F471605

General Info

Members Datasets Scaffolds Average Seq Length
639 282 638 96

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10001029|Ga0114129_1000102924
Length 111
Sequence MCVDKNRTTISKLQAMEELIPINVLIGDRTYRIRISPTDEEVVRKTLKLINDKIIEFKTTFAGKDMQDYVAMVVLWYATQQKAGDSQPLVDNETGEQIQAIEKLLDRMLLD

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
241 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
242 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
246 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
247 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
276 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.16
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 0
Rhizoplane 1.56
Rhizosphere 87.64
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01D7WOY 2088090003 Unclassified 501
2 rootH1_10070623 3300003316 Bacteria 2081
3 rootH1_10103792 3300003316 Bacteria 1492
4 rootH2_10002129 3300003320 Bacteria 15324
5 rootH2_10014840 3300003320 Bacteria 5335
6 rootH2_10020813 3300003320 Bacteria 17478
7 rootH2_10052864 3300003320 Bacteria 1505
8 rootH2_10111024 3300003320 Bacteria 7865
9 rootL2_10378854 3300003322 Bacteria 1390
10 rootH1_10015941 3300003323 Bacteria 21181
11 rootH1_10068884 3300003323 Bacteria 2117
12 rootH1_10068885 3300003323 Bacteria 1528
13 rootH1_10332917 3300003323 Bacteria 1531
14 JGI25404J52841_10081937 3300003659 Bacteria 674
15 Ga0065714_10287823 3300005288 Bacteria 713
16 Ga0065712_10103457 3300005290 Bacteria 1984
17 Ga0065712_10196191 3300005290 Bacteria 1127
18 Ga0065712_10553212 3300005290 Unclassified 616
19 Ga0070658_10011212 3300005327 Bacteria 7183
20 Ga0070658_10751327 3300005327 Bacteria 847
21 Ga0070676_10000238 3300005328 Bacteria 23718
22 Ga0070676_10036554 3300005328 Bacteria 2830
23 Ga0070676_10389533 3300005328 Unclassified 967
24 Ga0070676_10729744 3300005328 Bacteria 726
25 Ga0070683_101874058 3300005329 Unclassified 576
26 Ga0070690_100236633 3300005330 Bacteria 1286
27 Ga0070670_100154741 3300005331 Bacteria 1985
28 Ga0070670_100445216 3300005331 Unclassified 1147
29 Ga0070670_100778397 3300005331 Unclassified 863
30 Ga0070670_100798344 3300005331 Bacteria 852
31 Ga0070670_100846495 3300005331 Unclassified 827
32 Ga0068869_100021181 3300005334 Unclassified 4469
33 Ga0068869_100110204 3300005334 Bacteria 2093
34 Ga0070666_10001496 3300005335 Bacteria 14201
35 Ga0070666_10020916 3300005335 Bacteria 4236
36 Ga0070666_10248842 3300005335 Bacteria 1258
37 Ga0070680_100308915 3300005336 Bacteria 1341
38 Ga0070682_100000393 3300005337 Bacteria 29135
39 Ga0070682_100334817 3300005337 Bacteria 1123
40 Ga0068868_100001065 3300005338 Bacteria 18795
41 Ga0068868_100089776 3300005338 Bacteria 2474
42 Ga0068868_100459852 3300005338 Bacteria 1108
43 Ga0070660_100617455 3300005339 Bacteria 907
44 Ga0070689_100714994 3300005340 Bacteria 875
45 Ga0070691_10670626 3300005341 Bacteria 619
46 Ga0070661_101204583 3300005344 Bacteria 633
47 Ga0070668_100003447 3300005347 Bacteria 11678
48 Ga0070668_102121622 3300005347 Unclassified 519
49 Ga0070669_100043329 3300005353 Bacteria 3277
50 Ga0070669_101140873 3300005353 Unclassified 672
51 Ga0070675_100024172 3300005354 Unclassified 4866
52 Ga0070675_100251913 3300005354 Unclassified 1546
53 Ga0070671_100091589 3300005355 Bacteria 2547
54 Ga0070671_100243705 3300005355 Bacteria 1526
55 Ga0070674_100595813 3300005356 Unclassified 933
56 Ga0070674_100768031 3300005356 Bacteria 830
57 Ga0070673_100001402 3300005364 Bacteria 14099
58 Ga0070673_100834923 3300005364 Unclassified 852
59 Ga0070673_101715803 3300005364 Bacteria 594
60 Ga0070688_100266026 3300005365 Unclassified 1226
61 Ga0070688_100470671 3300005365 Bacteria 943
62 Ga0070659_100755167 3300005366 Unclassified 844
63 Ga0070667_100001589 3300005367 Bacteria 20342
64 Ga0070667_100012426 3300005367 Bacteria 7046
65 Ga0070667_100331808 3300005367 Bacteria 1374
66 Ga0070667_101562627 3300005367 Unclassified 620
67 Ga0070710_10558960 3300005437 Bacteria 791
68 Ga0070711_101780656 3300005439 Bacteria 540
69 Ga0070663_100263880 3300005455 Bacteria 1367
70 Ga0070678_100074786 3300005456 Bacteria 2547
71 Ga0070678_100277927 3300005456 Bacteria 1415
72 Ga0070678_100292701 3300005456 Bacteria 1381
73 Ga0070662_101150742 3300005457 Bacteria 666
74 Ga0070662_101448592 3300005457 Unclassified 592
75 Ga0070681_10039915 3300005458 Bacteria 4706
76 Ga0070681_10734170 3300005458 Bacteria 904
77 Ga0070681_11075410 3300005458 Bacteria 725
78 Ga0068867_100003608 3300005459 Bacteria 10887
79 Ga0068867_100077618 3300005459 Bacteria 2496
80 Ga0068867_100081775 3300005459 Bacteria 2436
81 Ga0068867_100104556 3300005459 Bacteria 2167
82 Ga0068867_100120537 3300005459 Bacteria 2027
83 Ga0068867_100249900 3300005459 Bacteria 1442
84 Ga0068867_102310520 3300005459 Bacteria 511
85 Ga0070685_10180536 3300005466 Bacteria 1358
86 Ga0070679_100110609 3300005530 Bacteria 2734
87 Ga0070684_101338620 3300005535 Bacteria 674
88 Ga0070697_101980970 3300005536 Bacteria 521
89 Ga0068853_100001266 3300005539 Bacteria 18098
90 Ga0068853_100001323 3300005539 Bacteria 17818
91 Ga0068853_100080995 3300005539 Bacteria 2842
92 Ga0068853_100125341 3300005539 Bacteria 2294
93 Ga0068853_100200406 3300005539 Bacteria 1816
94 Ga0068853_101474469 3300005539 Bacteria 659
95 Ga0070672_100008059 3300005543 Bacteria 7198
96 Ga0070672_100048947 3300005543 Bacteria 3287
97 Ga0070672_100332958 3300005543 Bacteria 1292
98 Ga0070672_100357007 3300005543 Unclassified 1247
99 Ga0070672_100659244 3300005543 Bacteria 914
100 Ga0070672_100689907 3300005543 Bacteria 894
101 Ga0070672_101201388 3300005543 Unclassified 676
102 Ga0070686_100554436 3300005544 Bacteria 899
103 Ga0070665_100000018 3300005548 Bacteria 434118
104 Ga0070665_100551063 3300005548 Bacteria 1165
105 Ga0070665_101258307 3300005548 Unclassified 750
106 Ga0070665_101833898 3300005548 Unclassified 613
107 Ga0070704_101693036 3300005549 Bacteria 584
108 Ga0068855_100006123 3300005563 Bacteria 14673
109 Ga0068855_100007114 3300005563 Bacteria 13574
110 Ga0068855_100039314 3300005563 Bacteria 5616
111 Ga0068855_100042044 3300005563 Bacteria 5416
112 Ga0070664_101029227 3300005564 Bacteria 774
113 Ga0068857_100000308 3300005577 Bacteria 33921
114 Ga0068857_100239428 3300005577 Bacteria 1661
115 Ga0068854_100217084 3300005578 Bacteria 1511
116 Ga0068854_100251591 3300005578 Bacteria 1411
117 Ga0068854_101223445 3300005578 Bacteria 674
118 Ga0068854_101231842 3300005578 Bacteria 671
119 Ga0068856_100004623 3300005614 Bacteria 13669
120 Ga0068856_100029852 3300005614 Bacteria 5328
121 Ga0068856_100194324 3300005614 Bacteria 2043
122 Ga0068856_101719051 3300005614 Bacteria 640
123 Ga0070702_101578300 3300005615 Bacteria 542
124 Ga0068852_100000902 3300005616 Bacteria 19654
125 Ga0068852_100075858 3300005616 Bacteria 2967
126 Ga0068852_100539884 3300005616 Bacteria 1165
127 Ga0068852_100999417 3300005616 Bacteria 855
128 Ga0068852_101192781 3300005616 Bacteria 782
129 Ga0068852_101956384 3300005616 Bacteria 608
130 Ga0068852_102041184 3300005616 Bacteria 595
131 Ga0068852_102202948 3300005616 Bacteria 573
132 Ga0068859_100236208 3300005617 Bacteria 1917
133 Ga0068859_100959009 3300005617 Bacteria 938
134 Ga0068859_100974498 3300005617 Unclassified 931
135 Ga0068859_102666392 3300005617 Unclassified 549
136 Ga0068864_100001339 3300005618 Bacteria 20471
137 Ga0068864_100147461 3300005618 Bacteria 2128
138 Ga0068864_100215546 3300005618 Bacteria 1770
139 Ga0068866_10017666 3300005718 Unclassified 3212
140 Ga0068866_10312573 3300005718 Bacteria 985
141 Ga0068861_100147948 3300005719 Bacteria 1924
142 Ga0068861_101167616 3300005719 Unclassified 743
143 Ga0068861_101366400 3300005719 Bacteria 691
144 Ga0068861_101592253 3300005719 Bacteria 643
145 Ga0068861_102471417 3300005719 Unclassified 523
146 Ga0068851_10000433 3300005834 Bacteria 18684
147 Ga0068851_10032370 3300005834 Bacteria 2602
148 Ga0068851_10679138 3300005834 Bacteria 632
149 Ga0068870_10355160 3300005840 Bacteria 942
150 Ga0068870_10991859 3300005840 Unclassified 598
151 Ga0068863_100015219 3300005841 Bacteria 7392
152 Ga0068863_100542225 3300005841 Bacteria 1148
153 Ga0068863_101006800 3300005841 Bacteria 836
154 Ga0068858_100018401 3300005842 Bacteria 6540
155 Ga0068858_100147646 3300005842 Bacteria 2209
156 Ga0068860_100001323 3300005843 Bacteria 26880
157 Ga0068860_100004955 3300005843 Bacteria 13573
158 Ga0068860_100017463 3300005843 Bacteria 6991
159 Ga0068860_100030211 3300005843 Bacteria 5211
160 Ga0068860_100331406 3300005843 Bacteria 1495
161 Ga0068860_101076962 3300005843 Unclassified 823
162 Ga0068862_100498016 3300005844 Bacteria 1156
163 Ga0081540_1005596 3300005983 Bacteria 9353
