 95 |
| 395 | 3300026089 | Ga0207648_10023926 | Ga0207648_100239265 | 95 |
| 396 | 3300026089 | Ga0207648_10122941 | Ga0207648_101229412 | 95 |
| 397 | 3300026118 | Ga0207675_100514416 | Ga0207675_1005144163 | 95 |
| 398 | 3300041443 | Ga0451789_0151170 | Ga0451789_0151170_214_501 | 95 |
| 399 | 3300042007 | Ga0439449_0375570 | Ga0439449_0375570_59_346 | 95 |
| 400 | 3300042876 | Ga0451577_0170800 | Ga0451577_0170800_717_1004 | 95 |
| 401 | 3300044712 | Ga0453684_0295910 | Ga0453684_0295910_75_362 | 95 |
| 402 | 3300048904 | Ga0496101_0030909 | Ga0496101_0030909_2119_2406 | 95 |
| 403 | 3300048909 | Ga0496106_0046633 | Ga0496106_0046633_2014_2301 | 95 |
| 404 | 3300048917 | Ga0496114_0104385 | Ga0496114_0104385_1522_1809 | 95 |
| 405 | 3300049569 | Ga0501032_0006965 | Ga0501032_0006965_2836_3126 | 95 |
| 406 | 3300049570 | Ga0501033_0011263 | Ga0501033_0011263_1699_1989 | 95 |
| 407 | 3300049571 | Ga0501034_0001891 | Ga0501034_0001891_11881_12171 | 95 |
| 408 | 3300049571 | Ga0501034_0024251 | Ga0501034_0024251_3096_3383 | 95 |
| 409 | 3300049571 | Ga0501034_0609167 | Ga0501034_0609167_369_659 | 95 |
| 410 | 3300049572 | Ga0501036_0289209 | Ga0501036_0289209_442_732 | 95 |
| 411 | 3300049573 | Ga0501037_0004781 | Ga0501037_0004781_4862_5152 | 95 |
| 412 | 3300049573 | Ga0501037_0215761 | Ga0501037_0215761_720_1007 | 95 |
| 413 | 3300049574 | Ga0501038_0513286 | Ga0501038_0513286_301_591 | 95 |
| 414 | 3300049579 | Ga0501043_0019373 | Ga0501043_0019373_2407_2697 | 95 |
| 415 | 3300049579 | Ga0501043_0442803 | Ga0501043_0442803_217_507 | 95 |
| 416 | 3300049581 | Ga0501047_0003037 | Ga0501047_0003037_11390_11680 | 95 |
| 417 | 3300049590 | Ga0501074_0753985 | Ga0501074_0753985_104_391 | 95 |
| 418 | 3300049822 | Ga0501035_0014156 | Ga0501035_0014156_2645_2935 | 95 |
| 419 | 3300049822 | Ga0501035_0615308 | Ga0501035_0615308_526_813 | 95 |
| 420 | 3300049823 | Ga0501044_0004145 | Ga0501044_0004145_1740_2030 | 95 |
| 421 | 3300049823 | Ga0501044_0005264 | Ga0501044_0005264_13784_14071 | 95 |
| 422 | 3300049823 | Ga0501044_1005732 | Ga0501044_1005732_119_406 | 95 |
| 423 | 3300050493 | nmdc:mga0k408_343249_c1 | nmdc:mga0k408_343249_c1_552_839 | 95 |
| 424 | 3300003316 | rootH1_10070623 | rootH1_100706234 | 96 |
| 425 | 3300003320 | rootH2_10111024 | rootH2_101110249 | 96 |
| 426 | 3300003322 | rootL2_10378854 | rootL2_103788541 | 96 |
| 427 | 3300003323 | rootH1_10015941 | rootH1_1001594119 | 96 |
| 428 | 3300003323 | rootH1_10068884 | rootH1_100688842 | 96 |
| 429 | 3300003323 | rootH1_10068885 | rootH1_100688853 | 96 |
| 430 | 3300005328 | Ga0070676_10036554 | Ga0070676_100365544 | 96 |
| 431 | 3300005329 | Ga0070683_101874058 | Ga0070683_1018740581 | 96 |
| 432 | 3300005331 | Ga0070670_100154741 | Ga0070670_1001547412 | 96 |
| 433 | 3300005331 | Ga0070670_100846495 | Ga0070670_1008464951 | 96 |
| 434 | 3300005335 | Ga0070666_10248842 | Ga0070666_102488422 | 96 |
