F471446

General Info

Members Datasets Scaffolds Average Seq Length
637 473 370 292

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0561599|Ga0436365_0561599_308_1258
Length 316
Sequence LSIRARGEGRVSVALERPRAGLREWLLAEVPRSRLQARLGAAYATWLVFRRNRLAVVGLAIVVLLVLTAALAPLLGAGAAFEQDLAQRLVPPSAAHWFGTDDLGRDIFARVVAGSRVTLFIIALVAVIVGPLGLVIGTVSGYAGGIVDVVLMRVTDIFMAFPRLVLALALVAALKPGIENAVLAIAVTTWPPYARIARAETITLREAEFILAAKLQGASMFRILRRHIVPLCLSSVIVRLTLDMAGVILTAAGLGFLGLGAQPPTPEWGAMVAGGRQFIIDQWWVATIPGAAIFVVSLGFNLLGDGLRDVLDPKRG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
12 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
17 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
18 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
19 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
20 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
21 2643221558 Rhizobium sp. Root149 Isolate Unclassified
22 2643221568 Rhizobium sp. Root564 Isolate Unclassified
23 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
24 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
25 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
26 2643221693 Rhizobium sp. Root491 Isolate Unclassified
27 2643221719 Rhizobium sp. Root274 Isolate Unclassified
28 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
29 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
30 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
31 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
32 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
33 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
34 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
35 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
36 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
37 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
38 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
39 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
40 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
41 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
42 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
43 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
44 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
45 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
46 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
47 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
48 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
49 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
50 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
51 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
52 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
53 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
54 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
55 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
56 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
57 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
58 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
59 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
60 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
61 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
62 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
63 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
64 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
65 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
66 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
67 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
68 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
69 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
70 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
71 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
72 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
73 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
74 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
75 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
76 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
77 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
78 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
79 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
80 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
81 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
82 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
83 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
84 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
85 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
86 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
87 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
88 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
89 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
90 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
91 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
92 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
93 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
94 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
95 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
96 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
97 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
98 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
99 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
100 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
101 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
102 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
103 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
104 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
105 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
106 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
107 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
108 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
109 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
110 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
111 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
112 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
113 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
114 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
115 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
116 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
117 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
118 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
119 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
120 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
121 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
122 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
123 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
124 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
125 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
126 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
127 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
128 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
129 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
130 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
131 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
132 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
133 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
134 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
135 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
136 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
137 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
138 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
139 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
140 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
141 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
142 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
143 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
144 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
145 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
146 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
147 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
148 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
149 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
150 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
151 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
152 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
153 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
154 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
155 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
156 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
157 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
158 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
159 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
160 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
161 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
162 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
163 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
164 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
165 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
166 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
167 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
168 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
169 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