164 Ga0070715_10119309 3300006163 Bacteria 1255
165 Ga0075366_10129343 3300006195 Bacteria 1523
166 Ga0075366_10301876 3300006195 Bacteria 979
167 Ga0075366_10694277 3300006195 Unclassified 632
168 Ga0075366_10761823 3300006195 Bacteria 602
169 Ga0097621_100000427 3300006237 Bacteria 29385
170 Ga0097621_100022689 3300006237 Bacteria 4875
171 Ga0097621_100417224 3300006237 Bacteria 1204
172 Ga0097621_100796894 3300006237 Bacteria 875
173 Ga0097621_101888816 3300006237 Bacteria 570
174 Ga0075370_10806042 3300006353 Bacteria 573
175 Ga0068871_100000582 3300006358 Bacteria 25067
176 Ga0068871_100005204 3300006358 Bacteria 9094
177 Ga0068871_100021743 3300006358 Bacteria 4936
178 Ga0068871_100335766 3300006358 Bacteria 1334
179 Ga0068871_100348038 3300006358 Bacteria 1310
180 Ga0068871_100477813 3300006358 Bacteria 1120
181 Ga0075428_100103007 3300006844 Bacteria 3113
182 Ga0075431_100004624 3300006847 Bacteria 13512
183 Ga0075429_100069117 3300006880 Bacteria 3075
184 Ga0068865_100169037 3300006881 Bacteria 1674
185 Ga0097620_100236194 3300006931 Bacteria 1917
186 Ga0097620_100959264 3300006931 Bacteria 938
187 Ga0097620_100974348 3300006931 Unclassified 931
188 Ga0097620_102666296 3300006931 Unclassified 549
189 Ga0105240_10010363 3300009093 Bacteria 13114
190 Ga0105240_10014456 3300009093 Bacteria 10778
191 Ga0105240_10026640 3300009093 Bacteria 7586
192 Ga0105240_10040454 3300009093 Bacteria 5961
193 Ga0105240_10057728 3300009093 Bacteria 4847
194 Ga0105240_10113772 3300009093 Bacteria 3270
195 Ga0105240_10163495 3300009093 Bacteria 2642
196 Ga0105240_10503751 3300009093 Bacteria 1346
197 Ga0105240_10506520 3300009093 Bacteria 1342
198 Ga0111539_10181440 3300009094 Bacteria 2458
199 Ga0111539_12679931 3300009094 Bacteria 578
200 Ga0105245_10738772 3300009098 Bacteria 1019
201 Ga0105247_10128752 3300009101 Bacteria 1648
202 Ga0114129_10001029 3300009147 Bacteria 36430
203 Ga0114129_10035352 3300009147 Bacteria 7058
204 Ga0105243_10792888 3300009148 Bacteria 933
205 Ga0105241_10015527 3300009174 Bacteria 5582
206 Ga0105241_10241279 3300009174 Bacteria 1528
207 Ga0105241_10651034 3300009174 Bacteria 957
208 Ga0105241_10796304 3300009174 Bacteria 870
209 Ga0105241_11234135 3300009174 Bacteria 709
210 Ga0105241_12575849 3300009174 Unclassified 510
211 Ga0105242_10078923 3300009176 Bacteria 2748
212 Ga0105242_10236935 3300009176 Bacteria 1638
213 Ga0105242_10485928 3300009176 Bacteria 1171
214 Ga0105242_10692482 3300009176 Bacteria 996
215 Ga0105242_11378478 3300009176 Unclassified 732
216 Ga0105248_10105707 3300009177 Bacteria 3174
217 Ga0105248_10215588 3300009177 Bacteria 2162
218 Ga0105237_10002084 3300009545 Bacteria 25287
219 Ga0105237_10022388 3300009545 Bacteria 6484
220 Ga0105237_10054325 3300009545 Bacteria 4013
221 Ga0105237_10111962 3300009545 Bacteria 2721
222 Ga0105237_12636225 3300009545 Unclassified 513
223 Ga0105238_10028860 3300009551 Bacteria 5651
224 Ga0105238_10286040 3300009551 Bacteria 1631
225 Ga0105238_12817882 3300009551 Unclassified 522
226 Ga0105249_10000349 3300009553 Bacteria 46353
227 Ga0105249_10036337 3300009553 Unclassified 4468
228 Ga0105249_10156150 3300009553 Bacteria 2201
229 Ga0105249_10853770 3300009553 Bacteria 976
230 Ga0105239_10024227 3300010375 Bacteria 6684
231 Ga0105239_10045483 3300010375 Bacteria 4811
232 Ga0105239_10101610 3300010375 Bacteria 3181
233 Ga0105239_10115101 3300010375 Bacteria 2983
234 Ga0105239_10289194 3300010375 Bacteria 1846
235 Ga0105239_10560562 3300010375 Bacteria 1301
236 Ga0105239_10568430 3300010375 Bacteria 1292
237 Ga0105239_13644838 3300010375 Bacteria 500
238 Ga0105246_10718055 3300011119 Unclassified 878
239 Ga0105246_10887371 3300011119 Bacteria 798
240 Ga0157373_10083773 3300013100 Bacteria 2248
241 Ga0157373_10161279 3300013100 Bacteria 1578
242 Ga0157373_11013944 3300013100 Bacteria 620
243 Ga0157371_10277757 3300013102 Bacteria 1210
244 Ga0157370_10024115 3300013104 Bacteria 6030
245 Ga0157370_10112289 3300013104 Bacteria 2547
246 Ga0157370_10557954 3300013104 Bacteria 1050
247 Ga0157370_11543916 3300013104 Bacteria 597
248 Ga0157370_11684750 3300013104 Bacteria 569
249 Ga0157369_10414082 3300013105 Bacteria 1397
250 Ga0157369_10430931 3300013105 Bacteria 1367
251 Ga0157369_10899353 3300013105 Bacteria 908
252 Ga0157369_11161193 3300013105 Bacteria 788
253 Ga0157374_10000025 3300013296 Bacteria 245131
254 Ga0157374_10016290 3300013296 Bacteria 6531
255 Ga0157374_10251304 3300013296 Bacteria 1740
256 Ga0157374_10279670 3300013296 Bacteria 1647
257 Ga0157374_10580127 3300013296 Bacteria 1130
258 Ga0157374_10972355 3300013296 Bacteria 868
259 Ga0157374_11996546 3300013296 Unclassified 606
260 Ga0157374_12687502 3300013296 Bacteria 525
261 Ga0157378_10015576 3300013297 Bacteria 6659
262 Ga0157378_10116932 3300013297 Bacteria 2453
263 Ga0157378_10176468 3300013297 Bacteria 2007
264 Ga0157378_11479715 3300013297 Unclassified 723
265 Ga0157378_12098183 3300013297 Unclassified 616
266 Ga0163162_10001002 3300013306 Bacteria 26238
267 Ga0163162_10002343 3300013306 Bacteria 17790
268 Ga0163162_10033628 3300013306 Bacteria 5096
269 Ga0163162_10073821 3300013306 Bacteria 3468
270 Ga0163162_11197459 3300013306 Bacteria 862
271 Ga0163162_11694895 3300013306 Bacteria 722
272 Ga0163162_11752364 3300013306 Bacteria 710
273 Ga0157372_10000080 3300013307 Bacteria 100216
274 Ga0157372_10046053 3300013307 Bacteria 4840
275 Ga0157372_10276210 3300013307 Bacteria 1953
276 Ga0157372_10710690 3300013307 Bacteria 1169
277 Ga0157372_10854654 3300013307 Bacteria 1056
278 Ga0157372_10996772 3300013307 Unclassified 970
279 Ga0157372_11496628 3300013307 Bacteria 778
280 Ga0157372_12397438 3300013307 Bacteria 606
281 Ga0157372_13146468 3300013307 Bacteria 527
282 Ga0157375_10000186 3300013308 Bacteria 58217
283 Ga0157375_10000827 3300013308 Bacteria 27101
284 Ga0157375_10310507 3300013308 Bacteria 1741
285 Ga0163163_10071141 3300014325 Unclassified 3465
286 Ga0163163_10544484 3300014325 Archaea 1223
287 Ga0157380_10249246 3300014326 Bacteria 1606
288 Ga0157380_10497350 3300014326 Bacteria 1183
289 Ga0157380_12983045 3300014326 Bacteria 539
290 Ga0157377_10141335 3300014745 Bacteria 1480
291 Ga0157379_10006059 3300014968 Bacteria 10413
292 Ga0157379_10014679 3300014968 Bacteria 6871
293 Ga0157379_10938378 3300014968 Bacteria 822
294 Ga0157379_11332084 3300014968 Bacteria 694
295 Ga0157376_10000101 3300014969 Bacteria 62612
296 Ga0157376_10000106 3300014969 Bacteria 60118
297 Ga0157376_10000650 3300014969 Bacteria 22495
298 Ga0157376_10635325 3300014969 Bacteria 1066
299 Ga0182006_1193940 3300015261 Bacteria 674
300 Ga0163161_10016541 3300017792 Bacteria 5150
301 Ga0163161_10209651 3300017792 Bacteria 1505
302 Ga0206352_11229666 3300020078 Bacteria 1229
303 Ga0213876_10007925 3300021384 Bacteria 5764
304 Ga0213876_10090628 3300021384 Unclassified 1619
305 Ga0209258_116824 3300025242 Bacteria 811
306 Ga0209646_1004961 3300025246 Bacteria 2372
307 Ga0207656_10090117 3300025321 Bacteria 1391
308 Ga0207656_10111589 3300025321 Bacteria 1264
309 Ga0207642_10010211 3300025899 Unclassified 3298
310 Ga0207642_10243405 3300025899 Bacteria 1017
311 Ga0207680_10001074 3300025903 Bacteria 12895
312 Ga0207680_10069908 3300025903 Bacteria 2171
313 Ga0207647_10008966 3300025904 Bacteria 7126
314 Ga0207647_10424916 3300025904 Bacteria 747
315 Ga0207645_10003472 3300025907 Bacteria 11943
316 Ga0207643_10145614 3300025908 Bacteria 1417
317 Ga0207705_10014017 3300025909 Bacteria 5777
318 Ga0207705_10298815 3300025909 Bacteria 1235
319 Ga0207654_10051471 3300025911 Bacteria 2370
320 Ga0207654_10149979 3300025911 Bacteria 1495
321 Ga0207707_10073935 3300025912 Bacteria 2972
322 Ga0207707_10451160 3300025912 Bacteria 1100
323 Ga0207707_11612588 3300025912 Bacteria 511
324 Ga0207695_10000146 3300025913 Bacteria 209416
325 Ga0207695_10000248 3300025913 Bacteria 140288
326 Ga0207695_10003218 3300025913 Bacteria 23245
327 Ga0207695_10015113 3300025913 Bacteria 9108
328 Ga0207695_10018745 3300025913 Bacteria 7989
329 Ga0207695_10052136 3300025913 Bacteria 4288
330 Ga0207695_10061832 3300025913 Bacteria 3868
331 Ga0207695_10139963 3300025913 Bacteria 2369
332 Ga0207695_10154091 3300025913 Bacteria 2234
333 Ga0207695_10730028 3300025913 Bacteria 871
334 Ga0207671_10001661 3300025914 Bacteria 25296
335 Ga0207671_10020429 3300025914 Bacteria 5040
336 Ga0207671_10150150 3300025914 Bacteria 1800
337 Ga0207671_11517087 3300025914 Unclassified 517
338 Ga0207663_11420920 3300025916 Unclassified 559
339 Ga0207660_10242324 3300025917 Bacteria 1421
340 Ga0207649_10434596 3300025920 Bacteria 988
341 Ga0207649_11015709 3300025920 Bacteria 653
342 Ga0207652_10122515 3300025921 Bacteria 2314