| 435 | 3300005347 | Ga0070668_102121622 | Ga0070668_1021216221 | 96 |
| 436 | 3300005355 | Ga0070671_100243705 | Ga0070671_1002437051 | 96 |
| 437 | 3300005356 | Ga0070674_100768031 | Ga0070674_1007680311 | 96 |
| 438 | 3300005364 | Ga0070673_101715803 | Ga0070673_1017158031 | 96 |
| 439 | 3300005437 | Ga0070710_10558960 | Ga0070710_105589601 | 96 |
| 440 | 3300005455 | Ga0070663_100263880 | Ga0070663_1002638802 | 96 |
| 441 | 3300005456 | Ga0070678_100277927 | Ga0070678_1002779273 | 96 |
| 442 | 3300005457 | Ga0070662_101150742 | Ga0070662_1011507422 | 96 |
| 443 | 3300005459 | Ga0068867_100081775 | Ga0068867_1000817753 | 96 |
| 444 | 3300005459 | Ga0068867_100249900 | Ga0068867_1002499004 | 96 |
| 445 | 3300005459 | Ga0068867_102310520 | Ga0068867_1023105201 | 96 |
| 446 | 3300005539 | Ga0068853_100080995 | Ga0068853_1000809953 | 96 |
| 447 | 3300005539 | Ga0068853_101474469 | Ga0068853_1014744691 | 96 |
| 448 | 3300005543 | Ga0070672_100048947 | Ga0070672_1000489472 | 96 |
| 449 | 3300005543 | Ga0070672_100332958 | Ga0070672_1003329582 | 96 |
| 450 | 3300005563 | Ga0068855_100007114 | Ga0068855_10000711415 | 96 |
| 451 | 3300005564 | Ga0070664_101029227 | Ga0070664_1010292272 | 96 |
| 452 | 3300005577 | Ga0068857_100239428 | Ga0068857_1002394282 | 96 |
| 453 | 3300005614 | Ga0068856_100004623 | Ga0068856_10000462312 | 96 |
| 454 | 3300005616 | Ga0068852_100539884 | Ga0068852_1005398841 | 96 |
| 455 | 3300005616 | Ga0068852_102041184 | Ga0068852_1020411841 | 96 |
| 456 | 3300005616 | Ga0068852_102202948 | Ga0068852_1022029481 | 96 |
| 457 | 3300005618 | Ga0068864_100147461 | Ga0068864_1001474612 | 96 |
| 458 | 3300005618 | Ga0068864_100215546 | Ga0068864_1002155462 | 96 |
| 459 | 3300005719 | Ga0068861_101592253 | Ga0068861_1015922531 | 96 |
| 460 | 3300005840 | Ga0068870_10355160 | Ga0068870_103551603 | 96 |
| 461 | 3300005841 | Ga0068863_100542225 | Ga0068863_1005422253 | 96 |
| 462 | 3300005841 | Ga0068863_101006800 | Ga0068863_1010068001 | 96 |
| 463 | 3300005843 | Ga0068860_100001323 | Ga0068860_1000013237 | 96 |
| 464 | 3300005843 | Ga0068860_100030211 | Ga0068860_1000302114 | 96 |
| 465 | 3300005843 | Ga0068860_100331406 | Ga0068860_1003314063 | 96 |
| 466 | 3300006195 | Ga0075366_10129343 | Ga0075366_101293432 | 96 |
| 467 | 3300006195 | Ga0075366_10301876 | Ga0075366_103018762 | 96 |
| 468 | 3300006195 | Ga0075366_10761823 | Ga0075366_107618232 | 96 |
| 469 | 3300006237 | Ga0097621_100796894 | Ga0097621_1007968941 | 96 |
| 470 | 3300006237 | Ga0097621_101888816 | Ga0097621_1018888161 | 96 |
| 471 | 3300006353 | Ga0075370_10806042 | Ga0075370_108060421 | 96 |
| 472 | 3300006358 | Ga0068871_100021743 | Ga0068871_1000217433 | 96 |
| 473 | 3300006358 | Ga0068871_100348038 | Ga0068871_1003480381 | 96 |
| 474 | 3300009093 | Ga0105240_10503751 | Ga0105240_105037513 | 96 |
| 475 | 3300009094 | Ga0111539_12679931 | Ga0111539_126799311 | 96 |
| 476 | 3300009147 | Ga0114129_10001029 | Ga0114129_1000102924 | 96 |