170 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
171 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
172 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
173 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
174 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
175 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
176 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
177 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
178 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
179 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
180 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
181 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
182 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
183 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
184 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
185 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
186 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
187 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
188 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
189 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
190 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
191 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
192 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
193 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
194 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
195 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
196 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
197 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
198 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
199 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
200 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
201 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
202 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
203 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
204 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
205 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
206 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
207 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
208 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
209 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
210 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
211 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
212 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
213 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
214 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
215 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
216 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
217 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
218 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
219 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
220 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
221 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
222 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
223 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
224 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
225 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
226 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
227 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
228 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
229 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
230 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
231 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
232 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
233 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
234 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
235 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
236 3004167301 Mesorhizobium loti 582 Isolate Unclassified
237 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
238 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
239 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
240 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
241 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
242 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
243 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
244 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
245 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
246 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
247 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
248 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
249 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
250 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
251 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
252 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
253 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
254 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
255 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
256 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
257 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
258 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
259 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
260 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
261 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
262 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
263 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
264 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
265 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
266 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
267 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
268 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
269 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
270 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
271 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
272 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
273 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
274 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
275 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
276 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
277 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
278 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
279 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
280 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
281 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
282 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
283 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
284 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
285 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
286 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
287 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
288 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
289 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
290 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
294 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
295 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
296 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
297 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
298 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
299 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
300 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
301 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
302 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
303 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
305 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
306 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
309 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
310 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
335 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
336 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
341 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
342 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
343 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
344 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
345 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
346 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
347 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
348 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
349 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
350 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
351 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
352 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
353 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
354 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
355 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
356 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
357 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
358 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
359 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
360 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
361 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
362 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
363 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
364 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
365 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
366 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