343 Ga0207681_10276840 3300025923 Bacteria 1320
344 Ga0207681_11127383 3300025923 Bacteria 659
345 Ga0207694_10284236 3300025924 Bacteria 1359
346 Ga0207694_10596242 3300025924 Bacteria 929
347 Ga0207650_10127474 3300025925 Bacteria 1988
348 Ga0207650_10153052 3300025925 Bacteria 1822
349 Ga0207650_10652750 3300025925 Unclassified 887
350 Ga0207650_11598069 3300025925 Bacteria 553
351 Ga0207659_10105800 3300025926 Bacteria 2129
352 Ga0207659_10186722 3300025926 Bacteria 1647
353 Ga0207659_10452958 3300025926 Bacteria 1081
354 Ga0207687_10518968 3300025927 Bacteria 996
355 Ga0207644_10077904 3300025931 Bacteria 2442
356 Ga0207644_10124235 3300025931 Bacteria 1968
357 Ga0207644_10310126 3300025931 Bacteria 1274
358 Ga0207686_10052274 3300025934 Bacteria 2549
359 Ga0207686_10263922 3300025934 Bacteria 1264
360 Ga0207669_10401549 3300025937 Bacteria 1074
361 Ga0207704_10006582 3300025938 Bacteria 5433
362 Ga0207704_10466975 3300025938 Bacteria 1010
363 Ga0207691_10000076 3300025940 Bacteria 83005
364 Ga0207691_10033525 3300025940 Bacteria 4780
365 Ga0207691_10165875 3300025940 Bacteria 1936
366 Ga0207691_10717495 3300025940 Bacteria 843
367 Ga0207691_11037087 3300025940 Bacteria 684
368 Ga0207711_10134535 3300025941 Bacteria 2219
369 Ga0207689_10058218 3300025942 Bacteria 3178
370 Ga0207689_10119101 3300025942 Bacteria 2172
371 Ga0207689_10392348 3300025942 Bacteria 1156
372 Ga0207689_10512509 3300025942 Bacteria 1005
373 Ga0207661_10009210 3300025944 Bacteria 7075
374 Ga0207679_12096722 3300025945 Bacteria 514
375 Ga0207667_10000270 3300025949 Bacteria 71998
376 Ga0207667_10000445 3300025949 Bacteria 55443
377 Ga0207667_10019461 3300025949 Bacteria 7578
378 Ga0207667_10032466 3300025949 Bacteria 5626
379 Ga0207667_10090406 3300025949 Bacteria 3164
380 Ga0207651_10055807 3300025960 Bacteria 2715
381 Ga0207651_10958492 3300025960 Unclassified 763
382 Ga0207712_10004215 3300025961 Bacteria 9073
383 Ga0207712_10020658 3300025961 Unclassified 4316
384 Ga0207712_10095109 3300025961 Bacteria 2202
385 Ga0207712_11444223 3300025961 Bacteria 616
386 Ga0207668_10005078 3300025972 Bacteria 7745
387 Ga0207668_10182274 3300025972 Bacteria 1658
388 Ga0207668_11720440 3300025972 Unclassified 566
389 Ga0207640_10006821 3300025981 Bacteria 6281
390 Ga0207640_10227275 3300025981 Bacteria 1433
391 Ga0207640_10294711 3300025981 Bacteria 1280
392 Ga0207640_10613544 3300025981 Bacteria 922
393 Ga0207640_11334486 3300025981 Bacteria 641
394 Ga0207640_11402382 3300025981 Unclassified 626
395 Ga0207658_10004289 3300025986 Bacteria 9936
396 Ga0207658_10022044 3300025986 Bacteria 4430
397 Ga0207658_10380405 3300025986 Bacteria 1236
398 Ga0207658_10866683 3300025986 Bacteria 821
399 Ga0207677_10054044 3300026023 Bacteria 2738
400 Ga0207703_10216645 3300026035 Bacteria 1710
401 Ga0207703_10466559 3300026035 Bacteria 1181
402 Ga0207639_10012165 3300026041 Bacteria 5987
403 Ga0207639_10031875 3300026041 Bacteria 3876
404 Ga0207639_10053121 3300026041 Bacteria 3090
405 Ga0207639_10157504 3300026041 Bacteria 1910
406 Ga0207639_11031768 3300026041 Bacteria 770
407 Ga0207639_12306295 3300026041 Bacteria 500
408 Ga0207678_10329049 3300026067 Bacteria 1315
409 Ga0207678_11177985 3300026067 Unclassified 678
410 Ga0207702_10162137 3300026078 Bacteria 2043
411 Ga0207702_10197512 3300026078 Bacteria 1863
412 Ga0207702_11432715 3300026078 Bacteria 684
413 Ga0207641_10025588 3300026088 Unclassified 4867
414 Ga0207641_10030766 3300026088 Bacteria 4447
415 Ga0207641_10373000 3300026088 Bacteria 1365
416 Ga0207641_10395709 3300026088 Bacteria 1326
417 Ga0207641_10904047 3300026088 Bacteria 877
418 Ga0207641_12146484 3300026088 Bacteria 559
419 Ga0207648_10010617 3300026089 Bacteria 8706
420 Ga0207648_10023153 3300026089 Bacteria 5571
421 Ga0207648_10023926 3300026089 Bacteria 5460
422 Ga0207648_10052560 3300026089 Bacteria 3563
423 Ga0207648_10122941 3300026089 Bacteria 2282
424 Ga0207648_10178766 3300026089 Archaea 1877
425 Ga0207648_10365359 3300026089 Unclassified 1303
426 Ga0207648_10399288 3300026089 Bacteria 1245
427 Ga0207676_10042450 3300026095 Bacteria 3498
428 Ga0207676_10259123 3300026095 Unclassified 1569
429 Ga0207676_11463483 3300026095 Bacteria 680
430 Ga0207676_11523448 3300026095 Bacteria 666
431 Ga0207674_10001573 3300026116 Bacteria 29387
432 Ga0207674_10069258 3300026116 Bacteria 3549
433 Ga0207674_10752839 3300026116 Bacteria 940
434 Ga0207675_100191873 3300026118 Bacteria 1960
435 Ga0207675_100256249 3300026118 Bacteria 1695
436 Ga0207675_100514416 3300026118 Bacteria 1193
437 Ga0207675_101333339 3300026118 Bacteria 738
438 Ga0207675_102330024 3300026118 Unclassified 549
439 Ga0207683_10243011 3300026121 Bacteria 1642
440 Ga0207683_10337941 3300026121 Bacteria 1381
441 Ga0207698_10000987 3300026142 Bacteria 16491
442 Ga0207698_10313756 3300026142 Bacteria 1465
443 Ga0207698_10598549 3300026142 Bacteria 1087
444 Ga0207698_10651217 3300026142 Bacteria 1043
445 Ga0207698_11147594 3300026142 Bacteria 790
446 Ga0207698_11815958 3300026142 Unclassified 625
447 Ga0209974_10032756 3300027876 Bacteria 1723
448 Ga0268266_10000026 3300028379 Bacteria 434485
449 Ga0268266_10144888 3300028379 Bacteria 2135
450 Ga0268266_10520302 3300028379 Unclassified 1137
451 Ga0268265_10389499 3300028380 Bacteria 1285
452 Ga0268264_10008251 3300028381 Bacteria 8650
453 Ga0268264_10018324 3300028381 Bacteria 5724
454 Ga0268264_10022556 3300028381 Bacteria 5138
455 Ga0268264_10046776 3300028381 Bacteria 3595
456 Ga0268264_10819251 3300028381 Bacteria 931
457 Ga0307517_10507214 3300028786 Unclassified 612
458 Ga0307515_10000001 3300028794 Bacteria 4259510
459 Ga0307511_10000509 3300030521 Bacteria 41790
460 Ga0265332_10371319 3300031238 Unclassified 591
461 Ga0265340_10203877 3300031247 Bacteria 889
462 Ga0265327_10115167 3300031251 Bacteria 1280
463 Ga0307513_10645887 3300031456 Bacteria 765
464 Ga0265313_10108421 3300031595 Bacteria 1224
465 Ga0265314_10211141 3300031711 Bacteria 1140
466 Ga0307413_10610866 3300031824 Unclassified 894
467 Ga0307410_11296601 3300031852 Bacteria 637
468 Ga0307414_11737893 3300032004 Bacteria 582
469 Ga0307411_11391725 3300032005 Unclassified 642
470 Ga0307510_10002732 3300033180 Bacteria 20188
471 Ga0307510_10104605 3300033180 Bacteria 2603
472 Ga0373927_1199713 3300035695 Bacteria 500
473 Ga0373937_0972334 3300036401 Unclassified 798
474 Ga0436365_1777169 3300039437 Bacteria 24248
475 Ga0439436_0000727 3300041404 Bacteria 8875
476 Ga0439439_0013927 3300041406 Bacteria 1954
477 Ga0439439_0076545 3300041406 Bacteria 901
478 Ga0451789_0151170 3300041443 Unclassified 580
479 Ga0451793_0775308 3300041452 Bacteria 512
480 Ga0451793_1543048 3300041452 Bacteria 550
481 Ga0451800_1122242 3300041459 Bacteria 598
482 Ga0451807_0297254 3300041486 Bacteria 549
483 Ga0451841_1070416 3300041498 Bacteria 843
484 Ga0451849_1451831 3300041505 Bacteria 696
485 Ga0451851_0769739 3300041507 Bacteria 585
486 Ga0451843_1188429 3300041509 Bacteria 564
487 Ga0451853_1888255 3300041512 Bacteria 803
488 Ga0439449_0019598 3300042007 Bacteria 2536
489 Ga0439449_0238131 3300042007 Bacteria 683
490 Ga0439449_0375570 3300042007 Bacteria 539
491 Ga0439457_031465 3300042014 Bacteria 1176
492 Ga0439462_0000406 3300042015 Bacteria 8332
493 Ga0451577_0170800 3300042876 Bacteria 1959
494 Ga0466969_0000004 3300044656 Bacteria 168068
495 Ga0466969_0091596 3300044656 Bacteria 1440
496 Ga0466969_0169237 3300044656 Bacteria 1002
497 Ga0466972_0000395 3300044658 Bacteria 23176
498 Ga0466972_0107997 3300044658 Bacteria 1315
499 Ga0466966_0104212 3300044684 Bacteria 1752
500 Ga0466966_0792863 3300044684 Bacteria 571
501 Ga0466961_0049986 3300044693 Bacteria 2671
502 Ga0466961_0208839 3300044693 Bacteria 1206
503 Ga0466961_0432779 3300044693 Bacteria 797
504 Ga0466964_0043385 3300044706 Bacteria 1824
505 Ga0453684_0295910 3300044712 Bacteria 1841
506 Ga0453684_0335704 3300044712 Bacteria 1708
507 Ga0453684_0877297 3300044712 Bacteria 962
508 Ga0466971_0028881 3300044719 Bacteria 2480
509 Ga0466971_0580598 3300044719 Bacteria 558
510 Ga0466968_0036066 3300044735 Bacteria 2071
511 Ga0466957_0004957 3300044842 Bacteria 7449
512 Ga0466957_0046684 3300044842 Bacteria 2630
513 Ga0466957_0308564 3300044842 Bacteria 1065
514 Ga0466960_0325194 3300044901 Bacteria 872
515 Ga0466959_0000004 3300045049 Bacteria 216815
516 Ga0466959_0005944 3300045049 Bacteria 8415
517 Ga0466958_0020671 3300045836 Bacteria 3841
518 Ga0495606_0005088 3300046507 Bacteria 12792
519 Ga0495632_0471791 3300046519 Bacteria 543
520 Ga0495668_0000685 3300046616 Bacteria 40831
521 Ga0495611_0000079 3300046648 Bacteria 68471
522 Ga0495625_0436765 3300046660 Bacteria 811
523 Ga0495625_0911790 3300046660 Unclassified 503