| 477 | 3300009174 | Ga0105241_10015527 | Ga0105241_100155275 | 96 |
| 478 | 3300009174 | Ga0105241_10651034 | Ga0105241_106510341 | 96 |
| 479 | 3300009545 | Ga0105237_10111962 | Ga0105237_101119621 | 96 |
| 480 | 3300009553 | Ga0105249_10000349 | Ga0105249_1000034944 | 96 |
| 481 | 3300009553 | Ga0105249_10156150 | Ga0105249_101561503 | 96 |
| 482 | 3300010375 | Ga0105239_10289194 | Ga0105239_102891943 | 96 |
| 483 | 3300010375 | Ga0105239_10560562 | Ga0105239_105605621 | 96 |
| 484 | 3300010375 | Ga0105239_13644838 | Ga0105239_136448381 | 96 |
| 485 | 3300011119 | Ga0105246_10887371 | Ga0105246_108873712 | 96 |
| 486 | 3300013100 | Ga0157373_11013944 | Ga0157373_110139442 | 96 |
| 487 | 3300013104 | Ga0157370_11684750 | Ga0157370_116847502 | 96 |
| 488 | 3300013105 | Ga0157369_11161193 | Ga0157369_111611931 | 96 |
| 489 | 3300013296 | Ga0157374_10251304 | Ga0157374_102513041 | 96 |
| 490 | 3300013296 | Ga0157374_10972355 | Ga0157374_109723551 | 96 |
| 491 | 3300013306 | Ga0163162_10002343 | Ga0163162_1000234310 | 96 |
| 492 | 3300013306 | Ga0163162_11197459 | Ga0163162_111974592 | 96 |
| 493 | 3300013307 | Ga0157372_10854654 | Ga0157372_108546542 | 96 |
| 494 | 3300013307 | Ga0157372_10996772 | Ga0157372_109967722 | 96 |
| 495 | 3300013307 | Ga0157372_12397438 | Ga0157372_123974381 | 96 |
| 496 | 3300013307 | Ga0157372_13146468 | Ga0157372_131464681 | 96 |
| 497 | 3300013308 | Ga0157375_10310507 | Ga0157375_103105071 | 96 |
| 498 | 3300014326 | Ga0157380_10249246 | Ga0157380_102492461 | 96 |
| 499 | 3300014326 | Ga0157380_12983045 | Ga0157380_129830451 | 96 |
| 500 | 3300014745 | Ga0157377_10141335 | Ga0157377_101413351 | 96 |
| 501 | 3300015261 | Ga0182006_1193940 | Ga0182006_11939401 | 96 |
| 502 | 3300025242 | Ga0209258_116824 | Ga0209258_1168242 | 96 |
| 503 | 3300025246 | Ga0209646_1004961 | Ga0209646_10049614 | 96 |
| 504 | 3300025908 | Ga0207643_10145614 | Ga0207643_101456142 | 96 |
| 505 | 3300025911 | Ga0207654_10051471 | Ga0207654_100514712 | 96 |
| 506 | 3300025913 | Ga0207695_10730028 | Ga0207695_107300282 | 96 |
| 507 | 3300025914 | Ga0207671_10150150 | Ga0207671_101501501 | 96 |
| 508 | 3300025916 | Ga0207663_11420920 | Ga0207663_114209202 | 96 |
| 509 | 3300025923 | Ga0207681_11127383 | Ga0207681_111273831 | 96 |
| 510 | 3300025925 | Ga0207650_10127474 | Ga0207650_101274742 | 96 |
| 511 | 3300025925 | Ga0207650_10153052 | Ga0207650_101530522 | 96 |
| 512 | 3300025926 | Ga0207659_10452958 | Ga0207659_104529582 | 96 |
| 513 | 3300025931 | Ga0207644_10124235 | Ga0207644_101242352 | 96 |
| 514 | 3300025937 | Ga0207669_10401549 | Ga0207669_104015493 | 96 |
| 515 | 3300025938 | Ga0207704_10466975 | Ga0207704_104669752 | 96 |
| 516 | 3300025940 | Ga0207691_10033525 | Ga0207691_100335253 | 96 |
| 517 | 3300025942 | Ga0207689_10392348 | Ga0207689_103923483 | 96 |
| 518 | 3300025945 | Ga0207679_12096722 | Ga0207679_120967221 | 96 |
| 519 | 3300025949 | Ga0207667_10019461 | Ga0207667_100194616 | 96 |