367 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
368 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
369 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
370 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
371 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
372 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
373 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
374 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
375 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
376 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
377 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
378 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
379 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
380 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
384 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
385 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
391 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
397 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
398 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
402 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
422 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
423 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
424 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
425 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
426 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
427 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
433 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
434 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
440 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
441 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
442 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
445 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
446 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
447 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
448 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
449 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
450 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
451 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
455 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
456 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
457 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
458 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
459 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
460 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
461 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
462 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
463 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
464 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
465 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
466 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
467 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
468 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
469 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
470 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
471 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
472 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
473 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.93
Metatranscriptomes 0.16
Isolates 41.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 10.83
Nodule 34.54
Rhizoplane 1.88
Rhizosphere 41.29
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003077 3300002773 Bacteria 5854
2 JGI25152J39213_1005946 3300002773 Bacteria 3431
3 JGI25150J39212_1007349 3300002774 Bacteria 2218
4 JGI25151J46595_10013943 3300003187 Bacteria 3599
5 JGI25165J46597_1000019 3300003214 Bacteria 371528
6 JGI25153J46596_10000042 3300003215 Bacteria 161788
7 JGI25153J46596_10005915 3300003215 Bacteria 6314
8 Ga0055542_1000625 3300003762 Bacteria 29738
9 Ga0055524_1006688 3300003775 Bacteria 4980
10 Ga0055536_1019144 3300003781 Bacteria 2164
11 Ga0055531_10005891 3300003794 Bacteria 7071
12 Ga0065165_1007157 3300005262 Bacteria 5580
13 Ga0070658_10020001 3300005327 Bacteria 5361
14 Ga0070683_100046296 3300005329 Bacteria 4018
15 Ga0068868_100137046 3300005338 Bacteria 2007
16 Ga0070660_100020664 3300005339 Bacteria 4843
17 Ga0070661_100028425 3300005344 Bacteria 4033
18 Ga0070661_100068724 3300005344 Bacteria 2603
19 Ga0070674_100238732 3300005356 Bacteria 1422
20 Ga0070659_100024039 3300005366 Bacteria 4669
21 Ga0070659_100042412 3300005366 Bacteria 3556
22 Ga0070659_100152539 3300005366 Bacteria 1886
23 Ga0070663_100193010 3300005455 Bacteria 1586
24 Ga0070678_100153673 3300005456 Bacteria 1857
25 Ga0070662_100530365 3300005457 Bacteria 985
26 Ga0068867_100125316 3300005459 Bacteria 1990
27 Ga0070707_100077038 3300005468 Bacteria 3217
28 Ga0070684_100026544 3300005535 Bacteria 4881
29 Ga0068853_100045963 3300005539 Bacteria 3742
30 Ga0068853_100106453 3300005539 Bacteria 2485
31 Ga0068853_100264066 3300005539 Bacteria 1583
32 Ga0068853_100403671 3300005539 Bacteria 1279
33 Ga0070665_100076463 3300005548 Bacteria 3355
34 Ga0070665_100163017 3300005548 Bacteria 2231
35 Ga0070665_100235559 3300005548 Bacteria 1831
36 Ga0068855_100024919 3300005563 Bacteria 7158
37 Ga0070664_100087232 3300005564 Bacteria 2698
38 Ga0068857_100009968 3300005577 Bacteria 8248
39 Ga0068854_100015921 3300005578 Bacteria 4997
40 Ga0068854_100276701 3300005578 Bacteria 1350
41 Ga0068854_100380317 3300005578 Bacteria 1163
42 Ga0068856_100029277 3300005614 Bacteria 5379
43 Ga0068852_100005298 3300005616 Bacteria 9209
44 Ga0068852_100176957 3300005616 Bacteria 2004
45 Ga0068852_100246615 3300005616 Bacteria 1709
46 Ga0068852_100289131 3300005616 Bacteria 1583
47 Ga0068852_100360497 3300005616 Bacteria 1422
48 Ga0068852_100378246 3300005616 Bacteria 1389
49 Ga0068860_100137445 3300005843 Bacteria 2347
50 Ga0068862_100021865 3300005844 Bacteria 5348
51 Ga0081455_10006243 3300005937 Bacteria 12830
52 Ga0075365_10006628 3300006038 Bacteria 6391
53 Ga0075365_10013768 3300006038 Bacteria 4851
54 Ga0075365_10043118 3300006038 Bacteria 2952
55 Ga0075365_10133552 3300006038 Bacteria 1719
56 Ga0075365_10138032 3300006038 Bacteria 1691
57 Ga0075365_10247443 3300006038 Bacteria 1252
58 Ga0075368_10044915 3300006042 Bacteria 1744
59 Ga0075364_10062399 3300006051 Bacteria 2445
60 Ga0075362_10060103 3300006177 Bacteria 1717
61 Ga0075367_10002105 3300006178 Bacteria 8932
62 Ga0075367_10160837 3300006178 Bacteria 1396
63 Ga0075370_10041657 3300006353 Bacteria 2592
64 Ga0075370_10076414 3300006353 Bacteria 1920
65 Ga0068865_100150975 3300006881 Bacteria 1763
66 Ga0079104_1000063 3300006946 Bacteria 159519
67 Ga0079104_1003309 3300006946 Bacteria 7646
68 Ga0099826_10112232 3300006948 Bacteria 1622
69 Ga0105240_10126822 3300009093 Bacteria 3065
70 Ga0105240_10182473 3300009093 Bacteria 2475
71 Ga0105240_10524548 3300009093 Bacteria 1314
72 Ga0105247_10256814 3300009101 Bacteria 1197
73 Ga0105237_10009556 3300009545 Bacteria 10382
74 Ga0105237_10094397 3300009545 Bacteria 2980
75 Ga0105238_10002270 3300009551 Bacteria 19365
76 Ga0105238_10118904 3300009551 Bacteria 2623
77 Ga0105239_10012124 3300010375 Bacteria 9611
78 Ga0105239_10050004 3300010375 Bacteria 4584
79 Ga0105239_10094129 3300010375 Bacteria 3309
80 Ga0105239_10419225 3300010375 Bacteria 1516
81 Ga0157371_10000031 3300013102 Bacteria 230441
82 Ga0157371_10078481 3300013102 Bacteria 2339
83 Ga0157370_10044175 3300013104 Bacteria 4284
84 Ga0157369_10080776 3300013105 Bacteria 3480
85 Ga0157369_10141283 3300013105 Bacteria 2548
86 Ga0157369_10314215 3300013105 Bacteria 1629
87 Ga0157374_10283679 3300013296 Bacteria 1635
88 Ga0182008_10015519 3300014497 Bacteria 3973
89 Ga0182008_10087343 3300014497 Bacteria 1536
90 Ga0182008_10162908 3300014497 Bacteria 1123
91 Ga0206353_10362164 3300020082 Bacteria 1131
92 Ga0228711_1000017 3300022739 Bacteria 121084
93 Ga0228710_1000005 3300022740 Bacteria 233531
94 Ga0207425_1000730 3300025245 Bacteria 17415
95 Ga0209148_1000032 3300025254 Bacteria 557660
96 Ga0209129_1000786 3300025258 Bacteria 20051
97 Ga0209233_1000034 3300025261 Bacteria 578898
98 Ga0209233_1005717 3300025261 Bacteria 4099
99 Ga0209233_1022879 3300025261 Bacteria 1592
100 Ga0209455_1000098 3300025272 Bacteria 213890
101 Ga0209676_1002662 3300025292 Bacteria 12128
102 Ga0209025_1012876 3300025294 Bacteria 5316
103 Ga0209758_1000105 3300025297 Bacteria 221415
104 Ga0209758_1000110 3300025297 Bacteria 213110
105 Ga0209758_1000422 3300025297 Bacteria 71804
106 Ga0209050_1007330 3300025298 Bacteria 6215
107 Ga0209257_1002982 3300025304 Bacteria 15409
108 Ga0207656_10022994 3300025321 Bacteria 2506
109 Ga0207647_10097853 3300025904 Bacteria 1744
110 Ga0207645_10066091 3300025907 Bacteria 2312
111 Ga0207645_10109590 3300025907 Bacteria 1786
112 Ga0207654_10008439 3300025911 Bacteria 5209
113 Ga0207695_10042483 3300025913 Bacteria 4855
114 Ga0207695_10068039 3300025913 Bacteria 3650
115 Ga0207695_10282858 3300025913 Bacteria 1552
116 Ga0207671_10062911 3300025914 Bacteria 2757
117 Ga0207671_10112012 3300025914 Bacteria 2077
118 Ga0207657_10029920 3300025919 Bacteria 4949
119 Ga0207657_10074778 3300025919 Bacteria 2860
120 Ga0207649_10045114 3300025920 Bacteria 2701
121 Ga0207694_10013279 3300025924 Bacteria 6201
122 Ga0207694_10142262 3300025924 Bacteria 1929
123 Ga0207694_10404230 3300025924 Bacteria 1136
124 Ga0207694_10475569 3300025924 Bacteria 1045
125 Ga0207690_10042616 3300025932 Bacteria 2982
126 Ga0207706_10098441 3300025933 Bacteria 2573
127 Ga0207669_10425097 3300025937 Bacteria 1047
128 Ga0207665_10180673 3300025939 Bacteria 1528
129 Ga0207679_10336233 3300025945 Bacteria 1312
130 Ga0207667_10013368 3300025949 Bacteria 9394
131 Ga0207667_10110686 3300025949 Bacteria 2833
132 Ga0207640_10061276 3300025981 Bacteria 2491
133 Ga0207639_10056737 3300026041 Bacteria 3003
134 Ga0207639_10061117 3300026041 Bacteria 2908
135 Ga0207639_10155951 3300026041 Bacteria 1918
136 Ga0207702_10009797 3300026078 Bacteria 8036
137 Ga0207702_10085062 3300026078 Bacteria 2755
138 Ga0207702_10095035 3300026078 Bacteria 2618
139 Ga0207648_10173958 3300026089 Bacteria 1904
140 Ga0207674_10006560 3300026116 Bacteria 13688
141 Ga0207683_10264456 3300026121 Bacteria 1571
142 Ga0207698_10016203 3300026142 Bacteria 5016
143 Ga0207698_10025562 3300026142 Bacteria 4162
144 Ga0207698_10107153 3300026142 Bacteria 2332
145 Ga0209281_1000082 3300027111 Bacteria 257684
146 Ga0209281_1000110 3300027111 Bacteria 215631
147 Ga0209282_1000006 3300027666 Bacteria 276998
148 Ga0209588_1046090 3300027671 Bacteria 1410
149 Ga0268266_10087008 3300028379 Bacteria 2733
150 Ga0268266_10115059 3300028379 Bacteria 2387
151 Ga0268266_10125430 3300028379 Bacteria 2290
152 Ga0268265_10008132 3300028380 Bacteria 7089
153 Ga0268264_10082792 3300028381 Bacteria 2747
154 Ga0265318_10019587 3300028577 Bacteria 2742
155 Ga0307517_10263325 3300028786 Bacteria 999
156 Ga0307515_10009704 3300028794 Bacteria 18560
157 Ga0265340_10050575 3300031247 Bacteria 2015
158 Ga0265331_10025645 3300031250 Bacteria 2973
159 Ga0265327_10111466 3300031251 Bacteria 1307
160 Ga0307513_10033850 3300031456 Bacteria 5739
161 Ga0307513_10372067 3300031456 Bacteria 1171
162 Ga0307408_100153959 3300031548 Bacteria 1818
163 Ga0307508_10130336 3300031616 Bacteria 2118
164 Ga0265314_10085243 3300031711 Bacteria 2072
165 Ga0307516_10022233 3300031730 Bacteria 6517
166 Ga0307405_10109767 3300031731 Bacteria 1867
167 Ga0307412_10009953 3300031911 Bacteria 5470
168 Ga0307412_10168281 3300031911 Bacteria 1636
169 Ga0315914_1000003 3300031967 Bacteria 314370
170 Ga0307510_10174473 3300033180 Bacteria 1723
171 Ga0315913_1000001 3300033430 Bacteria 284459
172 Ga0315915_1000008 3300033464 Bacteria 258517
173 Ga0373962_0068756 3300035242 Bacteria 1054
174 Ga0373927_0000412 3300035695 Bacteria 32914
175 Ga0373937_0147894 3300036401 Bacteria 2200
176 Ga0316582_0066958 3300036647 Bacteria 2316
177 Ga0316584_0019075 3300036712 Bacteria 4954
178 Ga0316584_0046390 3300036712 Bacteria 3246
179 Ga0373925_0001026 3300037068 Bacteria 25273
180 Ga0373925_0016279 3300037068 Bacteria 5383
181 Ga0373925_0194413 3300037068 Bacteria 1611
182 Ga0395899_0002420 3300037312 Bacteria 15170
183 Ga0395900_0006778 3300037418 Bacteria 11890
184 Ga0395900_0011818 3300037418 Bacteria 8928
185 Ga0395900_0367915 3300037418 Bacteria 1408
186 Ga0395900_0446890 3300037418 Bacteria 1249
187 Ga0395905_0000321 3300037471 Bacteria 69144
188 Ga0395905_0015961 3300037471 Bacteria 7138
189 Ga0395905_0016420 3300037471 Bacteria 7036
190 Ga0395905_0074498 3300037471 Bacteria 3181
191 Ga0395905_0097365 3300037471 Bacteria 2762
192 Ga0395905_0131670 3300037471 Bacteria 2352
193 Ga0395905_0445227 3300037471 Bacteria 1193
194 Ga0395901_0000754 3300038443 Bacteria 36379
195 Ga0395901_0074295 3300038443 Bacteria 3546
196 Ga0395901_0145068 3300038443 Bacteria 2495
197 Ga0395901_0210996 3300038443 Bacteria 2032
198 Ga0436365_0561599 3300039437 Bacteria 1450
199 Ga0436360_1363924 3300039438 Bacteria 1309
200 Ga0436361_0243751 3300039447 Bacteria 2822
201 Ga0436361_0797229 3300039447 Bacteria 2128
202 Ga0436363_0664872 3300039450 Bacteria 5316
203 Ga0439458_0006926 3300042157 Bacteria 2529
204 Ga0453683_0000137 3300044673 Bacteria 105989
205 Ga0466963_0021335 3300044694 Bacteria 4084
206 Ga0453684_0004361 3300044712 Bacteria 30015
207 Ga0466968_0064832 3300044735 Bacteria 1581
208 Ga0466960_0087650 3300044901 Bacteria 1581
209 Ga0451576_0000001 3300045051 Bacteria 1802108
210 Ga0466967_0004345 3300045976 Bacteria 9537
211 Ga0466967_0292293 3300045976 Bacteria 1566
212 Ga0495638_0000169 3300046460 Bacteria 101640
213 Ga0495638_0075200 3300046460 Bacteria 2059
214 Ga0495585_0002182 3300046492 Bacteria 14212
215 Ga0495583_0006812 3300046506 Bacteria 7377
216 Ga0495606_0000286 3300046507 Bacteria 87736
217 Ga0495606_0175305 3300046507 Bacteria 1240
218 Ga0495620_0033650 3300046515 Bacteria 2325
219 Ga0495654_0000121 3300046530 Bacteria 86743
220 Ga0495597_0050871 3300046542 Bacteria 1828
221 Ga0495668_0020510 3300046616 Bacteria 3802
222 Ga0495625_0177373 3300046660 Bacteria 1419
223 Ga0495588_0034553 3300046674 Bacteria 2559
224 Ga0495671_0040640 3300046692 Bacteria 2345
225 Ga0495681_0009787 3300047470 Bacteria 5866
226 Ga0495686_0114040 3300047472 Bacteria 1618
227 Ga0496102_0076666 3300048905 Bacteria 3076
228 Ga0496102_0200486 3300048905 Bacteria 1881
229 Ga0496102_0301957 3300048905 Bacteria 1509
230 Ga0496103_0022451 3300048906 Bacteria 3800
231 Ga0496108_0174932 3300048911 Bacteria 1858
232 Ga0496111_0001276 3300048914 Bacteria 14109
233 Ga0496112_0024574 3300048915 Bacteria 5773
234 Ga0496113_0497345 3300048916 Bacteria 979
235 Ga0496114_0462689 3300048917 Bacteria 1123
236 Ga0496116_0000135 3300048919 Bacteria 153165
237 Ga0496118_0062213 3300048921 Bacteria 2758
238 Ga0496119_0030888 3300048922 Bacteria 3603
239 Ga0496120_0004732 3300048923 Bacteria 11183
240 Ga0496120_0036634 3300048923 Bacteria 2917
241 Ga0496121_0000180 3300048924 Bacteria 141128
242 Ga0496121_0021681 3300048924 Bacteria 6280
243 Ga0496121_0029821 3300048924 Bacteria 5028
244 Ga0496121_0033506 3300048924 Bacteria 4647
245 Ga0496121_0145971 3300048924 Bacteria 1748
246 Ga0496122_0000107 3300048925 Bacteria 193163
247 Ga0496122_0041808 3300048925 Bacteria 3616
248 Ga0496122_0054210 3300048925 Bacteria 3014
249 Ga0496122_0108136 3300048925 Bacteria 1835
250 Ga0496123_0000063 3300048926 Bacteria 216072
251 Ga0496123_0021425 3300048926 Bacteria 5024
252 Ga0496124_0026109 3300048927 Bacteria 5273
253 Ga0496124_0165739 3300048927 Bacteria 1717
254 Ga0496125_0044751 3300048928 Bacteria 3736
255 Ga0496126_0000129 3300048929 Bacteria 174059
256 Ga0496126_0010454 3300048929 Bacteria 9723
257 Ga0496126_0375614 3300048929 Bacteria 1158
258 Ga0501031_0000218 3300049568 Bacteria 32961
259 Ga0501031_0075315 3300049568 Bacteria 2197
260 Ga0501031_0140656 3300049568 Bacteria 1577
261 Ga0501032_0000457 3300049569 Bacteria 32961
262 Ga0501032_0003237 3300049569 Bacteria 12520
263 Ga0501032_0192067 3300049569 Bacteria 1334
264 Ga0501032_0227972 3300049569 Bacteria 1211
265 Ga0501032_0264495 3300049569 Bacteria 1115
266 Ga0501033_0000612 3300049570 Bacteria 33054
267 Ga0501033_0000692 3300049570 Bacteria 31217
268 Ga0501033_0011511 3300049570 Bacteria 6770
269 Ga0501033_0136606 3300049570 Bacteria 1774
270 Ga0501033_0186064 3300049570 Bacteria 1488
271 Ga0501034_0001364 3300049571 Bacteria 32961
272 Ga0501034_0074936 3300049571 Bacteria 3391
273 Ga0501034_0713465 3300049571 Bacteria 900
274 Ga0501034_0724828 3300049571 Bacteria 891
275 Ga0501036_0000335 3300049572 Bacteria 32961
276 Ga0501036_0020894 3300049572 Bacteria 5498
277 Ga0501036_0081017 3300049572 Bacteria 2743
278 Ga0501036_0168513 3300049572 Bacteria 1845
279 Ga0501037_0000468 3300049573 Bacteria 32961
280 Ga0501037_0008942 3300049573 Bacteria 7341
281 Ga0501037_0260538 3300049573 Bacteria 1211
282 Ga0501037_0262859 3300049573 Bacteria 1205
283 Ga0501038_0000557 3300049574 Bacteria 32961
284 Ga0501038_0001830 3300049574 Bacteria 19693
285 Ga0501038_0116545 3300049574 Bacteria 2207
286 Ga0501039_0000689 3300049575 Bacteria 24309
287 Ga0501039_0029011 3300049575 Bacteria 4260
288 Ga0501039_0192987 3300049575 Bacteria 1601
289 Ga0501039_0262536 3300049575 Bacteria 1357
290 Ga0501039_0543602 3300049575 Bacteria 911
291 Ga0501040_0005022 3300049576 Bacteria 8550
292 Ga0501040_0285047 3300049576 Bacteria 1180
293 Ga0501043_0003061 3300049579 Bacteria 13893
294 Ga0501043_0004029 3300049579 Bacteria 12015
295 Ga0501043_0022353 3300049579 Bacteria 4961
296 Ga0501046_0000538 3300049580 Bacteria 37587
297 Ga0501046_0090035 3300049580 Bacteria 2361
298 Ga0501047_0003732 3300049581 Bacteria 14344
299 Ga0501047_0031479 3300049581 Bacteria 5116
300 Ga0501047_0312191 3300049581 Bacteria 1412
301 Ga0501047_0434377 3300049581 Bacteria 1143
302 Ga0501067_0027215 3300049583 Bacteria 3168
303 Ga0501067_0080353 3300049583 Bacteria 1807
304 Ga0501067_0204148 3300049583 Bacteria 1101
305 Ga0501068_0010475 3300049584 Bacteria 5211
306 Ga0501068_0065278 3300049584 Bacteria 2215
307 Ga0501068_0162103 3300049584 Bacteria 1409
308 Ga0501069_0003212 3300049585 Bacteria 8374
309 Ga0501069_0063668 3300049585 Bacteria 2060
310 Ga0501070_0002737 3300049586 Bacteria 15389
311 Ga0501070_0002902 3300049586 Bacteria 14938
312 Ga0501070_0059818 3300049586 Bacteria 3158
313 Ga0501070_0136045 3300049586 Bacteria 2029
314 Ga0501072_0104241 3300049588 Bacteria 2255
315 Ga0501073_0001283 3300049589 Bacteria 18442
316 Ga0501073_0005747 3300049589 Bacteria 9274
317 Ga0501073_0006938 3300049589 Bacteria 8432
318 Ga0501073_0345412 3300049589 Bacteria 1027
319 Ga0501074_0006735 3300049590 Bacteria 8289
320 Ga0501074_0120965 3300049590 Bacteria 1872
321 Ga0501080_0017603 3300049742 Bacteria 6607
322 Ga0501080_0020335 3300049742 Bacteria 6143
323 Ga0501080_0049140 3300049742 Bacteria 3926
324 Ga0501080_0170231 3300049742 Bacteria 2009
325 Ga0501083_0008800 3300049744 Bacteria 7127
326 Ga0501083_0047441 3300049744 Bacteria 2902
327 Ga0501035_0000157 3300049822 Bacteria 83835
328 Ga0501035_0000833 3300049822 Bacteria 32961
329 Ga0501035_0116093 3300049822 Bacteria 2342
330 Ga0501035_0362306 3300049822 Bacteria 1211
331 Ga0501035_0365333 3300049822 Bacteria 1205
332 Ga0501035_0366073 3300049822 Bacteria 1204
333 Ga0501044_0001065 3300049823 Bacteria 32961
334 Ga0501044_0025899 3300049823 Bacteria 6217
335 Ga0501044_0141041 3300049823 Bacteria 2398
336 Ga0501044_0201141 3300049823 Bacteria 1950
337 Ga0501044_0341211 3300049823 Bacteria 1419
338 nmdc:mga03683_11486_c1 3300050489 Bacteria 3208
339 nmdc:mga03n38_19943_c1 3300050490 Bacteria 2674
340 nmdc:mga03n38_75010_c1 3300050490 Bacteria 1574
341 nmdc:mga0yw44_115_c1 3300050492 Bacteria 24900
342 nmdc:mga0yw44_128819_c1 3300050492 Bacteria 1636
343 nmdc:mga0yw44_51605_c1 3300050492 Bacteria 2491
344 nmdc:mga0yw44_82454_c1 3300050492 Bacteria 2018
345 nmdc:mga06z11_191091_c1 3300050494 Bacteria 1185
346 nmdc:mga06z11_3460_c1 3300050494 Bacteria 6111
347 nmdc:mga07m45_10489_c1 3300050496 Bacteria 4842
348 nmdc:mga0sz30_15132_c1 3300050516 Bacteria 3047
349 Ga0500651_0112383 3300053093 Bacteria 1661
350 Ga0500595_001358 3300053119 Bacteria 13165
351 Ga0500618_014877 3300053125 Bacteria 1977
352 Ga0500618_027850 3300053125 Bacteria 1342
353 Ga0500642_0004355 3300053130 Bacteria 4422
354 Ga0500658_0071289 3300053134 Bacteria 1467
355 Ga0500559_0012677 3300053136 Bacteria 3578
356 Ga0500568_0000238 3300053139 Bacteria 47021
357 Ga0500568_0031326 3300053139 Bacteria 2195
358 Ga0500573_0001489 3300053140 Bacteria 11252
359 Ga0500616_0000402 3300053153 Bacteria 59210
360 Ga0500616_0002189 3300053153 Bacteria 16828
361 Ga0500616_0011111 3300053153 Bacteria 5345
362 Ga0500620_000147 3300053155 Bacteria 14180
363 Ga0500622_0000406 3300053156 Bacteria 40989
364 Ga0500627_0114783 3300053158 Bacteria 1213
365 Ga0500634_0003689 3300053161 Bacteria 6894
366 Ga0500609_001093 3300053731 Bacteria 4053
367 Ga0500609_008876 3300053731 Bacteria 1357
368 Ga0501084_0215744 3300054114 Bacteria 1619
369 Ga0501082_0015647 3300060353 Bacteria 6529
370 Ga0501082_0097418 3300060353 Bacteria 2542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2881861095 2881866674 206
2 3300048906 Ga0496103_0022451 Ga0496103_0022451_1648_2493 213
3 iso_pu_bacteria 2965047637 2965052974 215
4 3300049586 Ga0501070_0136045 Ga0501070_0136045_973_1875 229
5 3300050492 nmdc:mga0yw44_115_c1 nmdc:mga0yw44_115_c1_23513_24301 229
6 iso_pu_bacteria 2970510686 2970510868 231
7 3300049571 Ga0501034_0724828 Ga0501034_0724828_77_865 232
8 3300048905 Ga0496102_0200486 Ga0496102_0200486_236_1138 233
9 3300049571 Ga0501034_0713465 Ga0501034_0713465_56_850 233
10 3300049572 Ga0501036_0168513 Ga0501036_0168513_10_804 233
11 3300053139 Ga0500568_0000238 Ga0500568_0000238_23788_24681 233
12 3300006038 Ga0075365_10247443 Ga0075365_102474432 234
13 3300006042 Ga0075368_10044915 Ga0075368_100449152 234
14 3300006178 Ga0075367_10160837 Ga0075367_101608372 234
15 3300037471 Ga0395905_0000321 Ga0395905_0000321_2306_3163 234
16 3300044735 Ga0466968_0064832 Ga0466968_0064832_616_1479 235
17 3300049569 Ga0501032_0264495 Ga0501032_0264495_175_1101 235
18 3300049570 Ga0501033_0136606 Ga0501033_0136606_656_1582 235
19 3300049822 Ga0501035_0366073 Ga0501035_0366073_77_1003 235
20 3300003762 Ga0055542_1000625 Ga0055542_10006255 236
21 3300005539 Ga0068853_100403671 Ga0068853_1004036712 236
22 3300005548 Ga0070665_100076463 Ga0070665_1000764633 236
23 3300005616 Ga0068852_100378246 Ga0068852_1003782462 236
24 3300006038 Ga0075365_10013768 Ga0075365_100137682 236
25 3300006353 Ga0075370_10041657 Ga0075370_100416572 236
26 3300009093 Ga0105240_10524548 Ga0105240_105245482 236
27 3300009101 Ga0105247_10256814 Ga0105247_102568141 236
28 3300009545 Ga0105237_10094397 Ga0105237_100943973 236
29 3300010375 Ga0105239_10094129 Ga0105239_100941293 236
30 3300010375 Ga0105239_10419225 Ga0105239_104192252 236
31 3300013296 Ga0157374_10283679 Ga0157374_102836792 236
32 3300014497 Ga0182008_10015519 Ga0182008_100155192 236
33 3300014497 Ga0182008_10087343 Ga0182008_100873432 236
34 3300025254 Ga0209148_1000032 Ga0209148_100003250 236
35 3300025272 Ga0209455_1000098 Ga0209455_1000098141 236
36 3300025904 Ga0207647_10097853 Ga0207647_100978532 236
37 3300025911 Ga0207654_10008439 Ga0207654_100084394 236
38 3300025913 Ga0207695_10282858 Ga0207695_102828582 236
39 3300025914 Ga0207671_10062911 Ga0207671_100629112 236
40 3300025914 Ga0207671_10112012 Ga0207671_101120122 236
41 3300025919 Ga0207657_10074778 Ga0207657_100747783 236
42 3300025924 Ga0207694_10475569 Ga0207694_104755692 236
43 3300025949 Ga0207667_10110686 Ga0207667_101106862 236
44 3300026041 Ga0207639_10155951 Ga0207639_101559512 236
45 3300026142 Ga0207698_10107153 Ga0207698_101071532 236
46 3300028379 Ga0268266_10087008 Ga0268266_100870082 236
47 3300028786 Ga0307517_10263325 Ga0307517_102633251 236
48 3300033180 Ga0307510_10174473 Ga0307510_101744732 236
49 3300037471 Ga0395905_0445227 Ga0395905_0445227_195_1115 236
50 3300039438 Ga0436360_1363924 Ga0436360_1363924_86_1015 236
51 3300039447 Ga0436361_0243751 Ga0436361_0243751_1757_2686 236
52 3300048911 Ga0496108_0174932 Ga0496108_0174932_394_1314 236
53 3300048915 Ga0496112_0024574 Ga0496112_0024574_3964_4884 236
54 3300048916 Ga0496113_0497345 Ga0496113_0497345_22_942 236
55 3300048917 Ga0496114_0462689 Ga0496114_0462689_93_1013 236
56 3300048921 Ga0496118_0062213 Ga0496118_0062213_435_1355 236
57 3300048923 Ga0496120_0036634 Ga0496120_0036634_1100_2020 236
58 3300048929 Ga0496126_0375614 Ga0496126_0375614_214_1134 236
59 3300050490 nmdc:mga03n38_19943_c1 nmdc:mga03n38_19943_c1_1293_2213 236
60 3300050494 nmdc:mga06z11_3460_c1 nmdc:mga06z11_3460_c1_75_995 236
61 3300050496 nmdc:mga07m45_10489_c1 nmdc:mga07m45_10489_c1_3607_4527 236
62 iso_pu_bacteria 3004289098 3004294181 236
63 3300048922 Ga0496119_0030888 Ga0496119_0030888_1121_2041 237
64 3300048923 Ga0496120_0004732 Ga0496120_0004732_1687_2607 237
65 3300048927 Ga0496124_0165739 Ga0496124_0165739_462_1394 237
66 3300006038 Ga0075365_10043118 Ga0075365_100431182 238
67 3300037418 Ga0395900_0011818 Ga0395900_0011818_852_1772 238
68 3300037471 Ga0395905_0015961 Ga0395905_0015961_4351_5271 238
69 3300038443 Ga0395901_0074295 Ga0395901_0074295_1005_1925 238
70 3300048905 Ga0496102_0301957 Ga0496102_0301957_476_1390 238
71 3300006038 Ga0075365_10138032 Ga0075365_101380322 239
72 3300036712 Ga0316584_0019075 Ga0316584_0019075_3539_4429 239
73 3300044673 Ga0453683_0000137 Ga0453683_0000137_14250_15140 239
74 3300044712 Ga0453684_0004361 Ga0453684_0004361_10748_11638 239
75 3300045051 Ga0451576_0000001 Ga0451576_0000001_1323494_1324384 239
76 3300046460 Ga0495638_0000169 Ga0495638_0000169_25077_25934 239
77 3300046492 Ga0495585_0002182 Ga0495585_0002182_905_1840 239
78 3300046515 Ga0495620_0033650 Ga0495620_0033650_775_1710 239
79 3300046616 Ga0495668_0020510 Ga0495668_0020510_1825_2760 239
80 3300046660 Ga0495625_0177373 Ga0495625_0177373_345_1280 239
81 3300046674 Ga0495588_0034553 Ga0495588_0034553_822_1757 239
82 3300050492 nmdc:mga0yw44_82454_c1 nmdc:mga0yw44_82454_c1_421_1341 239
83 3300050516 nmdc:mga0sz30_15132_c1 nmdc:mga0sz30_15132_c1_268_1188 239
84 3300053134 Ga0500658_0071289 Ga0500658_0071289_177_1034 239
85 3300003214 JGI25165J46597_1000019 JGI25165J46597_1000019210 240
86 3300025261 Ga0209233_1000034 Ga0209233_1000034394 240
87 3300025261 Ga0209233_1005717 Ga0209233_10057173 240
88 3300044901 Ga0466960_0087650 Ga0466960_0087650_291_1217 240
89 3300045976 Ga0466967_0292293 Ga0466967_0292293_91_1011 240
90 3300006038 Ga0075365_10006628 Ga0075365_100066282 241
91 3300031730 Ga0307516_10022233 Ga0307516_100222336 242
92 3300048924 Ga0496121_0029821 Ga0496121_0029821_3876_4733 242
93 3300048925 Ga0496122_0108136 Ga0496122_0108136_701_1558 242
94 3300048928 Ga0496125_0044751 Ga0496125_0044751_2807_3664 242
95 3300048929 Ga0496126_0010454 Ga0496126_0010454_3267_4154 242
96 3300053153 Ga0500616_0011111 Ga0500616_0011111_2796_3653 242
97 3300005327 Ga0070658_10020001 Ga0070658_100200016 243
98 3300005344 Ga0070661_100028425 Ga0070661_1000284254 243
99 3300005366 Ga0070659_100024039 Ga0070659_1000240394 243
100 3300005539 Ga0068853_100045963 Ga0068853_1000459634 243
101 3300005578 Ga0068854_100380317 Ga0068854_1003803172 243
102 3300005614 Ga0068856_100029277 Ga0068856_1000292776 243
103 3300005616 Ga0068852_100005298 Ga0068852_1000052987 243
104 3300009093 Ga0105240_10182473 Ga0105240_101824732 243
105 3300013104 Ga0157370_10044175 Ga0157370_100441754 243
106 3300013105 Ga0157369_10314215 Ga0157369_103142152 243
107 3300025907 Ga0207645_10109590 Ga0207645_101095902 243
108 3300025913 Ga0207695_10042483 Ga0207695_100424832 243
109 3300025924 Ga0207694_10404230 Ga0207694_104042301 243
110 3300025937 Ga0207669_10425097 Ga0207669_104250972 243
111 3300025949 Ga0207667_10013368 Ga0207667_100133688 243
112 3300026078 Ga0207702_10085062 Ga0207702_100850622 243
113 3300028381 Ga0268264_10082792 Ga0268264_100827923 243
114 3300028577 Ga0265318_10019587 Ga0265318_100195873 243
115 3300031247 Ga0265340_10050575 Ga0265340_100505753 243
116 3300031250 Ga0265331_10025645 Ga0265331_100256452 243
117 3300031711 Ga0265314_10085243 Ga0265314_100852432 243
118 3300036401 Ga0373937_0147894 Ga0373937_0147894_828_1676 243
119 3300053125 Ga0500618_014877 Ga0500618_014877_420_1325 243
120 3300053731 Ga0500609_008876 Ga0500609_008876_237_1130 243
121 3300005338 Ga0068868_100137046 Ga0068868_1001370462 244
122 3300005339 Ga0070660_100020664 Ga0070660_1000206645 244
123 3300005344 Ga0070661_100068724 Ga0070661_1000687243 244
124 3300005366 Ga0070659_100042412 Ga0070659_1000424124 244
125 3300005455 Ga0070663_100193010 Ga0070663_1001930102 244
126 3300005456 Ga0070678_100153673 Ga0070678_1001536732 244
127 3300005457 Ga0070662_100530365 Ga0070662_1005303651 244
128 3300005459 Ga0068867_100125316 Ga0068867_1001253162 244
129 3300005539 Ga0068853_100106453 Ga0068853_1001064532 244
130 3300005563 Ga0068855_100024919 Ga0068855_1000249195 244
131 3300005564 Ga0070664_100087232 Ga0070664_1000872323 244
132 3300005577 Ga0068857_100009968 Ga0068857_1000099682 244
133 3300005578 Ga0068854_100015921 Ga0068854_1000159214 244
134 3300005616 Ga0068852_100246615 Ga0068852_1002466152 244
135 3300005616 Ga0068852_100360497 Ga0068852_1003604972 244
136 3300006178 Ga0075367_10002105 Ga0075367_100021052 244
137 3300006353 Ga0075370_10076414 Ga0075370_100764142 244
138 3300006881 Ga0068865_100150975 Ga0068865_1001509752 244
139 3300009551 Ga0105238_10118904 Ga0105238_101189042 244
140 3300010375 Ga0105239_10050004 Ga0105239_100500042 244
141 3300025321 Ga0207656_10022994 Ga0207656_100229943 244
142 3300025919 Ga0207657_10029920 Ga0207657_100299205 244
143 3300025920 Ga0207649_10045114 Ga0207649_100451144 244
144 3300025924 Ga0207694_10142262 Ga0207694_101422621 244
145 3300025933 Ga0207706_10098441 Ga0207706_100984412 244
146 3300025945 Ga0207679_10336233 Ga0207679_103362332 244
147 3300025981 Ga0207640_10061276 Ga0207640_100612762 244
148 3300026041 Ga0207639_10056737 Ga0207639_100567372 244
149 3300026078 Ga0207702_10095035 Ga0207702_100950353 244
150 3300026089 Ga0207648_10173958 Ga0207648_101739582 244
151 3300026116 Ga0207674_10006560 Ga0207674_100065606 244
152 3300026121 Ga0207683_10264456 Ga0207683_102644562 244
153 3300026142 Ga0207698_10025562 Ga0207698_100255622 244
154 3300028794 Ga0307515_10009704 Ga0307515_1000970414 244
155 3300031251 Ga0265327_10111466 Ga0265327_101114662 244
156 3300035242 Ga0373962_0068756 Ga0373962_0068756_99_998 244
157 3300035695 Ga0373927_0000412 Ga0373927_0000412_22413_23318 244
158 3300037068 Ga0373925_0001026 Ga0373925_0001026_8453_9358 244
159 3300037068 Ga0373925_0194413 Ga0373925_0194413_570_1469 244
160 3300037471 Ga0395905_0074498 Ga0395905_0074498_642_1553 244
161 3300039447 Ga0436361_0797229 Ga0436361_0797229_708_1601 244
162 3300049568 Ga0501031_0075315 Ga0501031_0075315_1042_1944 244
163 3300049569 Ga0501032_0227972 Ga0501032_0227972_56_958 244
164 3300049570 Ga0501033_0000692 Ga0501033_0000692_19406_20317 244
165 3300049571 Ga0501034_0074936 Ga0501034_0074936_1257_2159 244
166 3300049572 Ga0501036_0081017 Ga0501036_0081017_1786_2688 244
167 3300049573 Ga0501037_0260538 Ga0501037_0260538_254_1156 244
168 3300049574 Ga0501038_0116545 Ga0501038_0116545_1052_1954 244
169 3300049575 Ga0501039_0543602 Ga0501039_0543602_27_884 244
170 3300049576 Ga0501040_0285047 Ga0501040_0285047_32_934 244
171 3300049579 Ga0501043_0022353 Ga0501043_0022353_3605_4507 244
172 3300049581 Ga0501047_0312191 Ga0501047_0312191_56_958 244
173 3300049583 Ga0501067_0204148 Ga0501067_0204148_229_1086 244
174 3300049584 Ga0501068_0065278 Ga0501068_0065278_936_1838 244
175 3300049589 Ga0501073_0345412 Ga0501073_0345412_12_923 244
176 3300049822 Ga0501035_0000157 Ga0501035_0000157_36303_37214 244
177 3300049822 Ga0501035_0362306 Ga0501035_0362306_56_958 244
178 3300050490 nmdc:mga03n38_75010_c1 nmdc:mga03n38_75010_c1_487_1395 244
179 3300050494 nmdc:mga06z11_191091_c1 nmdc:mga06z11_191091_c1_228_1136 244
180 3300053136 Ga0500559_0012677 Ga0500559_0012677_2612_3523 244
181 3300053155 Ga0500620_000147 Ga0500620_000147_10898_11818 244
182 3300053156 Ga0500622_0000406 Ga0500622_0000406_25597_26508 244
183 iso_pu_bacteria 2511231027 2511389038 244
184 iso_pu_bacteria 2922130491 2922136776 244
185 iso_pu_bacteria 2996310559 2996314787 244
186 iso_pu_bacteria 3002141150 3002146248 244
187 iso_pu_bacteria 8055431914 8055431958 244
188 3300005616 Ga0068852_100289131 Ga0068852_1002891312 245
189 3300009093 Ga0105240_10126822 Ga0105240_101268223 245
190 3300009545 Ga0105237_10009556 Ga0105237_100095566 245
191 3300009551 Ga0105238_10002270 Ga0105238_1000227012 245
192 3300010375 Ga0105239_10012124 Ga0105239_100121246 245
193 3300013105 Ga0157369_10141283 Ga0157369_101412832 245
194 3300025261 Ga0209233_1022879 Ga0209233_10228792 245
195 3300025913 Ga0207695_10068039 Ga0207695_100680393 245
196 3300025924 Ga0207694_10013279 Ga0207694_100132793 245
197 3300026041 Ga0207639_10061117 Ga0207639_100611172 245
198 3300037418 Ga0395900_0367915 Ga0395900_0367915_393_1313 245
199 3300048905 Ga0496102_0076666 Ga0496102_0076666_1367_2287 245
200 3300053119 Ga0500595_001358 Ga0500595_001358_2829_3776 245
201 iso_pu_bacteria 2852103415 2852106115 245
202 3300037471 Ga0395905_0097365 Ga0395905_0097365_790_1716 246
203 3300049823 Ga0501044_0341211 Ga0501044_0341211_357_1277 246
204 iso_pu_bacteria 2643221550 2643771782 246
205 iso_pu_bacteria 2643221551 2643777658 246
206 iso_pu_bacteria 2643221555 2643796106 246
207 iso_pu_bacteria 2671180139 2671694321 246
208 iso_pu_bacteria 2965040258 2965046660 246
209 iso_pu_bacteria 2978969890 2978970796 246
210 iso_pu_bacteria 2984587000 2984587904 246
211 iso_pu_bacteria 8005658619 8005661681 246
212 3300006946 Ga0079104_1003309 Ga0079104_10033096 247
213 3300006948 Ga0099826_10112232 Ga0099826_101122322 247
214 3300022739 Ga0228711_1000017 Ga0228711_1000017119 247
215 3300022740 Ga0228710_1000005 Ga0228710_1000005134 247
216 3300025939 Ga0207665_10180673 Ga0207665_101806731 247
217 3300027111 Ga0209281_1000082 Ga0209281_100008282 247
218 3300027666 Ga0209282_1000006 Ga0209282_1000006104 247
219 3300031967 Ga0315914_1000003 Ga0315914_1000003159 247
220 3300033430 Ga0315913_1000001 Ga0315913_1000001110 247
221 3300033464 Ga0315915_1000008 Ga0315915_1000008177 247
222 3300037068 Ga0373925_0016279 Ga0373925_0016279_3914_4834 247
223 iso_pu_bacteria 2508501127 2509140283 247
224 iso_pu_bacteria 2509276018 2509370585 247
225 iso_pu_bacteria 2510065059 2510314396 247
226 iso_pu_bacteria 2513237090 2513609512 247
227 iso_pu_bacteria 2513237164 2514037514 247
228 iso_pu_bacteria 2588253730 2588520637 247
229 iso_pu_bacteria 2597489875 2597810135 247
230 iso_pu_bacteria 2599185301 2599935747 247
231 iso_pu_bacteria 2643221595 2643985007 247
232 iso_pu_bacteria 2643221627 2644154063 247
233 iso_pu_bacteria 2687453392 2688595363 247
234 iso_pu_bacteria 2693429783 2694628508 247
235 iso_pu_bacteria 2693429784 2694640593 247
236 iso_pu_bacteria 2756170246 2756674563 247
237 iso_pu_bacteria 2791355123 2792746559 247
238 iso_pu_bacteria 2841734538 2841735830 247
239 iso_pu_bacteria 2844002411 2844004124 247
240 iso_pu_bacteria 2856328259 2856332044 247
241 iso_pu_bacteria 2856334872 2856334890 247
242 iso_pu_bacteria 2856342000 2856345431 247
243 iso_pu_bacteria 2856349417 2856353168 247
244 iso_pu_bacteria 2856356410 2856361431 247
245 iso_pu_bacteria 2857367948 2857374103 247
246 iso_pu_bacteria 2869162929 2869168725 247
247 iso_pu_bacteria 2869169390 2869172315 247
248 iso_pu_bacteria 2869242130 2869246522 247
249 iso_pu_bacteria 2869249662 2869252028 247
250 iso_pu_bacteria 2869264136 2869264368 247
251 iso_pu_bacteria 2869271264 2869274706 247
252 iso_pu_bacteria 2869285874 2869292466 247
253 iso_pu_bacteria 2871429161 2871429281 247
254 iso_pu_bacteria 2871444079 2871451170 247
255 iso_pu_bacteria 2871451962 2871459245 247
256 iso_pu_bacteria 2871459585 2871460095 247
257 iso_pu_bacteria 2871466892 2871467725 247
258 iso_pu_bacteria 2871474448 2871475466 247
259 iso_pu_bacteria 2871481445 2871484481 247
260 iso_pu_bacteria 2871488783 2871490802 247
261 iso_pu_bacteria 2874116593 2874117814 247
262 iso_pu_bacteria 2874123672 2874129520 247
263 iso_pu_bacteria 2874131515 2874133817 247
264 iso_pu_bacteria 2874146452 2874154187 247
265 iso_pu_bacteria 2874155637 2874161689 247
266 iso_pu_bacteria 2874162495 2874162570 247
267 iso_pu_bacteria 2874168670 2874171757 247
268 iso_pu_bacteria 2876369609 2876370239 247
269 iso_pu_bacteria 2876377896 2876379932 247
270 iso_pu_bacteria 2876386047 2876391964 247
271 iso_pu_bacteria 2876392853 2876392926 247
272 iso_pu_bacteria 2876399893 2876405091 247
273 iso_pu_bacteria 2876406927 2876411103 247
274 iso_pu_bacteria 2876413966 2876419871 247
275 iso_pu_bacteria 2876420981 2876422627 247
276 iso_pu_bacteria 2878745973 2878752809 247
277 iso_pu_bacteria 2878753008 2878755206 247
278 iso_pu_bacteria 2878774303 2878775246 247
279 iso_pu_bacteria 2878781027 2878782222 247
280 iso_pu_bacteria 2881147464 2881147616 247
281 iso_pu_bacteria 2881155292 2881158716 247
282 iso_pu_bacteria 2881161766 2881164391 247
283 iso_pu_bacteria 2881845957 2881849666 247
284 iso_pu_bacteria 2881853255 2881854195 247
285 iso_pu_bacteria 2882912400 2882913663 247
286 iso_pu_bacteria 2885312484 2885314699 247
287 iso_pu_bacteria 2885318864 2885322787 247
288 iso_pu_bacteria 2885350715 2885357107 247
289 iso_pu_bacteria 2888350351 2888352277 247
290 iso_pu_bacteria 2889010040 2889014267 247
291 iso_pu_bacteria 2889016732 2889021028 247
292 iso_pu_bacteria 2903492973 2903494908 247
293 iso_pu_bacteria 2903492973 2903499314 247
294 iso_pu_bacteria 2904659560 2904659632 247
295 iso_pu_bacteria 2906308376 2906315200 247
296 iso_pu_bacteria 2906321335 2906321456 247
297 iso_pu_bacteria 2906328253 2906334552 247
298 iso_pu_bacteria 2906354277 2906354987 247
299 iso_pu_bacteria 2906363423 2906365554 247
300 iso_pu_bacteria 2906370794 2906374473 247
301 iso_pu_bacteria 2906378014 2906381291 247
302 iso_pu_bacteria 2906386501 2906390714 247
303 iso_pu_bacteria 2906393657 2906400592 247
304 iso_pu_bacteria 2906401398 2906404641 247
305 iso_pu_bacteria 2906408224 2906412487 247
306 iso_pu_bacteria 2906427513 2906431887 247
307 iso_pu_bacteria 2922151315 2922158338 247
308 iso_pu_bacteria 2922158528 2922165037 247
309 iso_pu_bacteria 2922172374 2922173398 247
310 iso_pu_bacteria 2922178524 2922182410 247
311 iso_pu_bacteria 2922185730 2922188530 247
312 iso_pu_bacteria 2924726620 2924732865 247
313 iso_pu_bacteria 2924741084 2924741786 247
314 iso_pu_bacteria 2924748358 2924751520 247
315 iso_pu_bacteria 2924754689 2924756116 247
316 iso_pu_bacteria 2924762789 2924767698 247
317 iso_pu_bacteria 2924784321 2924791427 247
318 iso_pu_bacteria 2937813078 2937821742 247
319 iso_pu_bacteria 2937836603 2937839123 247
320 iso_pu_bacteria 2937861824 2937863304 247
321 iso_pu_bacteria 2937868953 2937873760 247
322 iso_pu_bacteria 2937891427 2937895999 247
323 iso_pu_bacteria 2937980651 2937980921 247
324 iso_pu_bacteria 2938014810 2938016931 247
325 iso_pu_bacteria 2958064165 2958066724 247
326 iso_pu_bacteria 2958071322 2958076305 247
327 iso_pu_bacteria 2958100919 2958101453 247
328 iso_pu_bacteria 2958108152 2958109876 247
329 iso_pu_bacteria 2958122699 2958129237 247
330 iso_pu_bacteria 2958130278 2958136866 247
331 iso_pu_bacteria 2958137437 2958142401 247
332 iso_pu_bacteria 2958158011 2958159239 247
333 iso_pu_bacteria 2958172287 2958173746 247
334 iso_pu_bacteria 2958179912 2958186749 247
335 iso_pu_bacteria 2961077736 2961085250 247
336 iso_pu_bacteria 2961114664 2961114957 247
337 iso_pu_bacteria 2961127735 2961131915 247
338 iso_pu_bacteria 2961136820 2961141862 247
339 iso_pu_bacteria 2961170736 2961176752 247
340 iso_pu_bacteria 2961183825 2961189629 247
341 iso_pu_bacteria 2965025482 2965028852 247
342 iso_pu_bacteria 2965032056 2965035236 247
343 iso_pu_bacteria 2965089291 2965090689 247
344 iso_pu_bacteria 2965102966 2965107746 247
345 iso_pu_bacteria 2965110997 2965113306 247
346 iso_pu_bacteria 2965119406 2965122423 247
347 iso_pu_bacteria 2967996073 2968001139 247
348 iso_pu_bacteria 2968003550 2968007192 247
349 iso_pu_bacteria 2968091066 2968094099 247
350 iso_pu_bacteria 2968110612 2968110685 247
351 iso_pu_bacteria 2968117919 2968121589 247
352 iso_pu_bacteria 2968128360 2968131306 247
353 iso_pu_bacteria 2968138860 2968143551 247
354 iso_pu_bacteria 2970503327 2970509425 247
355 iso_pu_bacteria 2970524798 2970525510 247
356 iso_pu_bacteria 2970532167 2970533716 247
357 iso_pu_bacteria 2970540015 2970543536 247
358 iso_pu_bacteria 2970547951 2970553787 247
359 iso_pu_bacteria 2970627176 2970629230 247
360 iso_pu_bacteria 2977821940 2977824346 247
361 iso_pu_bacteria 2977828996 2977830328 247
362 iso_pu_bacteria 2977843712 2977850033 247
363 iso_pu_bacteria 2977851361 2977855069 247
364 iso_pu_bacteria 2977858184 2977858385 247
365 iso_pu_bacteria 2977864932 2977868315 247
366 iso_pu_bacteria 2977872689 2977879993 247
367 iso_pu_bacteria 2977907340 2977909691 247
368 iso_pu_bacteria 2977915119 2977916363 247
369 iso_pu_bacteria 2977935797 2977940499 247
370 iso_pu_bacteria 2977942078 2977943646 247
371 iso_pu_bacteria 2977950692 2977953085 247
372 iso_pu_bacteria 2977957713 2977961377 247
373 iso_pu_bacteria 2977971508 2977977364 247
374 iso_pu_bacteria 2977986579 2977987348 247
375 iso_pu_bacteria 2979710463 2979712338 247
376 iso_pu_bacteria 2979742915 2979745169 247
377 iso_pu_bacteria 2979764755 2979767584 247
378 iso_pu_bacteria 2979772303 2979779247 247
379 iso_pu_bacteria 2979793036 2979795800 247
380 iso_pu_bacteria 2979808191 2979814212 247
381 iso_pu_bacteria 2987645492 2987652014 247
382 iso_pu_bacteria 2987666974 2987668403 247
383 iso_pu_bacteria 2987673487 2987680080 247
384 iso_pu_bacteria 2996341866 2996346132 247
385 iso_pu_bacteria 3004195979 3004196336 247
386 iso_pu_bacteria 3004203850 3004210338 247
387 iso_pu_bacteria 3004239961 3004241121 247
388 iso_pu_bacteria 3004248173 3004255432 247
389 iso_pu_bacteria 3004334049 3004338065 247
390 iso_pu_bacteria 649633066 649869923 247
391 iso_pu_bacteria 8004300914 8004307126 247
392 iso_pu_bacteria 8004312739 8004319613 247
393 iso_pu_bacteria 8004361976 8004365370 247
394 iso_pu_bacteria 8004374579 8004376785 247
395 iso_pu_bacteria 8004387939 8004395140 247
396 iso_pu_bacteria 8004395343 8004401445 247
397 iso_pu_bacteria 8004445564 8004449739 247
398 iso_pu_bacteria 8004633249 8004638722 247
399 iso_pu_bacteria 8004695233 8004698296 247
400 iso_pu_bacteria 8004714634 8004721461 247
401 iso_pu_bacteria 8004727605 8004729309 247
402 iso_pu_bacteria 8018150411 8018154654 247
403 iso_pu_bacteria 8055617313 8055617360 247
404 3300039450 Ga0436363_0664872 Ga0436363_0664872_1375_2304 248
405 iso_pu_bacteria 2510461069 2510841581 248
406 iso_pu_bacteria 2510917026 2511170198 248
407 iso_pu_bacteria 2585427633 2585997278 248
408 iso_pu_bacteria 2585427634 2586001887 248
409 iso_pu_bacteria 2600255279 2601612878 248
410 iso_pu_bacteria 2600255308 2601749607 248
411 iso_pu_bacteria 2643221558 2643813349 248
412 iso_pu_bacteria 2643221568 2643853693 248
413 iso_pu_bacteria 2643221653 2644299348 248
414 iso_pu_bacteria 2643221693 2644523219 248
415 iso_pu_bacteria 2643221719 2644657576 248
416 iso_pu_bacteria 2775507049 2776914688 248
417 iso_pu_bacteria 2808606387 2808989933 248
418 iso_pu_bacteria 2818991272 2819243921 248
419 iso_pu_bacteria 2821123053 2821126287 248
420 iso_pu_bacteria 2838736955 2838737237 248
421 iso_pu_bacteria 2841840854 2841842394 248
422 iso_pu_bacteria 2842140634 2842142174 248
423 iso_pu_bacteria 2847670302 2847672955 248
424 iso_pu_bacteria 2856314179 2856320013 248
425 iso_pu_bacteria 2857531043 2857532848 248
426 iso_pu_bacteria 2878035449 2878035563 248
427 iso_pu_bacteria 2899803654 2899804125 248
428 iso_pu_bacteria 2899845264 2899847623 248
429 iso_pu_bacteria 2906414383 2906420789 248
430 iso_pu_bacteria 2919166419 2919168122 248
431 iso_pu_bacteria 2926760298 2926764535 248
432 iso_pu_bacteria 2933594066 2933597324 248
433 iso_pu_bacteria 2979089926 2979090359 248
434 iso_pu_bacteria 2979095461 2979095885 248
435 iso_pu_bacteria 2989776772 2989780453 248
436 iso_pu_bacteria 3002141150 3002142258 248
437 iso_pu_bacteria 650716007 650844016 248
438 iso_pu_bacteria 8005246636 8005248233 248
439 iso_pu_bacteria 8056875544 8056876276 248
440 3300005548 Ga0070665_100235559 Ga0070665_1002355592 249
441 iso_pu_bacteria 2503198000 2503198050 249
442 iso_pu_bacteria 2508501123 2509113641 249
443 iso_pu_bacteria 2844009547 2844010085 249
444 iso_pu_bacteria 2869234852 2869236047 249
445 iso_pu_bacteria 2869256925 2869261205 249
446 iso_pu_bacteria 2871435913 2871436147 249
447 iso_pu_bacteria 2874109183 2874115535 249
448 iso_pu_bacteria 2878730984 2878735055 249
449 iso_pu_bacteria 2878760144 2878763566 249
450 iso_pu_bacteria 2878767105 2878770564 249
451 iso_pu_bacteria 2885305155 2885306252 249
452 iso_pu_bacteria 2885326080 2885329321 249
453 iso_pu_bacteria 2885334103 2885336017 249
454 iso_pu_bacteria 2903513507 2903517201 249
455 iso_pu_bacteria 2903540706 2903544181 249
456 iso_pu_bacteria 2924710171 2924715467 249
457 iso_pu_bacteria 2924733363 2924734293 249
458 iso_pu_bacteria 2937822353 2937826017 249
459 iso_pu_bacteria 2937994558 2937998025 249
460 iso_pu_bacteria 2958165035 2958168500 249
461 iso_pu_bacteria 2961163497 2961166964 249
462 iso_pu_bacteria 2965018300 2965021788 249
463 iso_pu_bacteria 2968171901 2968175370 249
464 iso_pu_bacteria 2970489779 2970494155 249
465 iso_pu_bacteria 2970554993 2970558408 249
466 iso_pu_bacteria 2970619444 2970622548 249
467 iso_pu_bacteria 2987659509 2987662976 249
468 iso_pu_bacteria 2996386984 2996388497 249
469 iso_pu_bacteria 3004167301 3004172539 249
470 iso_pu_bacteria 3004188549 3004192028 249
471 iso_pu_bacteria 3004232784 3004237279 249
472 iso_pu_bacteria 3004268573 3004269517 249
473 iso_pu_bacteria 8004640170 8004646918 249
474 3300003187 JGI25151J46595_10013943 JGI25151J46595_100139432 250
475 3300005262 Ga0065165_1007157 Ga0065165_10071572 250
476 3300005329 Ga0070683_100046296 Ga0070683_1000462963 250
477 3300005366 Ga0070659_100152539 Ga0070659_1001525392 250
478 3300005468 Ga0070707_100077038 Ga0070707_1000770384 250
479 3300005535 Ga0070684_100026544 Ga0070684_1000265442 250
480 3300005578 Ga0068854_100276701 Ga0068854_1002767012 250
481 3300005616 Ga0068852_100176957 Ga0068852_1001769572 250
482 3300013102 Ga0157371_10000031 Ga0157371_10000031186 250
483 3300013105 Ga0157369_10080776 Ga0157369_100807763 250
484 3300014497 Ga0182008_10162908 Ga0182008_101629081 250
485 3300020082 Ga0206353_10362164 Ga0206353_103621642 250
486 3300025932 Ga0207690_10042616 Ga0207690_100426162 250
487 3300026078 Ga0207702_10009797 Ga0207702_100097974 250
488 3300026142 Ga0207698_10016203 Ga0207698_100162033 250
489 3300031548 Ga0307408_100153959 Ga0307408_1001539592 250
490 3300037312 Ga0395899_0002420 Ga0395899_0002420_2946_3860 250
491 3300037418 Ga0395900_0006778 Ga0395900_0006778_475_1389 250
492 3300037418 Ga0395900_0446890 Ga0395900_0446890_107_1021 250
493 3300038443 Ga0395901_0000754 Ga0395901_0000754_8266_9180 250
494 3300038443 Ga0395901_0210996 Ga0395901_0210996_644_1558 250
495 3300046506 Ga0495583_0006812 Ga0495583_0006812_5260_6195 250
496 3300046507 Ga0495606_0175305 Ga0495606_0175305_211_1146 250
497 3300046692 Ga0495671_0040640 Ga0495671_0040640_534_1466 250
498 3300047470 Ga0495681_0009787 Ga0495681_0009787_2050_2982 250
499 3300048925 Ga0496122_0000107 Ga0496122_0000107_162794_163723 250
500 3300048926 Ga0496123_0000063 Ga0496123_0000063_29386_30315 250
501 3300048927 Ga0496124_0026109 Ga0496124_0026109_2379_3308 250
502 3300053140 Ga0500573_0001489 Ga0500573_0001489_7657_8586 250
503 3300003781 Ga0055536_1019144 Ga0055536_10191441 251
504 3300003794 Ga0055531_10005891 Ga0055531_100058913 251
505 3300005356 Ga0070674_100238732 Ga0070674_1002387322 251
506 3300005539 Ga0068853_100264066 Ga0068853_1002640662 251
507 3300005548 Ga0070665_100163017 Ga0070665_1001630172 251
508 3300005843 Ga0068860_100137445 Ga0068860_1001374452 251
509 3300005937 Ga0081455_10006243 Ga0081455_100062436 251
510 3300006038 Ga0075365_10133552 Ga0075365_101335522 251
511 3300006051 Ga0075364_10062399 Ga0075364_100623993 251
512 3300006177 Ga0075362_10060103 Ga0075362_100601032 251
513 3300025292 Ga0209676_1002662 Ga0209676_10026625 251
514 3300025297 Ga0209758_1000105 Ga0209758_100010585 251
515 3300025298 Ga0209050_1007330 Ga0209050_10073303 251
516 3300025304 Ga0209257_1002982 Ga0209257_100298218 251
517 3300025907 Ga0207645_10066091 Ga0207645_100660912 251
518 3300027671 Ga0209588_1046090 Ga0209588_10460902 251
519 3300028379 Ga0268266_10115059 Ga0268266_101150593 251
520 3300028379 Ga0268266_10125430 Ga0268266_101254303 251
521 3300031456 Ga0307513_10372067 Ga0307513_103720672 251
522 3300031911 Ga0307412_10168281 Ga0307412_101682812 251
523 3300037471 Ga0395905_0131670 Ga0395905_0131670_257_1177 251
524 3300038443 Ga0395901_0145068 Ga0395901_0145068_1096_2016 251
525 3300042157 Ga0439458_0006926 Ga0439458_0006926_658_1578 251
526 3300044694 Ga0466963_0021335 Ga0466963_0021335_2511_3437 251
527 3300045976 Ga0466967_0004345 Ga0466967_0004345_6543_7469 251
528 3300046542 Ga0495597_0050871 Ga0495597_0050871_346_1266 251
529 3300048924 Ga0496121_0000180 Ga0496121_0000180_76856_77788 251
530 3300048924 Ga0496121_0145971 Ga0496121_0145971_445_1377 251
531 3300049568 Ga0501031_0000218 Ga0501031_0000218_19070_19996 251
532 3300049568 Ga0501031_0140656 Ga0501031_0140656_224_1150 251
533 3300049569 Ga0501032_0000457 Ga0501032_0000457_19070_19996 251
534 3300049570 Ga0501033_0000612 Ga0501033_0000612_19070_19996 251
535 3300049571 Ga0501034_0001364 Ga0501034_0001364_19070_19996 251
536 3300049572 Ga0501036_0000335 Ga0501036_0000335_19070_19996 251
537 3300049573 Ga0501037_0000468 Ga0501037_0000468_19070_19996 251
538 3300049573 Ga0501037_0262859 Ga0501037_0262859_224_1150 251
539 3300049574 Ga0501038_0000557 Ga0501038_0000557_12966_13892 251
540 3300049575 Ga0501039_0000689 Ga0501039_0000689_19070_19996 251
541 3300049575 Ga0501039_0192987 Ga0501039_0192987_251_1177 251
542 3300049576 Ga0501040_0005022 Ga0501040_0005022_7592_8518 251
543 3300049579 Ga0501043_0004029 Ga0501043_0004029_3757_4683 251
544 3300049581 Ga0501047_0003732 Ga0501047_0003732_132_1058 251
545 3300049581 Ga0501047_0434377 Ga0501047_0434377_162_1088 251
546 3300049586 Ga0501070_0002902 Ga0501070_0002902_9686_10612 251
547 3300049590 Ga0501074_0120965 Ga0501074_0120965_824_1750 251
548 3300049822 Ga0501035_0000833 Ga0501035_0000833_12966_13892 251
549 3300049822 Ga0501035_0365333 Ga0501035_0365333_224_1150 251
550 3300049823 Ga0501044_0001065 Ga0501044_0001065_12966_13892 251
551 3300049823 Ga0501044_0141041 Ga0501044_0141041_1249_2175 251
552 3300050489 nmdc:mga03683_11486_c1 nmdc:mga03683_11486_c1_1471_2391 251
553 3300050492 nmdc:mga0yw44_128819_c1 nmdc:mga0yw44_128819_c1_140_1060 251
554 3300050492 nmdc:mga0yw44_51605_c1 nmdc:mga0yw44_51605_c1_705_1625 251
555 3300053153 Ga0500616_0000402 Ga0500616_0000402_18577_19509 251
556 3300053161 Ga0500634_0003689 Ga0500634_0003689_4468_5397 251
557 3300006946 Ga0079104_1000063 Ga0079104_100006335 252
558 3300013102 Ga0157371_10078481 Ga0157371_100784813 252
559 3300027111 Ga0209281_1000110 Ga0209281_100011036 252
560 3300031456 Ga0307513_10033850 Ga0307513_100338502 252
561 3300031731 Ga0307405_10109767 Ga0307405_101097672 252
562 3300036647 Ga0316582_0066958 Ga0316582_0066958_36_944 252
563 3300036712 Ga0316584_0046390 Ga0316584_0046390_643_1551 252
564 3300046530 Ga0495654_0000121 Ga0495654_0000121_9905_10837 252
565 3300048919 Ga0496116_0000135 Ga0496116_0000135_133903_134835 252
566 3300048924 Ga0496121_0033506 Ga0496121_0033506_2555_3487 252
567 3300048929 Ga0496126_0000129 Ga0496126_0000129_79773_80705 252
568 3300049742 Ga0501080_0017603 Ga0501080_0017603_920_1855 252
569 3300053158 Ga0500627_0114783 Ga0500627_0114783_185_1117 252
570 3300037471 Ga0395905_0016420 Ga0395905_0016420_4919_5776 253
571 3300048925 Ga0496122_0041808 Ga0496122_0041808_1505_2362 253
572 3300049569 Ga0501032_0192067 Ga0501032_0192067_377_1315 253
573 3300049575 Ga0501039_0262536 Ga0501039_0262536_285_1223 253
574 3300049580 Ga0501046_0090035 Ga0501046_0090035_382_1320 253
575 3300049581 Ga0501047_0031479 Ga0501047_0031479_2506_3444 253
576 3300049583 Ga0501067_0080353 Ga0501067_0080353_769_1707 253
577 3300049584 Ga0501068_0162103 Ga0501068_0162103_186_1124 253
578 3300049585 Ga0501069_0063668 Ga0501069_0063668_874_1812 253
579 3300049589 Ga0501073_0006938 Ga0501073_0006938_4594_5532 253
580 3300049744 Ga0501083_0047441 Ga0501083_0047441_443_1381 253
581 3300049823 Ga0501044_0025899 Ga0501044_0025899_4468_5406 253
582 3300053125 Ga0500618_027850 Ga0500618_027850_275_1210 253
583 3300060353 Ga0501082_0015647 Ga0501082_0015647_4096_5034 253
584 3300003215 JGI25153J46596_10000042 JGI25153J46596_1000004268 254
585 3300003775 Ga0055524_1006688 Ga0055524_10066882 254
586 3300025297 Ga0209758_1000110 Ga0209758_1000110136 254
587 3300031911 Ga0307412_10009953 Ga0307412_100099532 254
588 3300049569 Ga0501032_0003237 Ga0501032_0003237_4116_5057 254
589 3300049570 Ga0501033_0011511 Ga0501033_0011511_2434_3375 254
590 3300049572 Ga0501036_0020894 Ga0501036_0020894_2316_3257 254
591 3300049573 Ga0501037_0008942 Ga0501037_0008942_5366_6307 254
592 3300049574 Ga0501038_0001830 Ga0501038_0001830_7592_8533 254
593 3300049575 Ga0501039_0029011 Ga0501039_0029011_3037_3978 254
594 3300049579 Ga0501043_0003061 Ga0501043_0003061_4116_5057 254
595 3300049580 Ga0501046_0000538 Ga0501046_0000538_9522_10463 254
596 3300049583 Ga0501067_0027215 Ga0501067_0027215_608_1549 254
597 3300049584 Ga0501068_0010475 Ga0501068_0010475_283_1224 254
598 3300049585 Ga0501069_0003212 Ga0501069_0003212_808_1749 254
599 3300049586 Ga0501070_0002737 Ga0501070_0002737_13666_14607 254
600 3300049586 Ga0501070_0059818 Ga0501070_0059818_904_1845 254
601 3300049588 Ga0501072_0104241 Ga0501072_0104241_712_1653 254
602 3300049589 Ga0501073_0001283 Ga0501073_0001283_8525_9466 254
603 3300049590 Ga0501074_0006735 Ga0501074_0006735_5382_6323 254
604 3300049742 Ga0501080_0020335 Ga0501080_0020335_138_1079 254
605 3300049742 Ga0501080_0170231 Ga0501080_0170231_159_1100 254
606 3300049822 Ga0501035_0116093 Ga0501035_0116093_24_965 254
607 3300049823 Ga0501044_0201141 Ga0501044_0201141_254_1195 254
608 3300053153 Ga0500616_0002189 Ga0500616_0002189_10814_11755 254
609 3300054114 Ga0501084_0215744 Ga0501084_0215744_646_1587 254
610 3300060353 Ga0501082_0097418 Ga0501082_0097418_24_965 254
611 3300005844 Ga0068862_100021865 Ga0068862_1000218654 255
612 3300028380 Ga0268265_10008132 Ga0268265_100081323 255
613 3300031616 Ga0307508_10130336 Ga0307508_101303362 255
614 3300046460 Ga0495638_0075200 Ga0495638_0075200_710_1654 255
615 3300046507 Ga0495606_0000286 Ga0495606_0000286_53539_54390 255
616 3300047472 Ga0495686_0114040 Ga0495686_0114040_666_1517 255
617 3300048914 Ga0496111_0001276 Ga0496111_0001276_11519_12463 255
618 3300048924 Ga0496121_0021681 Ga0496121_0021681_79_930 255
619 3300048925 Ga0496122_0054210 Ga0496122_0054210_1972_2916 255
620 3300048926 Ga0496123_0021425 Ga0496123_0021425_3163_4107 255
621 3300049570 Ga0501033_0186064 Ga0501033_0186064_370_1317 255
622 3300049589 Ga0501073_0005747 Ga0501073_0005747_1273_2220 255
623 3300049742 Ga0501080_0049140 Ga0501080_0049140_771_1718 255
624 3300049744 Ga0501083_0008800 Ga0501083_0008800_2491_3438 255
625 3300053093 Ga0500651_0112383 Ga0500651_0112383_291_1238 255
626 3300053130 Ga0500642_0004355 Ga0500642_0004355_1272_2216 255
627 3300053139 Ga0500568_0031326 Ga0500568_0031326_648_1592 255
628 3300053731 Ga0500609_001093 Ga0500609_001093_22_966 255
629 3300002773 JGI25152J39213_1003077 JGI25152J39213_10030773 257
630 3300002773 JGI25152J39213_1005946 JGI25152J39213_10059463 257
631 3300002774 JGI25150J39212_1007349 JGI25150J39212_10073492 257
632 3300003215 JGI25153J46596_10005915 JGI25153J46596_100059153 257
633 3300025245 Ga0207425_1000730 Ga0207425_10007309 257
634 3300025258 Ga0209129_1000786 Ga0209129_100078610 257
635 3300025294 Ga0209025_1012876 Ga0209025_10128764 257
636 3300025297 Ga0209758_1000422 Ga0209758_100042229 257
637 3300039437 Ga0436365_0561599 Ga0436365_0561599_308_1258 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

133

316

0.98

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

43

92

0.93

Feature Viewer

pLDDT pTM Quality
67.68 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map