524 Ga0495649_0045422 3300046694 Bacteria 2395
525 Ga0495672_0060488 3300047320 Bacteria 2188
526 Ga0495686_0000005 3300047472 Bacteria 827143
527 Ga0495686_0628074 3300047472 Bacteria 554
528 Ga0496101_0030909 3300048904 Bacteria 3760
529 Ga0496106_0046633 3300048909 Bacteria 3259
530 Ga0496108_0202635 3300048911 Bacteria 1722
531 Ga0496109_1820014 3300048912 Bacteria 542
532 Ga0496114_0104385 3300048917 Bacteria 2423
533 Ga0501291_168640 3300049514 Unclassified 504
534 Ga0501032_0006965 3300049569 Bacteria 8288
535 Ga0501032_0038126 3300049569 Bacteria 3274
536 Ga0501033_0011263 3300049570 Bacteria 6846
537 Ga0501033_0688616 3300049570 Bacteria 696
538 Ga0501033_0926165 3300049570 Bacteria 585
539 Ga0501034_0001891 3300049571 Bacteria 26519
540 Ga0501034_0024251 3300049571 Bacteria 6169
541 Ga0501034_0111926 3300049571 Bacteria 2720
542 Ga0501034_0609167 3300049571 Bacteria 997
543 Ga0501036_0030850 3300049572 Bacteria 4529
544 Ga0501036_0289209 3300049572 Unclassified 1371
545 Ga0501037_0004781 3300049573 Bacteria 9845
546 Ga0501037_0007419 3300049573 Bacteria 8017
547 Ga0501037_0215761 3300049573 Bacteria 1352
548 Ga0501038_0030182 3300049574 Bacteria 4800
549 Ga0501038_0513286 3300049574 Bacteria 915
550 Ga0501038_0665501 3300049574 Unclassified 783
551 Ga0501039_0095622 3300049575 Bacteria 2316
552 Ga0501043_0009692 3300049579 Bacteria 7546
553 Ga0501043_0019373 3300049579 Bacteria 5342
554 Ga0501043_0442803 3300049579 Bacteria 977
555 Ga0501043_0780700 3300049579 Bacteria 692
556 Ga0501046_0003336 3300049580 Bacteria 14755
557 Ga0501046_1026497 3300049580 Bacteria 572
558 Ga0501047_0002513 3300049581 Bacteria 17487
559 Ga0501047_0003037 3300049581 Bacteria 15919
560 Ga0501047_1246314 3300049581 Bacteria 557
561 Ga0501048_0101204 3300049582 Bacteria 2033
562 Ga0501048_0616881 3300049582 Bacteria 779
563 Ga0501067_0002016 3300049583 Bacteria 11196
564 Ga0501067_0005028 3300049583 Bacteria 7343
565 Ga0501068_0088935 3300049584 Bacteria 1903
566 Ga0501068_0216776 3300049584 Bacteria 1216
567 Ga0501069_0117805 3300049585 Unclassified 1515
568 Ga0501070_0075994 3300049586 Bacteria 2780
569 Ga0501072_0350103 3300049588 Bacteria 1173
570 Ga0501073_0058667 3300049589 Bacteria 2689
571 Ga0501074_0005676 3300049590 Bacteria 8990
572 Ga0501074_0753985 3300049590 Unclassified 686
573 Ga0501076_0153833 3300049592 Bacteria 1872
574 Ga0501077_0865200 3300049593 Bacteria 581
575 Ga0501209_269311 3300049656 Bacteria 534
576 Ga0501258_069604 3300049687 Bacteria 521
577 Ga0501219_000066 3300049703 Bacteria 17566
578 Ga0501079_0101000 3300049741 Bacteria 2237
579 Ga0501079_0302360 3300049741 Bacteria 1252
580 Ga0501083_0007950 3300049744 Bacteria 7509
581 Ga0501083_0270470 3300049744 Bacteria 1105
582 Ga0501241_018782 3300049758 Bacteria 1267
583 Ga0501268_051824 3300049765 Unclassified 796
584 Ga0501270_067199 3300049767 Unclassified 686
585 Ga0501035_0014156 3300049822 Bacteria 7359
586 Ga0501035_0065490 3300049822 Bacteria 3227
587 Ga0501035_0615308 3300049822 Unclassified 884
588 Ga0501035_0795376 3300049822 Bacteria 756
589 Ga0501044_0004121 3300049823 Bacteria 16310
590 Ga0501044_0004145 3300049823 Bacteria 16280
591 Ga0501044_0005264 3300049823 Bacteria 14391
592 Ga0501044_1005732 3300049823 Bacteria 705
593 Ga0501045_0629780 3300049824 Bacteria 793
594 Ga0501284_00018 3300050005 Bacteria 93729
595 Ga0501284_02238 3300050005 Bacteria 1061
596 nmdc:mga0k408_343249_c1 3300050493 Bacteria 890
597 nmdc:mga0k408_353356_c1 3300050493 Bacteria 876
598 nmdc:mga0k408_630225_c1 3300050493 Bacteria 631
599 nmdc:mga05p37_1343_c1 3300050507 Bacteria 28597
600 nmdc:mga09592_38283_c1 3300050508 Bacteria 4025
601 nmdc:mga06r32_7793_c1 3300050510 Bacteria 9624
602 nmdc:mga08y16_64205_c1 3300050511 Bacteria 3834
603 Ga0500578_0000037 3300053086 Bacteria 134901
604 Ga0500578_0253116 3300053086 Bacteria 1060
605 Ga0500644_0051565 3300053088 Bacteria 1413
606 Ga0500646_0003987 3300053090 Bacteria 3755
607 Ga0500646_0009166 3300053090 Bacteria 2533
608 Ga0500583_0000089 3300053092 Bacteria 51075
609 Ga0500583_0006034 3300053092 Bacteria 4124
610 Ga0500583_0206625 3300053092 Bacteria 975
611 Ga0500651_0378178 3300053093 Bacteria 799
612 Ga0500641_0181978 3300053096 Bacteria 902
613 Ga0500555_016078 3300053103 Bacteria 2157
614 Ga0500556_0086798 3300053104 Bacteria 1190
615 Ga0500628_247282 3300053129 Bacteria 524
616 Ga0500642_0064098 3300053130 Bacteria 1658
617 Ga0500658_0126247 3300053134 Bacteria 1138
618 Ga0500559_0059922 3300053136 Unclassified 1695
619 Ga0500559_0467521 3300053136 Bacteria 582
620 Ga0500561_0134710 3300053137 Bacteria 762
621 Ga0500573_0297183 3300053140 Bacteria 809
622 Ga0500588_0079748 3300053146 Unclassified 1092
623 Ga0500589_049400 3300053147 Bacteria 1954
624 Ga0500589_209137 3300053147 Bacteria 743
625 Ga0500604_0127854 3300053151 Bacteria 853
626 Ga0500622_0033454 3300053156 Bacteria 2695
627 Ga0500633_0186406 3300053160 Bacteria 778
628 Ga0500639_048361 3300053163 Bacteria 2220
629 Ga0500636_0035574 3300053177 Bacteria 2947
630 Ga0500636_0069011 3300053177 Bacteria 2052
631 Ga0500637_0016380 3300053178 Bacteria 3951
632 Ga0500637_0279934 3300053178 Bacteria 919
633 Ga0500637_0410391 3300053178 Bacteria 700
634 Ga0500611_009565 3300053727 Bacteria 1541
635 Ga0501084_0039744 3300054114 Bacteria 3934
636 Ga0501082_0083200 3300060353 Bacteria 2761
637 Ga0466962_0001216 3300061719 Bacteria 11838
638 Ga0466962_0396685 3300061719 Bacteria 691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041505 Ga0451849_1451831 Ga0451849_1451831_383_685 80
2 3300044693 Ga0466961_0208839 Ga0466961_0208839_814_1107 84
3 3300049514 Ga0501291_168640 Ga0501291_168640_227_493 88
4 3300005616 Ga0068852_100000902 Ga0068852_10000090215 90
5 3300025913 Ga0207695_10018745 Ga0207695_100187452 90
6 3300026142 Ga0207698_10000987 Ga0207698_100009878 90
7 3300044842 Ga0466957_0308564 Ga0466957_0308564_563_835 90
8 3300005539 Ga0068853_100001323 Ga0068853_10000132313 91
9 3300005578 Ga0068854_101231842 Ga0068854_1012318421 91
10 3300005616 Ga0068852_101192781 Ga0068852_1011927812 91
11 3300005834 Ga0068851_10679138 Ga0068851_106791381 91
12 3300009093 Ga0105240_10010363 Ga0105240_1001036312 91
13 3300009093 Ga0105240_10040454 Ga0105240_100404545 91
14 3300010375 Ga0105239_10045483 Ga0105239_100454831 91
15 3300013307 Ga0157372_10276210 Ga0157372_102762104 91
16 3300025904 Ga0207647_10424916 Ga0207647_104249162 91
17 3300025913 Ga0207695_10000146 Ga0207695_1000014622 91
18 3300025913 Ga0207695_10003218 Ga0207695_1000321812 91
19 3300025913 Ga0207695_10015113 Ga0207695_100151134 91
20 3300025981 Ga0207640_11402382 Ga0207640_114023821 91
21 3300025986 Ga0207658_10866683 Ga0207658_108666832 91
22 3300026041 Ga0207639_10012165 Ga0207639_100121656 91
23 3300053090 Ga0500646_0003987 Ga0500646_0003987_979_1269 91
24 3300005288 Ga0065714_10287823 Ga0065714_102878232 92
25 3300005331 Ga0070670_100798344 Ga0070670_1007983441 92
26 3300009174 Ga0105241_12575849 Ga0105241_125758491 92
27 3300025925 Ga0207650_11598069 Ga0207650_115980692 92
28 3300025931 Ga0207644_10310126 Ga0207644_103101262 92
29 3300036401 Ga0373937_0972334 Ga0373937_0972334_373_651 92
30 iso_pu_bacteria 2738541278 2738724580 92
31 3300003316 rootH1_10103792 rootH1_101037923 93
32 3300003320 rootH2_10014840 rootH2_100148405 93
33 3300003320 rootH2_10052864 rootH2_100528644 93
34 3300003323 rootH1_10332917 rootH1_103329172 93
35 3300003659 JGI25404J52841_10081937 JGI25404J52841_100819371 93
36 3300005290 Ga0065712_10196191 Ga0065712_101961911 93
37 3300005290 Ga0065712_10553212 Ga0065712_105532122 93
38 3300005327 Ga0070658_10011212 Ga0070658_100112126 93
39 3300005328 Ga0070676_10000238 Ga0070676_1000023820 93
40 3300005330 Ga0070690_100236633 Ga0070690_1002366331 93
41 3300005331 Ga0070670_100445216 Ga0070670_1004452161 93
42 3300005334 Ga0068869_100110204 Ga0068869_1001102041 93
43 3300005335 Ga0070666_10001496 Ga0070666_100014968 93
44 3300005337 Ga0070682_100000393 Ga0070682_1000003938 93
45 3300005337 Ga0070682_100334817 Ga0070682_1003348172 93
46 3300005338 Ga0068868_100001065 Ga0068868_10000106511 93
47 3300005347 Ga0070668_100003447 Ga0070668_1000034476 93
48 3300005354 Ga0070675_100024172 Ga0070675_1000241722 93
49 3300005356 Ga0070674_100595813 Ga0070674_1005958132 93
50 3300005364 Ga0070673_100001402 Ga0070673_10000140210 93
51 3300005366 Ga0070659_100755167 Ga0070659_1007551671 93
52 3300005367 Ga0070667_100001589 Ga0070667_1000015894 93
53 3300005456 Ga0070678_100292701 Ga0070678_1002927012 93
54 3300005458 Ga0070681_10039915 Ga0070681_100399154 93
55 3300005459 Ga0068867_100003608 Ga0068867_1000036087 93