| 520 | 3300025961 | Ga0207712_10004215 | Ga0207712_100042152 | 96 |
| 521 | 3300025961 | Ga0207712_10095109 | Ga0207712_100951092 | 96 |
| 522 | 3300025972 | Ga0207668_11720440 | Ga0207668_117204402 | 96 |
| 523 | 3300025981 | Ga0207640_11334486 | Ga0207640_113344861 | 96 |
| 524 | 3300026041 | Ga0207639_10053121 | Ga0207639_100531213 | 96 |
| 525 | 3300026041 | Ga0207639_11031768 | Ga0207639_110317682 | 96 |
| 526 | 3300026041 | Ga0207639_12306295 | Ga0207639_123062952 | 96 |
| 527 | 3300026067 | Ga0207678_10329049 | Ga0207678_103290491 | 96 |
| 528 | 3300026078 | Ga0207702_10197512 | Ga0207702_101975121 | 96 |
| 529 | 3300026088 | Ga0207641_10025588 | Ga0207641_100255886 | 96 |
| 530 | 3300026088 | Ga0207641_10373000 | Ga0207641_103730003 | 96 |
| 531 | 3300026088 | Ga0207641_10904047 | Ga0207641_109040472 | 96 |
| 532 | 3300026089 | Ga0207648_10023153 | Ga0207648_100231535 | 96 |
| 533 | 3300026089 | Ga0207648_10365359 | Ga0207648_103653591 | 96 |
| 534 | 3300026089 | Ga0207648_10399288 | Ga0207648_103992882 | 96 |
| 535 | 3300026095 | Ga0207676_10259123 | Ga0207676_102591234 | 96 |
| 536 | 3300026095 | Ga0207676_11463483 | Ga0207676_114634832 | 96 |
| 537 | 3300026095 | Ga0207676_11523448 | Ga0207676_115234481 | 96 |
| 538 | 3300026116 | Ga0207674_10069258 | Ga0207674_100692585 | 96 |
| 539 | 3300026116 | Ga0207674_10752839 | Ga0207674_107528393 | 96 |
| 540 | 3300026118 | Ga0207675_100256249 | Ga0207675_1002562494 | 96 |
| 541 | 3300026118 | Ga0207675_101333339 | Ga0207675_1013333391 | 96 |
| 542 | 3300026118 | Ga0207675_102330024 | Ga0207675_1023300241 | 96 |
| 543 | 3300026121 | Ga0207683_10243011 | Ga0207683_102430112 | 96 |
| 544 | 3300026142 | Ga0207698_10313756 | Ga0207698_103137563 | 96 |
| 545 | 3300028381 | Ga0268264_10008251 | Ga0268264_100082516 | 96 |
| 546 | 3300028381 | Ga0268264_10046776 | Ga0268264_100467762 | 96 |
| 547 | 3300028381 | Ga0268264_10819251 | Ga0268264_108192512 | 96 |
| 548 | 3300031251 | Ga0265327_10115167 | Ga0265327_101151672 | 96 |
| 549 | 3300031456 | Ga0307513_10645887 | Ga0307513_106458872 | 96 |
| 550 | 3300031824 | Ga0307413_10610866 | Ga0307413_106108661 | 96 |
| 551 | 3300032005 | Ga0307411_11391725 | Ga0307411_113917252 | 96 |
| 552 | 3300035695 | Ga0373927_1199713 | Ga0373927_1199713_38_328 | 96 |
| 553 | 3300041404 | Ga0439436_0000727 | Ga0439436_0000727_3112_3447 | 96 |
| 554 | 3300041406 | Ga0439439_0013927 | Ga0439439_0013927_1380_1715 | 96 |
| 555 | 3300041406 | Ga0439439_0076545 | Ga0439439_0076545_479_808 | 96 |
| 556 | 3300041459 | Ga0451800_1122242 | Ga0451800_1122242_222_512 | 96 |
| 557 | 3300041486 | Ga0451807_0297254 | Ga0451807_0297254_58_363 | 96 |
| 558 | 3300041498 | Ga0451841_1070416 | Ga0451841_1070416_86_376 | 96 |
| 559 | 3300041507 | Ga0451851_0769739 | Ga0451851_0769739_210_500 | 96 |
| 560 | 3300041512 | Ga0451853_1888255 | Ga0451853_1888255_327_617 | 96 |
| 561 | 3300042007 | Ga0439449_0019598 | Ga0439449_0019598_650_979 | 96 |
| 562 | 3300042007 | Ga0439449_0238131 | Ga0439449_0238131_286_621 | 96 |
| 563 | 3300042014 | Ga0439457_031465 | Ga0439457_031465_556_891 | 96 |
| 564 | 3300042015 | Ga0439462_0000406 | Ga0439462_0000406_5432_5767 | 96 |
| 565 | 3300044656 | Ga0466969_0000004 | Ga0466969_0000004_152019_152348 | 96 |
| 566 | 3300044656 | Ga0466969_0091596 | Ga0466969_0091596_300_629 | 96 |
| 567 | 3300044658 | Ga0466972_0000395 | Ga0466972_0000395_4417_4707 | 96 |
| 568 | 3300044658 | Ga0466972_0107997 | Ga0466972_0107997_924_1214 | 96 |
| 569 | 3300044684 | Ga0466966_0104212 | Ga0466966_0104212_928_1257 | 96 |
| 570 | 3300044693 | Ga0466961_0432779 | Ga0466961_0432779_342_671 | 96 |
| 571 | 3300044706 | Ga0466964_0043385 | Ga0466964_0043385_1295_1624 | 96 |
| 572 | 3300044719 | Ga0466971_0580598 | Ga0466971_0580598_11_340 | 96 |
| 573 | 3300044735 | Ga0466968_0036066 | Ga0466968_0036066_709_1038 | 96 |
| 574 | 3300044842 | Ga0466957_0004957 | Ga0466957_0004957_594_884 | 96 |
| 575 | 3300044842 | Ga0466957_0046684 | Ga0466957_0046684_1130_1420 | 96 |
| 576 | 3300044901 | Ga0466960_0325194 | Ga0466960_0325194_441_731 | 96 |
| 577 | 3300045049 | Ga0466959_0000004 | Ga0466959_0000004_115599_115928 | 96 |
| 578 | 3300046519 | Ga0495632_0471791 | Ga0495632_0471791_187_522 | 96 |
| 579 | 3300046616 | Ga0495668_0000685 | Ga0495668_0000685_26009_26302 | 96 |
| 580 | 3300046660 | Ga0495625_0911790 | Ga0495625_0911790_116_406 | 96 |
| 581 | 3300047472 | Ga0495686_0628074 | Ga0495686_0628074_246_536 | 96 |
| 582 | 3300049569 | Ga0501032_0038126 | Ga0501032_0038126_329_625 | 96 |
| 583 | 3300049570 | Ga0501033_0926165 | Ga0501033_0926165_258_554 | 96 |
| 584 | 3300049571 | Ga0501034_0111926 | Ga0501034_0111926_1275_1571 | 96 |
| 585 | 3300049572 | Ga0501036_0030850 | Ga0501036_0030850_2861_3157 | 96 |
| 586 | 3300049573 | Ga0501037_0007419 | Ga0501037_0007419_1181_1477 | 96 |
| 587 | 3300049574 | Ga0501038_0030182 | Ga0501038_0030182_2731_3027 | 96 |
| 588 | 3300049574 | Ga0501038_0665501 | Ga0501038_0665501_353_649 | 96 |
| 589 | 3300049575 | Ga0501039_0095622 | Ga0501039_0095622_1937_2233 | 96 |
| 590 | 3300049579 | Ga0501043_0009692 | Ga0501043_0009692_4792_5088 | 96 |
| 591 | 3300049579 | Ga0501043_0780700 | Ga0501043_0780700_349_645 | 96 |
| 592 | 3300049580 | Ga0501046_0003336 | Ga0501046_0003336_2239_2535 | 96 |
| 593 | 3300049581 | Ga0501047_0002513 | Ga0501047_0002513_242_538 | 96 |
| 594 | 3300049582 | Ga0501048_0101204 | Ga0501048_0101204_335_631 | 96 |
| 595 | 3300049583 | Ga0501067_0002016 | Ga0501067_0002016_1217_1513 | 96 |
| 596 | 3300049584 | Ga0501068_0088935 | Ga0501068_0088935_1135_1431 | 96 |
| 597 | 3300049590 | Ga0501074_0005676 | Ga0501074_0005676_1275_1571 | 96 |
| 598 | 3300049593 | Ga0501077_0865200 | Ga0501077_0865200_43_339 | 96 |
| 599 | 3300049687 | Ga0501258_069604 | Ga0501258_069604_60_389 | 96 |
| 600 | 3300049703 | Ga0501219_000066 | Ga0501219_000066_6511_6846 | 96 |