56 3300005466 Ga0070685_10180536 Ga0070685_101805361 93
57 3300005536 Ga0070697_101980970 Ga0070697_1019809701 93
58 3300005539 Ga0068853_100001266 Ga0068853_1000012666 93
59 3300005543 Ga0070672_100008059 Ga0070672_1000080591 93
60 3300005543 Ga0070672_101201388 Ga0070672_1012013881 93
61 3300005548 Ga0070665_100000018 Ga0070665_100000018211 93
62 3300005548 Ga0070665_100551063 Ga0070665_1005510632 93
63 3300005563 Ga0068855_100039314 Ga0068855_1000393142 93
64 3300005563 Ga0068855_100042044 Ga0068855_1000420443 93
65 3300005578 Ga0068854_100217084 Ga0068854_1002170844 93
66 3300005616 Ga0068852_101956384 Ga0068852_1019563842 93
67 3300005617 Ga0068859_100236208 Ga0068859_1002362083 93
68 3300005617 Ga0068859_102666392 Ga0068859_1026663922 93
69 3300005618 Ga0068864_100001339 Ga0068864_10000133919 93
70 3300005719 Ga0068861_100147948 Ga0068861_1001479483 93
71 3300005719 Ga0068861_101167616 Ga0068861_1011676162 93
72 3300005834 Ga0068851_10000433 Ga0068851_100004334 93
73 3300005834 Ga0068851_10032370 Ga0068851_100323703 93
74 3300005840 Ga0068870_10991859 Ga0068870_109918591 93
75 3300005841 Ga0068863_100015219 Ga0068863_1000152196 93
76 3300005842 Ga0068858_100018401 Ga0068858_1000184015 93
77 3300005843 Ga0068860_100004955 Ga0068860_1000049552 93
78 3300005983 Ga0081540_1005596 Ga0081540_10055967 93
79 3300006163 Ga0070715_10119309 Ga0070715_101193092 93
80 3300006237 Ga0097621_100022689 Ga0097621_1000226894 93
81 3300006358 Ga0068871_100000582 Ga0068871_10000058215 93
82 3300006881 Ga0068865_100169037 Ga0068865_1001690373 93
83 3300006931 Ga0097620_100236194 Ga0097620_1002361943 93
84 3300006931 Ga0097620_102666296 Ga0097620_1026662962 93
85 3300009093 Ga0105240_10057728 Ga0105240_100577283 93
86 3300009093 Ga0105240_10163495 Ga0105240_101634952 93
87 3300009098 Ga0105245_10738772 Ga0105245_107387721 93
88 3300009174 Ga0105241_10241279 Ga0105241_102412791 93
89 3300009174 Ga0105241_10796304 Ga0105241_107963041 93
90 3300009177 Ga0105248_10105707 Ga0105248_101057072 93
91 3300009545 Ga0105237_10022388 Ga0105237_100223885 93
92 3300009551 Ga0105238_10028860 Ga0105238_100288606 93
93 3300009553 Ga0105249_10036337 Ga0105249_100363371 93
94 3300009553 Ga0105249_10853770 Ga0105249_108537701 93
95 3300010375 Ga0105239_10101610 Ga0105239_101016102 93
96 3300010375 Ga0105239_10568430 Ga0105239_105684301 93
97 3300011119 Ga0105246_10718055 Ga0105246_107180551 93
98 3300013296 Ga0157374_10000025 Ga0157374_10000025148 93
99 3300013296 Ga0157374_10016290 Ga0157374_100162904 93
100 3300013297 Ga0157378_10116932 Ga0157378_101169322 93
101 3300013306 Ga0163162_10033628 Ga0163162_100336284 93
102 3300013306 Ga0163162_10073821 Ga0163162_100738212 93
103 3300013307 Ga0157372_10046053 Ga0157372_100460535 93
104 3300013308 Ga0157375_10000827 Ga0157375_100008274 93
105 3300014325 Ga0163163_10071141 Ga0163163_100711414 93
106 3300014968 Ga0157379_10014679 Ga0157379_100146791 93
107 3300014969 Ga0157376_10000106 Ga0157376_1000010648 93
108 3300014969 Ga0157376_10000650 Ga0157376_1000065017 93
109 3300025321 Ga0207656_10090117 Ga0207656_100901172 93
110 3300025321 Ga0207656_10111589 Ga0207656_101115891 93
111 3300025903 Ga0207680_10001074 Ga0207680_100010746 93
112 3300025907 Ga0207645_10003472 Ga0207645_1000347210 93
113 3300025909 Ga0207705_10014017 Ga0207705_100140171 93
114 3300025912 Ga0207707_10073935 Ga0207707_100739354 93
115 3300025913 Ga0207695_10139963 Ga0207695_101399634 93
116 3300025913 Ga0207695_10154091 Ga0207695_101540912 93
117 3300025914 Ga0207671_10020429 Ga0207671_100204293 93
118 3300025914 Ga0207671_11517087 Ga0207671_115170871 93
119 3300025926 Ga0207659_10186722 Ga0207659_101867224 93
120 3300025927 Ga0207687_10518968 Ga0207687_105189681 93
121 3300025938 Ga0207704_10006582 Ga0207704_100065821 93
122 3300025940 Ga0207691_10000076 Ga0207691_100000767 93
123 3300025940 Ga0207691_10165875 Ga0207691_101658753 93
124 3300025940 Ga0207691_11037087 Ga0207691_110370871 93
125 3300025941 Ga0207711_10134535 Ga0207711_101345354 93
126 3300025942 Ga0207689_10058218 Ga0207689_100582184 93
127 3300025942 Ga0207689_10512509 Ga0207689_105125092 93
128 3300025949 Ga0207667_10032466 Ga0207667_100324665 93
129 3300025949 Ga0207667_10090406 Ga0207667_100904061 93
130 3300025960 Ga0207651_10055807 Ga0207651_100558074 93
131 3300025961 Ga0207712_10020658 Ga0207712_100206581 93
132 3300025961 Ga0207712_11444223 Ga0207712_114442231 93
133 3300025972 Ga0207668_10005078 Ga0207668_100050785 93
134 3300025981 Ga0207640_10227275 Ga0207640_102272753 93
135 3300025986 Ga0207658_10004289 Ga0207658_100042899 93
136 3300026023 Ga0207677_10054044 Ga0207677_100540444 93
137 3300026035 Ga0207703_10466559 Ga0207703_104665594 93
138 3300026041 Ga0207639_10157504 Ga0207639_101575044 93
139 3300026088 Ga0207641_10030766 Ga0207641_100307662 93
140 3300026088 Ga0207641_12146484 Ga0207641_121464841 93
141 3300026089 Ga0207648_10010617 Ga0207648_100106174 93
142 3300026095 Ga0207676_10042450 Ga0207676_100424502 93
143 3300026118 Ga0207675_100191873 Ga0207675_1001918733 93
144 3300026121 Ga0207683_10337941 Ga0207683_103379412 93
145 3300026142 Ga0207698_10651217 Ga0207698_106512172 93
146 3300026142 Ga0207698_11815958 Ga0207698_118159581 93
147 3300028379 Ga0268266_10000026 Ga0268266_10000026150 93
148 3300028379 Ga0268266_10144888 Ga0268266_101448884 93
149 3300028379 Ga0268266_10520302 Ga0268266_105203023 93
150 3300028381 Ga0268264_10022556 Ga0268264_100225565 93
151 3300028794 Ga0307515_10000001 Ga0307515_100000012181 93
152 3300031238 Ga0265332_10371319 Ga0265332_103713191 93
153 3300031247 Ga0265340_10203877 Ga0265340_102038771 93
154 3300031595 Ga0265313_10108421 Ga0265313_101084213 93
155 3300031711 Ga0265314_10211141 Ga0265314_102111412 93
156 3300032004 Ga0307414_11737893 Ga0307414_117378931 93
157 3300041452 Ga0451793_0775308 Ga0451793_0775308_209_490 93
158 3300041509 Ga0451843_1188429 Ga0451843_1188429_49_330 93
159 3300044656 Ga0466969_0169237 Ga0466969_0169237_252_533 93
160 3300044684 Ga0466966_0792863 Ga0466966_0792863_83_364 93
161 3300044693 Ga0466961_0049986 Ga0466961_0049986_13_294 93
162 3300044712 Ga0453684_0877297 Ga0453684_0877297_508_789 93
163 3300044719 Ga0466971_0028881 Ga0466971_0028881_98_379 93
164 3300045049 Ga0466959_0005944 Ga0466959_0005944_5028_5309 93
165 3300045836 Ga0466958_0020671 Ga0466958_0020671_3122_3403 93
166 3300046660 Ga0495625_0436765 Ga0495625_0436765_80_361 93
167 3300046694 Ga0495649_0045422 Ga0495649_0045422_659_940 93
168 3300047320 Ga0495672_0060488 Ga0495672_0060488_237_518 93
169 3300048911 Ga0496108_0202635 Ga0496108_0202635_636_917 93
170 3300050005 Ga0501284_02238 Ga0501284_02238_155_439 93
171 3300053096 Ga0500641_0181978 Ga0500641_0181978_163_444 93
172 3300053140 Ga0500573_0297183 Ga0500573_0297183_69_350 93
173 3300061719 Ga0466962_0001216 Ga0466962_0001216_4558_4839 93
174 3300003320 rootH2_10002129 rootH2_1000212911 94
175 3300003320 rootH2_10020813 rootH2_100208139 94
176 3300005290 Ga0065712_10103457 Ga0065712_101034572 94
177 3300005327 Ga0070658_10751327 Ga0070658_107513271 94
178 3300005328 Ga0070676_10389533 Ga0070676_103895332 94
179 3300005331 Ga0070670_100778397 Ga0070670_1007783972 94
180 3300005336 Ga0070680_100308915 Ga0070680_1003089152 94
181 3300005338 Ga0068868_100089776 Ga0068868_1000897762 94
182 3300005339 Ga0070660_100617455 Ga0070660_1006174551 94
183 3300005340 Ga0070689_100714994 Ga0070689_1007149943 94
184 3300005341 Ga0070691_10670626 Ga0070691_106706261 94
185 3300005344 Ga0070661_101204583 Ga0070661_1012045831 94
186 3300005353 Ga0070669_100043329 Ga0070669_1000433291 94
187 3300005354 Ga0070675_100251913 Ga0070675_1002519133 94
188 3300005364 Ga0070673_100834923 Ga0070673_1008349231 94
189 3300005365 Ga0070688_100266026 Ga0070688_1002660262 94
190 3300005365 Ga0070688_100470671 Ga0070688_1004706711 94
191 3300005439 Ga0070711_101780656 Ga0070711_1017806561 94
192 3300005457 Ga0070662_101448592 Ga0070662_1014485922 94
193 3300005458 Ga0070681_10734170 Ga0070681_107341701 94
194 3300005458 Ga0070681_11075410 Ga0070681_110754101 94
195 3300005459 Ga0068867_100120537 Ga0068867_1001205372 94
196 3300005530 Ga0070679_100110609 Ga0070679_1001106092 94
197 3300005535 Ga0070684_101338620 Ga0070684_1013386201 94
198 3300005539 Ga0068853_100125341 Ga0068853_1001253414 94
199 3300005543 Ga0070672_100689907 Ga0070672_1006899071 94
200 3300005549 Ga0070704_101693036 Ga0070704_1016930362 94
201 3300005563 Ga0068855_100006123 Ga0068855_10000612311 94
202 3300005577 Ga0068857_100000308 Ga0068857_10000030822 94
203 3300005578 Ga0068854_100251591 Ga0068854_1002515912 94
204 3300005614 Ga0068856_100029852 Ga0068856_1000298524 94
205 3300005614 Ga0068856_100194324 Ga0068856_1001943243 94
206 3300005614 Ga0068856_101719051 Ga0068856_1017190511 94
207 3300005616 Ga0068852_100075858 Ga0068852_1000758584 94
208 3300005617 Ga0068859_100959009 Ga0068859_1009590093 94
209 3300005719 Ga0068861_101366400 Ga0068861_1013664002 94
210 3300005843 Ga0068860_100017463 Ga0068860_1000174632 94
211 3300005844 Ga0068862_100498016 Ga0068862_1004980162 94
212 3300006237 Ga0097621_100417224 Ga0097621_1004172242 94
213 3300006358 Ga0068871_100335766 Ga0068871_1003357662 94
214 3300006358 Ga0068871_100477813 Ga0068871_1004778133 94
215 3300006844 Ga0075428_100103007 Ga0075428_1001030071 94
216 3300006847 Ga0075431_100004624 Ga0075431_10000462412 94
217 3300006880 Ga0075429_100069117 Ga0075429_1000691172 94
218 3300006931 Ga0097620_100959264 Ga0097620_1009592643 94
219 3300009093 Ga0105240_10014456 Ga0105240_100144564 94
220 3300009093 Ga0105240_10026640 Ga0105240_100266402 94
221 3300009093 Ga0105240_10113772 Ga0105240_101137725 94
222 3300009093 Ga0105240_10506520 Ga0105240_105065202 94
223 3300009094 Ga0111539_10181440 Ga0111539_101814402 94
224 3300009101 Ga0105247_10128752 Ga0105247_101287522 94
225 3300009147 Ga0114129_10035352 Ga0114129_100353522 94
226 3300009174 Ga0105241_11234135 Ga0105241_112341351 94
227 3300009176 Ga0105242_10485928 Ga0105242_104859282 94
228 3300009176 Ga0105242_10692482 Ga0105242_106924823 94
229 3300009176 Ga0105242_11378478 Ga0105242_113784781 94
230 3300009545 Ga0105237_10002084 Ga0105237_100020845 94
231 3300009545 Ga0105237_10054325 Ga0105237_100543252 94
232 3300009545 Ga0105237_12636225 Ga0105237_126362251 94
233 3300009551 Ga0105238_10286040 Ga0105238_102860402 94
234 3300009551 Ga0105238_12817882 Ga0105238_128178821 94
235 3300010375 Ga0105239_10024227 Ga0105239_100242276 94
236 3300010375 Ga0105239_10115101 Ga0105239_101151012 94
237 3300013100 Ga0157373_10083773 Ga0157373_100837732 94
238 3300013100 Ga0157373_10161279 Ga0157373_101612793 94
239 3300013102 Ga0157371_10277757 Ga0157371_102777572 94
240 3300013104 Ga0157370_10024115 Ga0157370_100241155 94
241 3300013104 Ga0157370_10112289 Ga0157370_101122892 94
242 3300013104 Ga0157370_10557954 Ga0157370_105579543 94
243 3300013104 Ga0157370_11543916 Ga0157370_115439162 94
244 3300013105 Ga0157369_10414082 Ga0157369_104140822 94
245 3300013105 Ga0157369_10430931 Ga0157369_104309313 94
246 3300013105 Ga0157369_10899353 Ga0157369_108993532 94
247 3300013296 Ga0157374_10580127 Ga0157374_105801271 94
248 3300013296 Ga0157374_11996546 Ga0157374_119965461 94
249 3300013296 Ga0157374_12687502 Ga0157374_126875022 94
250 3300013297 Ga0157378_12098183 Ga0157378_120981831 94
251 3300013306 Ga0163162_11694895 Ga0163162_116948951 94
252 3300013306 Ga0163162_11752364 Ga0163162_117523642 94
253 3300013307 Ga0157372_10000080 Ga0157372_1000008060 94
254 3300013307 Ga0157372_10710690 Ga0157372_107106902 94
255 3300013307 Ga0157372_11496628 Ga0157372_114966281 94
256 3300014325 Ga0163163_10544484 Ga0163163_105444843 94
257 3300014326 Ga0157380_10497350 Ga0157380_104973502 94
258 3300014968 Ga0157379_10938378 Ga0157379_109383782 94
259 3300014968 Ga0157379_11332084 Ga0157379_113320842 94
260 3300014969 Ga0157376_10635325 Ga0157376_106353251 94
261 3300017792 Ga0163161_10209651 Ga0163161_102096512 94
262 3300020078 Ga0206352_11229666 Ga0206352_112296661 94
263 3300021384 Ga0213876_10007925 Ga0213876_100079253 94
264 3300021384 Ga0213876_10090628 Ga0213876_100906282 94
265 3300025904 Ga0207647_10008966 Ga0207647_100089664 94
266 3300025909 Ga0207705_10298815 Ga0207705_102988152 94
267 3300025911 Ga0207654_10149979 Ga0207654_101499794 94
268 3300025912 Ga0207707_10451160 Ga0207707_104511603 94
269 3300025912 Ga0207707_11612588 Ga0207707_116125882 94
270 3300025913 Ga0207695_10000248 Ga0207695_10000248123 94
271 3300025913 Ga0207695_10052136 Ga0207695_100521365 94
272 3300025913 Ga0207695_10061832 Ga0207695_100618323 94
273 3300025914 Ga0207671_10001661 Ga0207671_1000166120 94
274 3300025917 Ga0207660_10242324 Ga0207660_102423243 94
275 3300025920 Ga0207649_10434596 Ga0207649_104345962 94
276 3300025920 Ga0207649_11015709 Ga0207649_110157092 94
277 3300025921 Ga0207652_10122515 Ga0207652_101225152 94
278 3300025924 Ga0207694_10284236 Ga0207694_102842362 94
279 3300025924 Ga0207694_10596242 Ga0207694_105962422 94
280 3300025925 Ga0207650_10652750 Ga0207650_106527502 94
281 3300025926 Ga0207659_10105800 Ga0207659_101058002 94
282 3300025944 Ga0207661_10009210 Ga0207661_100092107 94
283 3300025949 Ga0207667_10000270 Ga0207667_1000027011 94
284 3300025949 Ga0207667_10000445 Ga0207667_1000044538 94
285 3300025960 Ga0207651_10958492 Ga0207651_109584922 94
286 3300025981 Ga0207640_10006821 Ga0207640_100068216 94
287 3300025981 Ga0207640_10294711 Ga0207640_102947112 94
288 3300025986 Ga0207658_10380405 Ga0207658_103804053 94
289 3300026041 Ga0207639_10031875 Ga0207639_100318752 94
290 3300026078 Ga0207702_10162137 Ga0207702_101621373 94
291 3300026078 Ga0207702_11432715 Ga0207702_114327151 94
292 3300026088 Ga0207641_10395709 Ga0207641_103957093 94
293 3300026089 Ga0207648_10052560 Ga0207648_100525603 94
294 3300026089 Ga0207648_10178766 Ga0207648_101787664 94
295 3300026116 Ga0207674_10001573 Ga0207674_1000157322 94
296 3300026142 Ga0207698_10598549 Ga0207698_105985492 94
297 3300026142 Ga0207698_11147594 Ga0207698_111475942 94
298 3300027876 Ga0209974_10032756 Ga0209974_100327563 94
299 3300028380 Ga0268265_10389499 Ga0268265_103894992 94
300 3300028381 Ga0268264_10018324 Ga0268264_100183245 94
301 3300028786 Ga0307517_10507214 Ga0307517_105072141 94
302 3300030521 Ga0307511_10000509 Ga0307511_1000050914 94
303 3300031852 Ga0307410_11296601 Ga0307410_112966011 94
304 3300033180 Ga0307510_10002732 Ga0307510_100027322 94
305 3300033180 Ga0307510_10104605 Ga0307510_101046053 94
306 3300039437 Ga0436365_1777169 Ga0436365_1777169_23414_23698 94
307 3300041452 Ga0451793_1543048 Ga0451793_1543048_36_320 94
308 3300046507 Ga0495606_0005088 Ga0495606_0005088_4576_4860 94
309 3300046648 Ga0495611_0000079 Ga0495611_0000079_40536_40820 94
310 3300047472 Ga0495686_0000005 Ga0495686_0000005_90311_90595 94
311 3300048912 Ga0496109_1820014 Ga0496109_1820014_72_356 94
312 3300049570 Ga0501033_0688616 Ga0501033_0688616_87_371 94
313 3300049580 Ga0501046_1026497 Ga0501046_1026497_203_487 94
314 3300049581 Ga0501047_1246314 Ga0501047_1246314_65_349 94
315 3300049582 Ga0501048_0616881 Ga0501048_0616881_62_346 94
316 3300049583 Ga0501067_0005028 Ga0501067_0005028_1823_2107 94
317 3300049584 Ga0501068_0216776 Ga0501068_0216776_678_962 94
318 3300049585 Ga0501069_0117805 Ga0501069_0117805_554_838 94
319 3300049586 Ga0501070_0075994 Ga0501070_0075994_1770_2054 94
320 3300049588 Ga0501072_0350103 Ga0501072_0350103_831_1115 94
321 3300049589 Ga0501073_0058667 Ga0501073_0058667_2075_2359 94
322 3300049592 Ga0501076_0153833 Ga0501076_0153833_1292_1576 94
323 3300049656 Ga0501209_269311 Ga0501209_269311_122_409 94
324 3300049741 Ga0501079_0101000 Ga0501079_0101000_1144_1428 94
325 3300049744 Ga0501083_0270470 Ga0501083_0270470_715_999 94
326 3300049765 Ga0501268_051824 Ga0501268_051824_158_445 94
327 3300049767 Ga0501270_067199 Ga0501270_067199_276_563 94
328 3300050508 nmdc:mga09592_38283_c1 nmdc:mga09592_38283_c1_877_1164 94
329 3300050510 nmdc:mga06r32_7793_c1 nmdc:mga06r32_7793_c1_8312_8599 94
330 3300050511 nmdc:mga08y16_64205_c1 nmdc:mga08y16_64205_c1_1605_1892 94
331 3300053092 Ga0500583_0206625 Ga0500583_0206625_447_731 94
332 3300053129 Ga0500628_247282 Ga0500628_247282_218_502 94
333 3300053146 Ga0500588_0079748 Ga0500588_0079748_430_714 94
334 3300053178 Ga0500637_0016380 Ga0500637_0016380_653_937 94
335 3300054114 Ga0501084_0039744 Ga0501084_0039744_1760_2044 94
336 3300060353 Ga0501082_0083200 Ga0501082_0083200_1221_1505 94
337 3300005328 Ga0070676_10729744 Ga0070676_107297441 95
338 3300005334 Ga0068869_100021181 Ga0068869_1000211815 95
339 3300005335 Ga0070666_10020916 Ga0070666_100209164 95
340 3300005338 Ga0068868_100459852 Ga0068868_1004598521 95
341 3300005353 Ga0070669_101140873 Ga0070669_1011408731 95
342 3300005355 Ga0070671_100091589 Ga0070671_1000915894 95
343 3300005367 Ga0070667_100012426 Ga0070667_1000124267 95
344 3300005367 Ga0070667_100331808 Ga0070667_1003318082 95
345 3300005367 Ga0070667_101562627 Ga0070667_1015626271 95
346 3300005456 Ga0070678_100074786 Ga0070678_1000747862 95
347 3300005459 Ga0068867_100077618 Ga0068867_1000776181 95
348 3300005459 Ga0068867_100104556 Ga0068867_1001045562 95
349 3300005539 Ga0068853_100200406 Ga0068853_1002004062 95
350 3300005543 Ga0070672_100357007 Ga0070672_1003570071 95
351 3300005543 Ga0070672_100659244 Ga0070672_1006592443 95
352 3300005544 Ga0070686_100554436 Ga0070686_1005544361 95
353 3300005548 Ga0070665_101258307 Ga0070665_1012583072 95
354 3300005548 Ga0070665_101833898 Ga0070665_1018338981 95
355 3300005578 Ga0068854_101223445 Ga0068854_1012234452 95
356 3300005615 Ga0070702_101578300 Ga0070702_1015783001 95
357 3300005616 Ga0068852_100999417 Ga0068852_1009994172 95
358 3300005617 Ga0068859_100974498 Ga0068859_1009744982 95
359 3300005718 Ga0068866_10017666 Ga0068866_100176665 95
360 3300005718 Ga0068866_10312573 Ga0068866_103125732 95
361 3300005719 Ga0068861_102471417 Ga0068861_1024714171 95
362 3300005842 Ga0068858_100147646 Ga0068858_1001476462 95
363 3300005843 Ga0068860_101076962 Ga0068860_1010769622 95
364 3300006195 Ga0075366_10694277 Ga0075366_106942772 95
365 3300006237 Ga0097621_100000427 Ga0097621_10000042715 95
366 3300006358 Ga0068871_100005204 Ga0068871_1000052046 95
367 3300006931 Ga0097620_100974348 Ga0097620_1009743482 95
368 3300009148 Ga0105243_10792888 Ga0105243_107928883 95
369 3300009176 Ga0105242_10078923 Ga0105242_100789232 95
370 3300009176 Ga0105242_10236935 Ga0105242_102369353 95
371 3300009177 Ga0105248_10215588 Ga0105248_102155883 95
372 3300013296 Ga0157374_10279670 Ga0157374_102796704 95
373 3300013297 Ga0157378_10015576 Ga0157378_100155765 95
374 3300013297 Ga0157378_10176468 Ga0157378_101764683 95
375 3300013297 Ga0157378_11479715 Ga0157378_114797152 95
376 3300013306 Ga0163162_10001002 Ga0163162_1000100222 95
377 3300013308 Ga0157375_10000186 Ga0157375_1000018625 95
378 3300014968 Ga0157379_10006059 Ga0157379_100060594 95
379 3300014969 Ga0157376_10000101 Ga0157376_1000010147 95
380 3300017792 Ga0163161_10016541 Ga0163161_100165411 95
381 3300025899 Ga0207642_10010211 Ga0207642_100102112 95
382 3300025899 Ga0207642_10243405 Ga0207642_102434051 95
383 3300025903 Ga0207680_10069908 Ga0207680_100699082 95
384 3300025923 Ga0207681_10276840 Ga0207681_102768402 95
385 3300025931 Ga0207644_10077904 Ga0207644_100779042 95
386 3300025934 Ga0207686_10052274 Ga0207686_100522742 95
387 3300025934 Ga0207686_10263922 Ga0207686_102639222 95
388 3300025940 Ga0207691_10717495 Ga0207691_107174951 95
389 3300025942 Ga0207689_10119101 Ga0207689_101191012 95
390 3300025972 Ga0207668_10182274 Ga0207668_101822743 95
391 3300025981 Ga0207640_10613544 Ga0207640_106135441 95
392 3300025986 Ga0207658_10022044 Ga0207658_100220445 95
393 3300026035 Ga0207703_10216645 Ga0207703_102166452 95
394 3300026067 Ga0207678_11177985 Ga0207678_111779851 95
395 3300026089 Ga0207648_10023926 Ga0207648_100239265 95
396 3300026089 Ga0207648_10122941 Ga0207648_101229412 95
397 3300026118 Ga0207675_100514416 Ga0207675_1005144163 95
398 3300041443 Ga0451789_0151170 Ga0451789_0151170_214_501 95
399 3300042007 Ga0439449_0375570 Ga0439449_0375570_59_346 95
400 3300042876 Ga0451577_0170800 Ga0451577_0170800_717_1004 95
401 3300044712 Ga0453684_0295910 Ga0453684_0295910_75_362 95
402 3300048904 Ga0496101_0030909 Ga0496101_0030909_2119_2406 95
403 3300048909 Ga0496106_0046633 Ga0496106_0046633_2014_2301 95
404 3300048917 Ga0496114_0104385 Ga0496114_0104385_1522_1809 95
405 3300049569 Ga0501032_0006965 Ga0501032_0006965_2836_3126 95
406 3300049570 Ga0501033_0011263 Ga0501033_0011263_1699_1989 95
407 3300049571 Ga0501034_0001891 Ga0501034_0001891_11881_12171 95
408 3300049571 Ga0501034_0024251 Ga0501034_0024251_3096_3383 95
409 3300049571 Ga0501034_0609167 Ga0501034_0609167_369_659 95
410 3300049572 Ga0501036_0289209 Ga0501036_0289209_442_732 95
411 3300049573 Ga0501037_0004781 Ga0501037_0004781_4862_5152 95
412 3300049573 Ga0501037_0215761 Ga0501037_0215761_720_1007 95
413 3300049574 Ga0501038_0513286 Ga0501038_0513286_301_591 95
414 3300049579 Ga0501043_0019373 Ga0501043_0019373_2407_2697 95
415 3300049579 Ga0501043_0442803 Ga0501043_0442803_217_507 95
416 3300049581 Ga0501047_0003037 Ga0501047_0003037_11390_11680 95
417 3300049590 Ga0501074_0753985 Ga0501074_0753985_104_391 95
418 3300049822 Ga0501035_0014156 Ga0501035_0014156_2645_2935 95
419 3300049822 Ga0501035_0615308 Ga0501035_0615308_526_813 95
420 3300049823 Ga0501044_0004145 Ga0501044_0004145_1740_2030 95
421 3300049823 Ga0501044_0005264 Ga0501044_0005264_13784_14071 95
422 3300049823 Ga0501044_1005732 Ga0501044_1005732_119_406 95
423 3300050493 nmdc:mga0k408_343249_c1 nmdc:mga0k408_343249_c1_552_839 95
424 3300003316 rootH1_10070623 rootH1_100706234 96
425 3300003320 rootH2_10111024 rootH2_101110249 96
426 3300003322 rootL2_10378854 rootL2_103788541 96
427 3300003323 rootH1_10015941 rootH1_1001594119 96
428 3300003323 rootH1_10068884 rootH1_100688842 96
429 3300003323 rootH1_10068885 rootH1_100688853 96
430 3300005328 Ga0070676_10036554 Ga0070676_100365544 96
431 3300005329 Ga0070683_101874058 Ga0070683_1018740581 96
432 3300005331 Ga0070670_100154741 Ga0070670_1001547412 96
433 3300005331 Ga0070670_100846495 Ga0070670_1008464951 96
434 3300005335 Ga0070666_10248842 Ga0070666_102488422 96
435 3300005347 Ga0070668_102121622 Ga0070668_1021216221 96
436 3300005355 Ga0070671_100243705 Ga0070671_1002437051 96
437 3300005356 Ga0070674_100768031 Ga0070674_1007680311 96
438 3300005364 Ga0070673_101715803 Ga0070673_1017158031 96
439 3300005437 Ga0070710_10558960 Ga0070710_105589601 96
440 3300005455 Ga0070663_100263880 Ga0070663_1002638802 96
441 3300005456 Ga0070678_100277927 Ga0070678_1002779273 96
442 3300005457 Ga0070662_101150742 Ga0070662_1011507422 96
443 3300005459 Ga0068867_100081775 Ga0068867_1000817753 96
444 3300005459 Ga0068867_100249900 Ga0068867_1002499004 96
445 3300005459 Ga0068867_102310520 Ga0068867_1023105201 96
446 3300005539 Ga0068853_100080995 Ga0068853_1000809953 96
447 3300005539 Ga0068853_101474469 Ga0068853_1014744691 96
448 3300005543 Ga0070672_100048947 Ga0070672_1000489472 96
449 3300005543 Ga0070672_100332958 Ga0070672_1003329582 96
450 3300005563 Ga0068855_100007114 Ga0068855_10000711415 96
451 3300005564 Ga0070664_101029227 Ga0070664_1010292272 96
452 3300005577 Ga0068857_100239428 Ga0068857_1002394282 96
453 3300005614 Ga0068856_100004623 Ga0068856_10000462312 96
454 3300005616 Ga0068852_100539884 Ga0068852_1005398841 96
455 3300005616 Ga0068852_102041184 Ga0068852_1020411841 96
456 3300005616 Ga0068852_102202948 Ga0068852_1022029481 96
457 3300005618 Ga0068864_100147461 Ga0068864_1001474612 96
458 3300005618 Ga0068864_100215546 Ga0068864_1002155462 96
459 3300005719 Ga0068861_101592253 Ga0068861_1015922531 96
460 3300005840 Ga0068870_10355160 Ga0068870_103551603 96
461 3300005841 Ga0068863_100542225 Ga0068863_1005422253 96
462 3300005841 Ga0068863_101006800 Ga0068863_1010068001 96
463 3300005843 Ga0068860_100001323 Ga0068860_1000013237 96
464 3300005843 Ga0068860_100030211 Ga0068860_1000302114 96
465 3300005843 Ga0068860_100331406 Ga0068860_1003314063 96
466 3300006195 Ga0075366_10129343 Ga0075366_101293432 96
467 3300006195 Ga0075366_10301876 Ga0075366_103018762 96
468 3300006195 Ga0075366_10761823 Ga0075366_107618232 96
469 3300006237 Ga0097621_100796894 Ga0097621_1007968941 96
470 3300006237 Ga0097621_101888816 Ga0097621_1018888161 96
471 3300006353 Ga0075370_10806042 Ga0075370_108060421 96
472 3300006358 Ga0068871_100021743 Ga0068871_1000217433 96
473 3300006358 Ga0068871_100348038 Ga0068871_1003480381 96
474 3300009093 Ga0105240_10503751 Ga0105240_105037513 96
475 3300009094 Ga0111539_12679931 Ga0111539_126799311 96
476 3300009147 Ga0114129_10001029 Ga0114129_1000102924 96
477 3300009174 Ga0105241_10015527 Ga0105241_100155275 96
478 3300009174 Ga0105241_10651034 Ga0105241_106510341 96
479 3300009545 Ga0105237_10111962 Ga0105237_101119621 96
480 3300009553 Ga0105249_10000349 Ga0105249_1000034944 96
481 3300009553 Ga0105249_10156150 Ga0105249_101561503 96
482 3300010375 Ga0105239_10289194 Ga0105239_102891943 96
483 3300010375 Ga0105239_10560562 Ga0105239_105605621 96
484 3300010375 Ga0105239_13644838 Ga0105239_136448381 96
485 3300011119 Ga0105246_10887371 Ga0105246_108873712 96
486 3300013100 Ga0157373_11013944 Ga0157373_110139442 96
487 3300013104 Ga0157370_11684750 Ga0157370_116847502 96
488 3300013105 Ga0157369_11161193 Ga0157369_111611931 96
489 3300013296 Ga0157374_10251304 Ga0157374_102513041 96
490 3300013296 Ga0157374_10972355 Ga0157374_109723551 96
491 3300013306 Ga0163162_10002343 Ga0163162_1000234310 96
492 3300013306 Ga0163162_11197459 Ga0163162_111974592 96
493 3300013307 Ga0157372_10854654 Ga0157372_108546542 96
494 3300013307 Ga0157372_10996772 Ga0157372_109967722 96
495 3300013307 Ga0157372_12397438 Ga0157372_123974381 96
496 3300013307 Ga0157372_13146468 Ga0157372_131464681 96
497 3300013308 Ga0157375_10310507 Ga0157375_103105071 96
498 3300014326 Ga0157380_10249246 Ga0157380_102492461 96
499 3300014326 Ga0157380_12983045 Ga0157380_129830451 96
500 3300014745 Ga0157377_10141335 Ga0157377_101413351 96
501 3300015261 Ga0182006_1193940 Ga0182006_11939401 96
502 3300025242 Ga0209258_116824 Ga0209258_1168242 96
503 3300025246 Ga0209646_1004961 Ga0209646_10049614 96
504 3300025908 Ga0207643_10145614 Ga0207643_101456142 96
505 3300025911 Ga0207654_10051471 Ga0207654_100514712 96
506 3300025913 Ga0207695_10730028 Ga0207695_107300282 96
507 3300025914 Ga0207671_10150150 Ga0207671_101501501 96
508 3300025916 Ga0207663_11420920 Ga0207663_114209202 96
509 3300025923 Ga0207681_11127383 Ga0207681_111273831 96
510 3300025925 Ga0207650_10127474 Ga0207650_101274742 96
511 3300025925 Ga0207650_10153052 Ga0207650_101530522 96
512 3300025926 Ga0207659_10452958 Ga0207659_104529582 96
513 3300025931 Ga0207644_10124235 Ga0207644_101242352 96
514 3300025937 Ga0207669_10401549 Ga0207669_104015493 96
515 3300025938 Ga0207704_10466975 Ga0207704_104669752 96
516 3300025940 Ga0207691_10033525 Ga0207691_100335253 96
517 3300025942 Ga0207689_10392348 Ga0207689_103923483 96
518 3300025945 Ga0207679_12096722 Ga0207679_120967221 96
519 3300025949 Ga0207667_10019461 Ga0207667_100194616 96
520 3300025961 Ga0207712_10004215 Ga0207712_100042152 96
521 3300025961 Ga0207712_10095109 Ga0207712_100951092 96
522 3300025972 Ga0207668_11720440 Ga0207668_117204402 96
523 3300025981 Ga0207640_11334486 Ga0207640_113344861 96
524 3300026041 Ga0207639_10053121 Ga0207639_100531213 96
525 3300026041 Ga0207639_11031768 Ga0207639_110317682 96
526 3300026041 Ga0207639_12306295 Ga0207639_123062952 96
527 3300026067 Ga0207678_10329049 Ga0207678_103290491 96
528 3300026078 Ga0207702_10197512 Ga0207702_101975121 96
529 3300026088 Ga0207641_10025588 Ga0207641_100255886 96
530 3300026088 Ga0207641_10373000 Ga0207641_103730003 96
531 3300026088 Ga0207641_10904047 Ga0207641_109040472 96
532 3300026089 Ga0207648_10023153 Ga0207648_100231535 96
533 3300026089 Ga0207648_10365359 Ga0207648_103653591 96
534 3300026089 Ga0207648_10399288 Ga0207648_103992882 96
535 3300026095 Ga0207676_10259123 Ga0207676_102591234 96
536 3300026095 Ga0207676_11463483 Ga0207676_114634832 96
537 3300026095 Ga0207676_11523448 Ga0207676_115234481 96
538 3300026116 Ga0207674_10069258 Ga0207674_100692585 96
539 3300026116 Ga0207674_10752839 Ga0207674_107528393 96
540 3300026118 Ga0207675_100256249 Ga0207675_1002562494 96
541 3300026118 Ga0207675_101333339 Ga0207675_1013333391 96
542 3300026118 Ga0207675_102330024 Ga0207675_1023300241 96
543 3300026121 Ga0207683_10243011 Ga0207683_102430112 96
544 3300026142 Ga0207698_10313756 Ga0207698_103137563 96
545 3300028381 Ga0268264_10008251 Ga0268264_100082516 96
546 3300028381 Ga0268264_10046776 Ga0268264_100467762 96
547 3300028381 Ga0268264_10819251 Ga0268264_108192512 96
548 3300031251 Ga0265327_10115167 Ga0265327_101151672 96
549 3300031456 Ga0307513_10645887 Ga0307513_106458872 96
550 3300031824 Ga0307413_10610866 Ga0307413_106108661 96
551 3300032005 Ga0307411_11391725 Ga0307411_113917252 96
552 3300035695 Ga0373927_1199713 Ga0373927_1199713_38_328 96
553 3300041404 Ga0439436_0000727 Ga0439436_0000727_3112_3447 96
554 3300041406 Ga0439439_0013927 Ga0439439_0013927_1380_1715 96
555 3300041406 Ga0439439_0076545 Ga0439439_0076545_479_808 96
556 3300041459 Ga0451800_1122242 Ga0451800_1122242_222_512 96
557 3300041486 Ga0451807_0297254 Ga0451807_0297254_58_363 96
558 3300041498 Ga0451841_1070416 Ga0451841_1070416_86_376 96
559 3300041507 Ga0451851_0769739 Ga0451851_0769739_210_500 96
560 3300041512 Ga0451853_1888255 Ga0451853_1888255_327_617 96
561 3300042007 Ga0439449_0019598 Ga0439449_0019598_650_979 96
562 3300042007 Ga0439449_0238131 Ga0439449_0238131_286_621 96
563 3300042014 Ga0439457_031465 Ga0439457_031465_556_891 96
564 3300042015 Ga0439462_0000406 Ga0439462_0000406_5432_5767 96
565 3300044656 Ga0466969_0000004 Ga0466969_0000004_152019_152348 96
566 3300044656 Ga0466969_0091596 Ga0466969_0091596_300_629 96
567 3300044658 Ga0466972_0000395 Ga0466972_0000395_4417_4707 96
568 3300044658 Ga0466972_0107997 Ga0466972_0107997_924_1214 96
569 3300044684 Ga0466966_0104212 Ga0466966_0104212_928_1257 96
570 3300044693 Ga0466961_0432779 Ga0466961_0432779_342_671 96
571 3300044706 Ga0466964_0043385 Ga0466964_0043385_1295_1624 96
572 3300044719 Ga0466971_0580598 Ga0466971_0580598_11_340 96
573 3300044735 Ga0466968_0036066 Ga0466968_0036066_709_1038 96
574 3300044842 Ga0466957_0004957 Ga0466957_0004957_594_884 96
575 3300044842 Ga0466957_0046684 Ga0466957_0046684_1130_1420 96
576 3300044901 Ga0466960_0325194 Ga0466960_0325194_441_731 96
577 3300045049 Ga0466959_0000004 Ga0466959_0000004_115599_115928 96
578 3300046519 Ga0495632_0471791 Ga0495632_0471791_187_522 96
579 3300046616 Ga0495668_0000685 Ga0495668_0000685_26009_26302 96
580 3300046660 Ga0495625_0911790 Ga0495625_0911790_116_406 96
581 3300047472 Ga0495686_0628074 Ga0495686_0628074_246_536 96
582 3300049569 Ga0501032_0038126 Ga0501032_0038126_329_625 96
583 3300049570 Ga0501033_0926165 Ga0501033_0926165_258_554 96
584 3300049571 Ga0501034_0111926 Ga0501034_0111926_1275_1571 96
585 3300049572 Ga0501036_0030850 Ga0501036_0030850_2861_3157 96
586 3300049573 Ga0501037_0007419 Ga0501037_0007419_1181_1477 96
587 3300049574 Ga0501038_0030182 Ga0501038_0030182_2731_3027 96
588 3300049574 Ga0501038_0665501 Ga0501038_0665501_353_649 96
589 3300049575 Ga0501039_0095622 Ga0501039_0095622_1937_2233 96
590 3300049579 Ga0501043_0009692 Ga0501043_0009692_4792_5088 96
591 3300049579 Ga0501043_0780700 Ga0501043_0780700_349_645 96
592 3300049580 Ga0501046_0003336 Ga0501046_0003336_2239_2535 96
593 3300049581 Ga0501047_0002513 Ga0501047_0002513_242_538 96
594 3300049582 Ga0501048_0101204 Ga0501048_0101204_335_631 96
595 3300049583 Ga0501067_0002016 Ga0501067_0002016_1217_1513 96
596 3300049584 Ga0501068_0088935 Ga0501068_0088935_1135_1431 96
597 3300049590 Ga0501074_0005676 Ga0501074_0005676_1275_1571 96
598 3300049593 Ga0501077_0865200 Ga0501077_0865200_43_339 96
599 3300049687 Ga0501258_069604 Ga0501258_069604_60_389 96
600 3300049703 Ga0501219_000066 Ga0501219_000066_6511_6846 96
601 3300049741 Ga0501079_0302360 Ga0501079_0302360_268_564 96
602 3300049744 Ga0501083_0007950 Ga0501083_0007950_6828_7124 96
603 3300049758 Ga0501241_018782 Ga0501241_018782_174_509 96
604 3300049822 Ga0501035_0065490 Ga0501035_0065490_250_546 96
605 3300049822 Ga0501035_0795376 Ga0501035_0795376_388_720 96
606 3300049823 Ga0501044_0004121 Ga0501044_0004121_2650_2946 96
607 3300049824 Ga0501045_0629780 Ga0501045_0629780_197_493 96
608 3300050005 Ga0501284_00018 Ga0501284_00018_11707_12042 96
609 3300050493 nmdc:mga0k408_353356_c1 nmdc:mga0k408_353356_c1_28_357 96
610 3300050493 nmdc:mga0k408_630225_c1 nmdc:mga0k408_630225_c1_262_552 96
611 3300050507 nmdc:mga05p37_1343_c1 nmdc:mga05p37_1343_c1_8801_9136 96
612 3300053086 Ga0500578_0000037 Ga0500578_0000037_33784_34074 96
613 3300053086 Ga0500578_0253116 Ga0500578_0253116_67_357 96
614 3300053088 Ga0500644_0051565 Ga0500644_0051565_910_1239 96
615 3300053090 Ga0500646_0009166 Ga0500646_0009166_2032_2322 96
616 3300053092 Ga0500583_0000089 Ga0500583_0000089_28020_28355 96
617 3300053092 Ga0500583_0006034 Ga0500583_0006034_1448_1738 96
618 3300053093 Ga0500651_0378178 Ga0500651_0378178_142_471 96
619 3300053103 Ga0500555_016078 Ga0500555_016078_1323_1652 96
620 3300053104 Ga0500556_0086798 Ga0500556_0086798_306_635 96
621 3300053130 Ga0500642_0064098 Ga0500642_0064098_979_1269 96
622 3300053134 Ga0500658_0126247 Ga0500658_0126247_305_595 96
623 3300053136 Ga0500559_0059922 Ga0500559_0059922_710_1000 96
624 3300053136 Ga0500559_0467521 Ga0500559_0467521_63_353 96
625 3300053137 Ga0500561_0134710 Ga0500561_0134710_44_334 96
626 3300053147 Ga0500589_049400 Ga0500589_049400_639_929 96
627 3300053147 Ga0500589_209137 Ga0500589_209137_391_720 96
628 3300053151 Ga0500604_0127854 Ga0500604_0127854_34_324 96
629 3300053156 Ga0500622_0033454 Ga0500622_0033454_2308_2598 96
630 3300053160 Ga0500633_0186406 Ga0500633_0186406_208_498 96
631 3300053163 Ga0500639_048361 Ga0500639_048361_255_545 96
632 3300053177 Ga0500636_0035574 Ga0500636_0035574_924_1214 96
633 3300053177 Ga0500636_0069011 Ga0500636_0069011_1257_1547 96
634 3300053178 Ga0500637_0279934 Ga0500637_0279934_56_346 96
635 3300053178 Ga0500637_0410391 Ga0500637_0410391_170_460 96
636 3300053727 Ga0500611_009565 Ga0500611_009565_462_752 96
637 3300061719 Ga0466962_0396685 Ga0466962_0396685_340_669 96
638 2088090003 LJN_F7QKVOU01D7WOY LJN_03667110 97
639 3300044712 Ga0453684_0335704 Ga0453684_0335704_655_957 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05164

ZapA

Cell division protein ZapA

22

108

0.79

Feature Viewer

pLDDT pTM Quality
80.28 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map