| 601 | 3300049741 | Ga0501079_0302360 | Ga0501079_0302360_268_564 | 96 |
| 602 | 3300049744 | Ga0501083_0007950 | Ga0501083_0007950_6828_7124 | 96 |
| 603 | 3300049758 | Ga0501241_018782 | Ga0501241_018782_174_509 | 96 |
| 604 | 3300049822 | Ga0501035_0065490 | Ga0501035_0065490_250_546 | 96 |
| 605 | 3300049822 | Ga0501035_0795376 | Ga0501035_0795376_388_720 | 96 |
| 606 | 3300049823 | Ga0501044_0004121 | Ga0501044_0004121_2650_2946 | 96 |
| 607 | 3300049824 | Ga0501045_0629780 | Ga0501045_0629780_197_493 | 96 |
| 608 | 3300050005 | Ga0501284_00018 | Ga0501284_00018_11707_12042 | 96 |
| 609 | 3300050493 | nmdc:mga0k408_353356_c1 | nmdc:mga0k408_353356_c1_28_357 | 96 |
| 610 | 3300050493 | nmdc:mga0k408_630225_c1 | nmdc:mga0k408_630225_c1_262_552 | 96 |
| 611 | 3300050507 | nmdc:mga05p37_1343_c1 | nmdc:mga05p37_1343_c1_8801_9136 | 96 |
| 612 | 3300053086 | Ga0500578_0000037 | Ga0500578_0000037_33784_34074 | 96 |
| 613 | 3300053086 | Ga0500578_0253116 | Ga0500578_0253116_67_357 | 96 |
| 614 | 3300053088 | Ga0500644_0051565 | Ga0500644_0051565_910_1239 | 96 |
| 615 | 3300053090 | Ga0500646_0009166 | Ga0500646_0009166_2032_2322 | 96 |
| 616 | 3300053092 | Ga0500583_0000089 | Ga0500583_0000089_28020_28355 | 96 |
| 617 | 3300053092 | Ga0500583_0006034 | Ga0500583_0006034_1448_1738 | 96 |
| 618 | 3300053093 | Ga0500651_0378178 | Ga0500651_0378178_142_471 | 96 |
| 619 | 3300053103 | Ga0500555_016078 | Ga0500555_016078_1323_1652 | 96 |
| 620 | 3300053104 | Ga0500556_0086798 | Ga0500556_0086798_306_635 | 96 |
| 621 | 3300053130 | Ga0500642_0064098 | Ga0500642_0064098_979_1269 | 96 |
| 622 | 3300053134 | Ga0500658_0126247 | Ga0500658_0126247_305_595 | 96 |
| 623 | 3300053136 | Ga0500559_0059922 | Ga0500559_0059922_710_1000 | 96 |
| 624 | 3300053136 | Ga0500559_0467521 | Ga0500559_0467521_63_353 | 96 |
| 625 | 3300053137 | Ga0500561_0134710 | Ga0500561_0134710_44_334 | 96 |
| 626 | 3300053147 | Ga0500589_049400 | Ga0500589_049400_639_929 | 96 |
| 627 | 3300053147 | Ga0500589_209137 | Ga0500589_209137_391_720 | 96 |
| 628 | 3300053151 | Ga0500604_0127854 | Ga0500604_0127854_34_324 | 96 |
| 629 | 3300053156 | Ga0500622_0033454 | Ga0500622_0033454_2308_2598 | 96 |
| 630 | 3300053160 | Ga0500633_0186406 | Ga0500633_0186406_208_498 | 96 |
| 631 | 3300053163 | Ga0500639_048361 | Ga0500639_048361_255_545 | 96 |
| 632 | 3300053177 | Ga0500636_0035574 | Ga0500636_0035574_924_1214 | 96 |
| 633 | 3300053177 | Ga0500636_0069011 | Ga0500636_0069011_1257_1547 | 96 |
| 634 | 3300053178 | Ga0500637_0279934 | Ga0500637_0279934_56_346 | 96 |
| 635 | 3300053178 | Ga0500637_0410391 | Ga0500637_0410391_170_460 | 96 |
| 636 | 3300053727 | Ga0500611_009565 | Ga0500611_009565_462_752 | 96 |
| 637 | 3300061719 | Ga0466962_0396685 | Ga0466962_0396685_340_669 | 96 |
| 638 | 2088090003 | LJN_F7QKVOU01D7WOY | LJN_03667110 | 97 |
| 639 | 3300044712 | Ga0453684_0335704 | Ga0453684_0335704_655_957 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar