F471341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 636 | 412 | 635 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_11317636|Ga0207693_113176361 |
| Length | 128 |
| Sequence | MGRSRGGLTTKIHAVVDADGLPIALKLTPGQAHDGRSADGLLESLDAGDILLADRGAWANIKPMPNRKNVPAFSAFLYRYRNLVECFFNRLKHFRAVATRYDKRDDNFLASVQLASIRIWLRHNESVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 235 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 236 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 240 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 241 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 242 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 243 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 244 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 247 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 248 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 339 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 375 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 380 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 382 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 383 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 384 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 387 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 388 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 391 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 392 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 397 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 400 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 403 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 404 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 409 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 410 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.18 |
| Nodule | 0 |
| Rhizoplane | 4.25 |
| Rhizosphere | 83.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10319136 | 3300003320 | Bacteria | 1322 |
| 2 | JGI25405J52794_10148316 | 3300003911 | Bacteria | 534 |
| 3 | Ga0070690_100395001 | 3300005330 | Bacteria | 1014 |
| 4 | Ga0070670_101272407 | 3300005331 | Bacteria | 673 |
| 5 | Ga0068869_100170591 | 3300005334 | Bacteria | 1699 |
| 6 | Ga0070666_10134811 | 3300005335 | Bacteria | 1717 |
| 7 | Ga0070666_10203354 | 3300005335 | Bacteria | 1393 |
| 8 | Ga0070666_10468884 | 3300005335 | Bacteria | 911 |
| 9 | Ga0068868_100232045 | 3300005338 | Bacteria | 1548 |
| 10 | Ga0068868_100625599 | 3300005338 | Bacteria | 956 |
| 11 | Ga0070660_100544555 | 3300005339 | Bacteria | 968 |
| 12 | Ga0070689_100247915 | 3300005340 | Bacteria | 1469 |
| 13 | Ga0070689_100445660 | 3300005340 | Bacteria | 1101 |
| 14 | Ga0070691_10578150 | 3300005341 | Bacteria | 660 |
| 15 | Ga0070687_100187038 | 3300005343 | Bacteria | 1245 |
| 16 | Ga0070687_100264273 | 3300005343 | Bacteria | 1075 |
| 17 | Ga0070661_100159912 | 3300005344 | Bacteria | 1706 |
| 18 | Ga0070668_100404120 | 3300005347 | Bacteria | 1167 |
| 19 | Ga0070669_100686740 | 3300005353 | Bacteria | 863 |
| 20 | Ga0070675_100594931 | 3300005354 | Bacteria | 1003 |
| 21 | Ga0070675_100708916 | 3300005354 | Bacteria | 917 |
| 22 | Ga0070671_100389336 | 3300005355 | Bacteria | 1192 |
| 23 | Ga0070674_100314372 | 3300005356 | Bacteria | 1253 |
| 24 | Ga0070673_100282682 | 3300005364 | Bacteria | 1456 |
| 25 | Ga0070688_100206560 | 3300005365 | Bacteria | 1377 |
| 26 | Ga0070659_100423121 | 3300005366 | Bacteria | 1127 |
| 27 | Ga0070667_100617351 | 3300005367 | Bacteria | 1000 |
| 28 | Ga0070667_100893263 | 3300005367 | Bacteria | 827 |
| 29 | Ga0070709_10331006 | 3300005434 | Bacteria | 1120 |
| 30 | Ga0070714_100123094 | 3300005435 | Bacteria | 2309 |
| 31 | Ga0070705_100238843 | 3300005440 | Bacteria | 1269 |
| 32 | Ga0070700_100232014 | 3300005441 | Bacteria | 1314 |
| 33 | Ga0070700_101354988 | 3300005441 | Bacteria | 600 |
| 34 | Ga0070694_100393886 | 3300005444 | Bacteria | 1083 |
| 35 | Ga0070663_100552616 | 3300005455 | Bacteria | 963 |
| 36 | Ga0070678_100434545 | 3300005456 | Bacteria | 1147 |
| 37 | Ga0070678_100456859 | 3300005456 | Bacteria | 1119 |
| 38 | Ga0070662_100597875 | 3300005457 | Bacteria | 928 |
| 39 | Ga0070662_100689140 | 3300005457 | Bacteria | 864 |
| 40 | Ga0068867_100189581 | 3300005459 | Bacteria | 1640 |
| 41 | Ga0068867_100350586 | 3300005459 | Bacteria | 1231 |
| 42 | Ga0068867_100577234 | 3300005459 | Bacteria | 977 |
| 43 | Ga0070685_10162681 | 3300005466 | Bacteria | 1424 |
| 44 | Ga0070706_100489263 | 3300005467 | Bacteria | 1145 |
| 45 | Ga0070707_101616538 | 3300005468 | Bacteria | 615 |
| 46 | Ga0070698_100313401 | 3300005471 | Bacteria | 1500 |
| 47 | Ga0070698_100643985 | 3300005471 | Bacteria | 1001 |
| 48 | Ga0070679_100782721 | 3300005530 | Bacteria | 897 |
| 49 | Ga0070697_100205007 | 3300005536 | Bacteria | 1677 |
| 50 | Ga0070697_100540802 | 3300005536 | Bacteria | 1021 |
| 51 | Ga0068853_100625321 | 3300005539 | Bacteria | 1024 |
| 52 | Ga0068853_100797578 | 3300005539 | Bacteria | 904 |
| 53 | Ga0068853_100855751 | 3300005539 | Bacteria | 872 |
| 54 | Ga0070672_100397290 | 3300005543 | Bacteria | 1181 |
| 55 | Ga0070672_100411862 | 3300005543 | Bacteria | 1160 |
| 56 | Ga0070672_100707969 | 3300005543 | Bacteria | 882 |
| 57 | Ga0070695_100688708 | 3300005545 | Bacteria | 810 |
| 58 | Ga0070696_100471369 | 3300005546 | Bacteria | 994 |
| 59 | Ga0070665_100435626 | 3300005548 | Bacteria | 1320 |
| 60 | Ga0070665_101902417 | 3300005548 | Bacteria | 601 |
| 61 | Ga0070704_100361859 | 3300005549 | Bacteria | 1228 |
| 62 | Ga0068855_100793789 | 3300005563 | Bacteria | 1007 |
| 63 | Ga0070664_100225810 | 3300005564 | Bacteria | 1677 |
| 64 | Ga0068854_100320485 | 3300005578 | Unclassified | 1260 |
| 65 | Ga0068856_101150740 | 3300005614 | Bacteria | 793 |
| 66 | Ga0070702_100252822 | 3300005615 | Bacteria | 1195 |
| 67 | Ga0070702_100341911 | 3300005615 | Bacteria | 1051 |
| 68 | Ga0070702_100406835 | 3300005615 | Bacteria | 975 |
| 69 | Ga0068852_100505776 | 3300005616 | Bacteria | 1204 |
| 70 | Ga0068852_100616248 | 3300005616 | Bacteria | 1091 |
| 71 | Ga0068852_100731478 | 3300005616 | Bacteria | 1001 |
| 72 | Ga0068852_100808224 | 3300005616 | Bacteria | 952 |
| 73 | Ga0068859_100244323 | 3300005617 | Bacteria | 1884 |
| 74 | Ga0068864_100572369 | 3300005618 | Bacteria | 1094 |
| 75 | Ga0068864_100856703 | 3300005618 | Bacteria | 896 |
| 76 | Ga0068866_10186635 | 3300005718 | Bacteria | 1229 |
| 77 | Ga0068866_10299707 | 3300005718 | Bacteria | 1003 |
| 78 | Ga0068858_100346013 | 3300005842 | Bacteria | 1423 |
| 79 | Ga0068860_100560266 | 3300005843 | Bacteria | 1145 |
| 80 | Ga0068860_100872582 | 3300005843 | Bacteria | 915 |
| 81 | Ga0068860_100938268 | 3300005843 | Bacteria | 882 |
| 82 | Ga0068862_100312862 | 3300005844 | Bacteria | 1448 |
| 83 | Ga0068862_101729899 | 3300005844 | Bacteria | 634 |
| 84 | Ga0081455_10083951 | 3300005937 | Bacteria | 2601 |
| 85 | Ga0081455_10304431 | 3300005937 | Bacteria | 1142 |
| 86 | Ga0081538_10030964 | 3300005981 | Bacteria | 3619 |
| 87 | Ga0081539_10164302 | 3300005985 | Bacteria | 1055 |
| 88 | Ga0081539_10169805 | 3300005985 | Bacteria | 1032 |
| 89 | Ga0081539_10385167 | 3300005985 | Bacteria | 584 |
| 90 | Ga0070717_10369753 | 3300006028 | Bacteria | 1284 |
| 91 | Ga0070717_10397643 | 3300006028 | Bacteria | 1237 |
| 92 | Ga0075365_10338300 | 3300006038 | Bacteria | 1060 |
| 93 | Ga0075368_10069558 | 3300006042 | Bacteria | 1420 |
| 94 | Ga0075363_100167654 | 3300006048 | Bacteria | 1245 |
| 95 | Ga0075432_10385126 | 3300006058 | Bacteria | 602 |
| 96 | Ga0070715_10243337 | 3300006163 | Bacteria | 936 |
| 97 | Ga0070716_100214425 | 3300006173 | Bacteria | 1289 |
| 98 | Ga0075367_10095347 | 3300006178 | Bacteria | 1814 |
| 99 | Ga0097621_100432146 | 3300006237 | Bacteria | 1183 |
| 100 | Ga0068871_100355421 | 3300006358 | Bacteria | 1297 |
| 101 | Ga0075430_100144437 | 3300006846 | Bacteria | 1981 |
| 102 | Ga0068865_100370892 | 3300006881 | Bacteria | 1165 |
| 103 | Ga0097620_100244335 | 3300006931 | Bacteria | 1884 |
| 104 | Ga0105240_10390814 | 3300009093 | Bacteria | 1569 |
| 105 | Ga0105240_10791253 | 3300009093 | Bacteria | 1028 |
| 106 | Ga0111539_10570907 | 3300009094 | Bacteria | 1317 |
| 107 | Ga0111539_11064239 | 3300009094 | Bacteria | 940 |
| 108 | Ga0111539_11153486 | 3300009094 | Bacteria | 900 |
| 109 | Ga0105245_10429144 | 3300009098 | Bacteria | 1326 |
| 110 | Ga0105247_11592676 | 3300009101 | Bacteria | 536 |
| 111 | Ga0105243_10093774 | 3300009148 | Bacteria | 2478 |
| 112 | Ga0105243_10606818 | 3300009148 | Bacteria | 1054 |
| 113 | Ga0105243_10658401 | 3300009148 | Bacteria | 1016 |
| 114 | Ga0105243_10904623 | 3300009148 | Bacteria | 878 |
| 115 | Ga0105241_10478520 | 3300009174 | Bacteria | 1106 |
| 116 | Ga0105241_10516931 | 3300009174 | Bacteria | 1067 |
| 117 | Ga0105242_10246042 | 3300009176 | Bacteria | 1610 |
| 118 | Ga0105242_10554012 | 3300009176 | Bacteria | 1103 |
| 119 | Ga0105242_11335881 | 3300009176 | Bacteria | 742 |
| 120 | Ga0105248_10757025 | 3300009177 | Bacteria | 1096 |
| 121 | Ga0105248_11124767 | 3300009177 | Bacteria | 888 |
| 122 | Ga0105237_10374119 | 3300009545 | Bacteria | 1429 |
| 123 | Ga0105238_10530280 | 3300009551 | Bacteria | 1181 |
| 124 | Ga0105238_10754690 | 3300009551 | Bacteria | 987 |
| 125 | Ga0105249_10329068 | 3300009553 | Bacteria | 1541 |
| 126 | Ga0105249_12333153 | 3300009553 | Bacteria | 608 |
| 127 | Ga0099796_10118101 | 3300010159 | Bacteria | 1016 |
| 128 | Ga0105239_10771069 | 3300010375 | Bacteria | 1101 |
| 129 | Ga0105239_10891467 | 3300010375 | Bacteria | 1021 |
| 130 | Ga0105246_10342609 | 3300011119 | Bacteria | 1222 |
| 131 | Ga0105246_10485202 | 3300011119 | Bacteria | 1046 |
| 132 | Ga0157338_1005719 | 3300012515 | Unclassified | 1127 |
| 133 | Ga0157369_10003558 | 3300013105 | Bacteria | 18510 |
| 134 | Ga0157369_10522502 | 3300013105 | Bacteria | 1228 |
| 135 | Ga0157378_10177412 | 3300013297 | Bacteria | 2002 |
| 136 | Ga0157378_10450926 | 3300013297 | Bacteria | 1277 |
| 137 | Ga0157378_10617084 | 3300013297 | Bacteria | 1097 |
| 138 | Ga0163162_10419434 | 3300013306 | Bacteria | 1471 |
| 139 | Ga0163162_10465644 | 3300013306 | Bacteria | 1395 |
| 140 | Ga0163162_10671187 | 3300013306 | Bacteria | 1159 |
| 141 | Ga0163162_12796065 | 3300013306 | Bacteria | 562 |
| 142 | Ga0157375_10704517 | 3300013308 | Bacteria | 1163 |
| 143 | Ga0163163_10790288 | 3300014325 | Bacteria | 1012 |
| 144 | Ga0163163_11993983 | 3300014325 | Bacteria | 640 |
| 145 | Ga0157380_10401638 | 3300014326 | Bacteria | 1300 |
| 146 | Ga0157380_10422128 | 3300014326 | Bacteria | 1272 |
| 147 | Ga0157377_10226864 | 3300014745 | Bacteria | 1199 |
| 148 | Ga0157377_10454881 | 3300014745 | Bacteria | 885 |
| 149 | Ga0157376_10592419 | 3300014969 | Bacteria | 1103 |
| 150 | Ga0182007_10118846 | 3300015262 | Bacteria | 883 |
| 151 | Ga0182005_1034174 | 3300015265 | Bacteria | 1383 |
| 152 | Ga0163161_10497423 | 3300017792 | Bacteria | 992 |
| 153 | Ga0213873_10027059 | 3300021358 | Bacteria | 1396 |
| 154 | Ga0213872_10011011 | 3300021361 | Bacteria | 4290 |
| 155 | Ga0213872_10030387 | 3300021361 | Bacteria | 2476 |
| 156 | Ga0213872_10055944 | 3300021361 | Bacteria | 1787 |
| 157 | Ga0213872_10149140 | 3300021361 | Bacteria | 1022 |
| 158 | Ga0213874_10050111 | 3300021377 | Bacteria | 1278 |
| 159 | Ga0213876_10023733 | 3300021384 | Bacteria | 3237 |
| 160 | Ga0213876_10336794 | 3300021384 | Bacteria | 802 |
| 161 | Ga0213875_10036016 | 3300021388 | Bacteria | 2333 |
| 162 | Ga0213871_10027107 | 3300021441 | Bacteria | 1469 |
| 163 | Ga0213871_10063017 | 3300021441 | Bacteria | 1035 |
| 164 | Ga0207692_10270735 | 3300025898 | Bacteria | 1024 |
| 165 | Ga0207642_10175029 | 3300025899 | Bacteria | 1164 |
| 166 | Ga0207688_10273324 | 3300025901 | Bacteria | 1028 |
| 167 | Ga0207680_10055136 | 3300025903 | Bacteria | 2394 |
| 168 | Ga0207680_10204514 | 3300025903 | Bacteria | 1347 |
| 169 | Ga0207680_10235222 | 3300025903 | Bacteria | 1260 |
| 170 | Ga0207647_10119111 | 3300025904 | Bacteria | 1557 |
| 171 | Ga0207685_10174967 | 3300025905 | Bacteria | 991 |
| 172 | Ga0207699_10475628 | 3300025906 | Bacteria | 899 |
| 173 | Ga0207645_10072709 | 3300025907 | Bacteria | 2201 |
| 174 | Ga0207645_10073232 | 3300025907 | Bacteria | 2193 |
| 175 | Ga0207643_10457882 | 3300025908 | Bacteria | 812 |
| 176 | Ga0207654_10387519 | 3300025911 | Bacteria | 969 |
| 177 | Ga0207707_10654465 | 3300025912 | Bacteria | 885 |
| 178 | Ga0207695_10319174 | 3300025913 | Bacteria | 1443 |
| 179 | Ga0207695_10702176 | 3300025913 | Bacteria | 892 |
| 180 | Ga0207693_11317636 | 3300025915 | Bacteria | 539 |
| 181 | Ga0207663_10017696 | 3300025916 | Bacteria | 3978 |
| 182 | Ga0207662_10095938 | 3300025918 | Bacteria | 1831 |
| 183 | Ga0207657_10313636 | 3300025919 | Bacteria | 1241 |
| 184 | Ga0207657_10665675 | 3300025919 | Bacteria | 810 |
| 185 | Ga0207649_10021569 | 3300025920 | Bacteria | 3710 |
| 186 | Ga0207649_10573817 | 3300025920 | Bacteria | 865 |
| 187 | Ga0207652_10475255 | 3300025921 | Bacteria | 1126 |
| 188 | Ga0207681_10657595 | 3300025923 | Bacteria | 869 |
| 189 | Ga0207694_11526876 | 3300025924 | Bacteria | 563 |
| 190 | Ga0207650_10415149 | 3300025925 | Bacteria | 1116 |
| 191 | Ga0207650_11171654 | 3300025925 | Bacteria | 654 |
| 192 | Ga0207659_11008040 | 3300025926 | Bacteria | 716 |
| 193 | Ga0207687_10696629 | 3300025927 | Bacteria | 862 |
| 194 | Ga0207700_10474169 | 3300025928 | Bacteria | 1105 |
| 195 | Ga0207706_10222117 | 3300025933 | Bacteria | 1654 |
| 196 | Ga0207706_10599498 | 3300025933 | Bacteria | 946 |
| 197 | Ga0207686_10123401 | 3300025934 | Bacteria | 1766 |
| 198 | Ga0207686_10508584 | 3300025934 | Bacteria | 936 |
| 199 | Ga0207709_10038008 | 3300025935 | Bacteria | 2863 |
| 200 | Ga0207709_10554805 | 3300025935 | Bacteria | 904 |
| 201 | Ga0207709_10628256 | 3300025935 | Bacteria | 853 |
| 202 | Ga0207670_10569658 | 3300025936 | Bacteria | 927 |
| 203 | Ga0207670_10632155 | 3300025936 | Bacteria | 881 |
| 204 | Ga0207669_10437309 | 3300025937 | Bacteria | 1033 |
| 205 | Ga0207669_10526105 | 3300025937 | Bacteria | 950 |
| 206 | Ga0207704_10674911 | 3300025938 | Bacteria | 853 |
| 207 | Ga0207665_10027888 | 3300025939 | Bacteria | 3730 |
| 208 | Ga0207691_10174553 | 3300025940 | Bacteria | 1880 |
| 209 | Ga0207691_10497434 | 3300025940 | Bacteria | 1035 |
| 210 | Ga0207691_10498579 | 3300025940 | Bacteria | 1034 |
| 211 | Ga0207711_10490292 | 3300025941 | Bacteria | 1145 |
| 212 | Ga0207689_10542681 | 3300025942 | Bacteria | 976 |
| 213 | Ga0207689_10589058 | 3300025942 | Bacteria | 935 |
| 214 | Ga0207689_11100878 | 3300025942 | Bacteria | 670 |
| 215 | Ga0207679_10645567 | 3300025945 | Bacteria | 957 |
| 216 | Ga0207679_11028237 | 3300025945 | Bacteria | 755 |
| 217 | Ga0207667_10716470 | 3300025949 | Bacteria | 1002 |
| 218 | Ga0207651_11284221 | 3300025960 | Bacteria | 658 |
| 219 | Ga0207712_10262193 | 3300025961 | Bacteria | 1402 |
| 220 | Ga0207668_10797403 | 3300025972 | Bacteria | 836 |
| 221 | Ga0207640_10599350 | 3300025981 | Bacteria | 932 |
| 222 | Ga0207658_10623135 | 3300025986 | Bacteria | 971 |
| 223 | Ga0207703_10362307 | 3300026035 | Bacteria | 1337 |
| 224 | Ga0207639_10002990 | 3300026041 | Bacteria | 11380 |
| 225 | Ga0207639_10657006 | 3300026041 | Bacteria | 970 |
| 226 | Ga0207639_10766078 | 3300026041 | Bacteria | 898 |
| 227 | Ga0207639_11849834 | 3300026041 | Bacteria | 564 |
| 228 | Ga0207678_10444333 | 3300026067 | Bacteria | 1126 |
| 229 | Ga0207678_11292257 | 3300026067 | Bacteria | 646 |
| 230 | Ga0207708_10038597 | 3300026075 | Bacteria | 3638 |
| 231 | Ga0207708_10310395 | 3300026075 | Bacteria | 1285 |
| 232 | Ga0207702_10874174 | 3300026078 | Bacteria | 890 |
| 233 | Ga0207641_10025835 | 3300026088 | Bacteria | 4843 |
| 234 | Ga0207648_10541089 | 3300026089 | Bacteria | 1069 |
| 235 | Ga0207648_10559031 | 3300026089 | Bacteria | 1052 |
| 236 | Ga0207676_10505456 | 3300026095 | Bacteria | 1148 |
| 237 | Ga0207676_11256590 | 3300026095 | Bacteria | 735 |
| 238 | Ga0207674_11709402 | 3300026116 | Bacteria | 597 |
| 239 | Ga0207675_100232312 | 3300026118 | Bacteria | 1780 |
| 240 | Ga0207675_100657888 | 3300026118 | Bacteria | 1054 |
| 241 | Ga0207683_10025033 | 3300026121 | Bacteria | 5146 |
| 242 | Ga0207683_10615589 | 3300026121 | Bacteria | 1005 |
| 243 | Ga0207683_10796843 | 3300026121 | Bacteria | 877 |
| 244 | Ga0207683_11376328 | 3300026121 | Bacteria | 653 |
| 245 | Ga0207698_10499738 | 3300026142 | Bacteria | 1183 |
| 246 | Ga0207698_10991474 | 3300026142 | Bacteria | 850 |
| 247 | Ga0207698_11306307 | 3300026142 | Bacteria | 740 |
| 248 | Ga0209974_10228386 | 3300027876 | Bacteria | 695 |
| 249 | Ga0268266_10436933 | 3300028379 | Bacteria | 1242 |
| 250 | Ga0268266_10757470 | 3300028379 | Bacteria | 937 |
| 251 | Ga0268265_10770703 | 3300028380 | Bacteria | 935 |
| 252 | Ga0268265_10798719 | 3300028380 | Bacteria | 919 |
| 253 | Ga0268264_11029626 | 3300028381 | Bacteria | 830 |
| 254 | Ga0268264_11268438 | 3300028381 | Bacteria | 747 |
| 255 | Ga0265326_10062338 | 3300028558 | Bacteria | 1054 |
| 256 | Ga0265334_10192344 | 3300028573 | Bacteria | 710 |
| 257 | Ga0265318_10100799 | 3300028577 | Bacteria | 1062 |
| 258 | Ga0265338_10339643 | 3300028800 | Bacteria | 1082 |
| 259 | Ga0265338_10709910 | 3300028800 | Bacteria | 693 |
| 260 | Ga0265324_10086692 | 3300029957 | Bacteria | 1064 |
| 261 | Ga0265330_10137848 | 3300031235 | Bacteria | 1037 |
| 262 | Ga0265330_10189007 | 3300031235 | Bacteria | 872 |
| 263 | Ga0265332_10164097 | 3300031238 | Bacteria | 927 |
| 264 | Ga0265328_10100034 | 3300031239 | Bacteria | 1074 |
| 265 | Ga0265328_10135239 | 3300031239 | Bacteria | 923 |
| 266 | Ga0265320_10027217 | 3300031240 | Bacteria | 2984 |
| 267 | Ga0265320_10145521 | 3300031240 | Bacteria | 1071 |
| 268 | Ga0265325_10017004 | 3300031241 | Bacteria | 4053 |
| 269 | Ga0265325_10183757 | 3300031241 | Bacteria | 972 |
| 270 | Ga0265325_10210721 | 3300031241 | Bacteria | 892 |
| 271 | Ga0265329_10075906 | 3300031242 | Bacteria | 1063 |
| 272 | Ga0265329_10093342 | 3300031242 | Bacteria | 955 |
| 273 | Ga0265329_10096743 | 3300031242 | Bacteria | 938 |
| 274 | Ga0265340_10123751 | 3300031247 | Bacteria | 1188 |
| 275 | Ga0265340_10137232 | 3300031247 | Bacteria | 1119 |
| 276 | Ga0265340_10167051 | 3300031247 | Bacteria | 998 |
| 277 | Ga0265339_10061812 | 3300031249 | Bacteria | 2014 |
| 278 | Ga0265339_10142027 | 3300031249 | Bacteria | 1220 |
| 279 | Ga0265339_10177780 | 3300031249 | Bacteria | 1061 |
| 280 | Ga0265339_10336390 | 3300031249 | Bacteria | 714 |
| 281 | Ga0265331_10007247 | 3300031250 | Bacteria | 6433 |
| 282 | Ga0265331_10160903 | 3300031250 | Bacteria | 1017 |
| 283 | Ga0265327_10124936 | 3300031251 | Bacteria | 1215 |
| 284 | Ga0265316_10039062 | 3300031344 | Bacteria | 3815 |
| 285 | Ga0265316_10244253 | 3300031344 | Bacteria | 1320 |
| 286 | Ga0265316_10401175 | 3300031344 | Bacteria | 987 |
| 287 | Ga0265316_10450361 | 3300031344 | Bacteria | 923 |
| 288 | Ga0307513_10524425 | 3300031456 | Bacteria | 899 |
| 289 | Ga0307408_100361649 | 3300031548 | Bacteria | 1235 |
| 290 | Ga0265313_10005945 | 3300031595 | Bacteria | 8821 |
| 291 | Ga0265313_10090117 | 3300031595 | Bacteria | 1378 |
| 292 | Ga0265313_10098903 | 3300031595 | Bacteria | 1297 |
| 293 | Ga0316579_10558170 | 3300031691 | Bacteria | 554 |
| 294 | Ga0265314_10098058 | 3300031711 | Bacteria | 1891 |
| 295 | Ga0265314_10166410 | 3300031711 | Bacteria | 1335 |
| 296 | Ga0265314_10369479 | 3300031711 | Bacteria | 784 |
| 297 | Ga0265342_10014539 | 3300031712 | Bacteria | 5222 |
| 298 | Ga0265342_10062162 | 3300031712 | Bacteria | 2198 |
| 299 | Ga0265342_10188212 | 3300031712 | Bacteria | 1127 |
| 300 | Ga0265342_10253414 | 3300031712 | Bacteria | 938 |
| 301 | Ga0307516_10557827 | 3300031730 | Bacteria | 799 |
| 302 | Ga0307405_10371480 | 3300031731 | Bacteria | 1110 |
| 303 | Ga0307405_10501645 | 3300031731 | Bacteria | 973 |
| 304 | Ga0307413_10115514 | 3300031824 | Bacteria | 1806 |
| 305 | Ga0307410_10220482 | 3300031852 | Bacteria | 1459 |
| 306 | Ga0307410_10587364 | 3300031852 | Bacteria | 927 |
| 307 | Ga0307406_10387754 | 3300031901 | Bacteria | 1103 |
| 308 | Ga0307407_10365773 | 3300031903 | Bacteria | 1025 |
| 309 | Ga0307407_10446227 | 3300031903 | Bacteria | 938 |
| 310 | Ga0307412_10734072 | 3300031911 | Bacteria | 851 |
| 311 | Ga0307409_100645660 | 3300031995 | Bacteria | 1051 |
| 312 | Ga0307416_100236117 | 3300032002 | Bacteria | 1767 |
| 313 | Ga0307416_100833847 | 3300032002 | Bacteria | 1019 |
| 314 | Ga0307416_102053286 | 3300032002 | Bacteria | 674 |
| 315 | Ga0307415_100461838 | 3300032126 | Bacteria | 1100 |
| 316 | Ga0307415_101648258 | 3300032126 | Bacteria | 617 |
| 317 | Ga0373948_0040224 | 3300034817 | Bacteria | 975 |
| 318 | Ga0373950_0082247 | 3300034818 | Unclassified | 674 |
| 319 | Ga0373934_0079607 | 3300035086 | Bacteria | 1316 |
| 320 | Ga0373940_0222598 | 3300035088 | Bacteria | 627 |
| 321 | Ga0373949_0064245 | 3300035090 | Bacteria | 950 |
| 322 | Ga0373951_0053258 | 3300035091 | Bacteria | 999 |
| 323 | Ga0373952_0066590 | 3300035092 | Bacteria | 892 |
| 324 | Ga0373932_0131481 | 3300035112 | Bacteria | 844 |
| 325 | Ga0373932_0243301 | 3300035112 | Unclassified | 654 |
| 326 | Ga0373936_0173513 | 3300035113 | Bacteria | 943 |
| 327 | Ga0373939_0122294 | 3300035114 | Bacteria | 919 |
| 328 | Ga0373941_0080367 | 3300035115 | Bacteria | 1100 |
| 329 | Ga0373945_0198780 | 3300035116 | Bacteria | 831 |
| 330 | Ga0373956_0267646 | 3300035119 | Bacteria | 813 |
| 331 | Ga0373960_0080931 | 3300035121 | Bacteria | 1022 |
| 332 | Ga0373943_0135377 | 3300035170 | Bacteria | 1322 |
| 333 | Ga0373943_0185957 | 3300035170 | Bacteria | 1144 |
| 334 | Ga0373946_0187963 | 3300035171 | Bacteria | 983 |
| 335 | Ga0373946_0744802 | 3300035171 | Bacteria | 514 |
| 336 | Ga0373942_0073196 | 3300035207 | Bacteria | 1004 |
| 337 | Ga0373961_0074216 | 3300035241 | Bacteria | 1058 |
| 338 | Ga0373962_0041770 | 3300035242 | Bacteria | 1294 |
| 339 | Ga0316574_0208120 | 3300035398 | Bacteria | 1255 |
| 340 | Ga0373931_0168570 | 3300035691 | Bacteria | 1288 |
| 341 | Ga0373935_0299873 | 3300035692 | Bacteria | 1135 |
| 342 | Ga0373935_0558222 | 3300035692 | Bacteria | 835 |
| 343 | Ga0373933_0215060 | 3300035724 | Bacteria | 1232 |
| 344 | Ga0373947_0256137 | 3300035725 | Bacteria | 1158 |
| 345 | Ga0373937_0613824 | 3300036401 | Bacteria | 1032 |
| 346 | Ga0373937_0687320 | 3300036401 | Bacteria | 969 |
| 347 | Ga0373937_1046627 | 3300036401 | Bacteria | 765 |
| 348 | Ga0316582_1081620 | 3300036647 | Bacteria | 547 |
| 349 | Ga0373925_0184893 | 3300037068 | Bacteria | 1651 |
| 350 | Ga0373925_1371559 | 3300037068 | Bacteria | 579 |
| 351 | Ga0395898_1209316 | 3300037466 | Bacteria | 687 |
| 352 | Ga0395905_0327147 | 3300037471 | Bacteria | 1423 |
| 353 | Ga0395905_0443817 | 3300037471 | Bacteria | 1195 |
| 354 | Ga0395905_0459040 | 3300037471 | Bacteria | 1172 |
| 355 | Ga0436364_0176825 | 3300037853 | Bacteria | 1484 |
| 356 | Ga0436364_0230566 | 3300037853 | Bacteria | 3539 |
| 357 | Ga0436364_0751518 | 3300037853 | Bacteria | 1337 |
| 358 | Ga0436364_1290285 | 3300037853 | Bacteria | 1187 |
| 359 | Ga0436365_0304394 | 3300039437 | Bacteria | 1198 |
| 360 | Ga0436365_0889978 | 3300039437 | Bacteria | 1324 |
| 361 | Ga0436365_0916403 | 3300039437 | Bacteria | 1244 |
| 362 | Ga0436365_0953019 | 3300039437 | Bacteria | 1244 |
| 363 | Ga0436365_1038530 | 3300039437 | Bacteria | 1160 |
| 364 | Ga0436365_1543867 | 3300039437 | Bacteria | 1120 |
| 365 | Ga0436365_1796423 | 3300039437 | Bacteria | 1667 |
| 366 | Ga0436360_0084886 | 3300039438 | Bacteria | 2542 |
| 367 | Ga0436360_0190664 | 3300039438 | Bacteria | 1533 |
| 368 | Ga0436360_0300747 | 3300039438 | Bacteria | 627 |
| 369 | Ga0436360_0380265 | 3300039438 | Bacteria | 1350 |
| 370 | Ga0436360_0954986 | 3300039438 | Bacteria | 1332 |
| 371 | Ga0436360_1090570 | 3300039438 | Bacteria | 548 |
| 372 | Ga0436360_1281300 | 3300039438 | Bacteria | 885 |
| 373 | Ga0436361_0144288 | 3300039447 | Bacteria | 4080 |
| 374 | Ga0436361_0224788 | 3300039447 | Bacteria | 1829 |
| 375 | Ga0436361_0323478 | 3300039447 | Bacteria | 793 |
| 376 | Ga0436361_0369523 | 3300039447 | Bacteria | 1092 |
| 377 | Ga0436361_0598041 | 3300039447 | Bacteria | 1167 |
| 378 | Ga0436361_0658187 | 3300039447 | Bacteria | 2014 |
| 379 | Ga0436361_1064448 | 3300039447 | Bacteria | 11122 |
| 380 | Ga0436363_0191444 | 3300039450 | Bacteria | 1044 |
| 381 | Ga0436363_1078731 | 3300039450 | Bacteria | 1763 |
| 382 | Ga0436363_1141193 | 3300039450 | Bacteria | 1136 |
| 383 | Ga0436362_0300804 | 3300039453 | Bacteria | 1832 |
| 384 | Ga0436362_1204039 | 3300039453 | Bacteria | 798 |
| 385 | Ga0439466_0055649 | 3300041411 | Bacteria | 1285 |
| 386 | Ga0439465_0190882 | 3300041413 | Bacteria | 744 |
| 387 | Ga0439465_0199016 | 3300041413 | Bacteria | 729 |
| 388 | Ga0439465_0356782 | 3300041413 | Bacteria | 553 |
| 389 | Ga0451793_1106380 | 3300041452 | Bacteria | 754 |
| 390 | Ga0451797_0907562 | 3300041453 | Bacteria | 696 |
| 391 | Ga0451798_1072412 | 3300041458 | Bacteria | 1061 |
| 392 | Ga0451802_0228420 | 3300041460 | Bacteria | 624 |
| 393 | Ga0451802_2096503 | 3300041460 | Bacteria | 1140 |
| 394 | Ga0451807_1047851 | 3300041486 | Bacteria | 773 |
| 395 | Ga0451837_1271536 | 3300041494 | Bacteria | 765 |
| 396 | Ga0451837_1861520 | 3300041494 | Bacteria | 1016 |
| 397 | Ga0451851_0809618 | 3300041507 | Bacteria | 970 |
| 398 | Ga0451855_1985776 | 3300041511 | Bacteria | 941 |
| 399 | Ga0451853_1763636 | 3300041512 | Bacteria | 706 |
| 400 | Ga0439448_0067681 | 3300042005 | Bacteria | 1186 |
| 401 | Ga0439450_008225 | 3300042008 | Bacteria | 1940 |
| 402 | Ga0439454_003986 | 3300042011 | Bacteria | 1675 |
| 403 | Ga0439457_005512 | 3300042014 | Bacteria | 3179 |
| 404 | Ga0439463_099299 | 3300042016 | Bacteria | 750 |
| 405 | Ga0450920_029371 | 3300042122 | Bacteria | 1079 |
| 406 | Ga0450923_078411 | 3300042125 | Bacteria | 740 |
| 407 | Ga0450923_095907 | 3300042125 | Bacteria | 680 |
| 408 | Ga0450923_161470 | 3300042125 | Bacteria | 546 |
| 409 | Ga0439434_0184347 | 3300042435 | Bacteria | 700 |
| 410 | Ga0439459_0039346 | 3300042438 | Bacteria | 998 |
| 411 | Ga0439460_0045690 | 3300042461 | Bacteria | 1299 |
| 412 | Ga0439440_0079393 | 3300042993 | Bacteria | 865 |
| 413 | Ga0466966_0188773 | 3300044684 | Bacteria | 1249 |
| 414 | Ga0466971_0344004 | 3300044719 | Bacteria | 721 |
| 415 | Ga0466968_0345083 | 3300044735 | Bacteria | 722 |
| 416 | Ga0466957_0180413 | 3300044842 | Bacteria | 1379 |
| 417 | Ga0451576_1414963 | 3300045051 | Bacteria | 723 |
| 418 | Ga0466958_0326937 | 3300045836 | Bacteria | 986 |
| 419 | Ga0466967_0610486 | 3300045976 | Bacteria | 1077 |
| 420 | Ga0495592_0440415 | 3300046454 | Bacteria | 818 |
| 421 | Ga0495592_0719637 | 3300046454 | Bacteria | 599 |
| 422 | Ga0495629_0269178 | 3300046459 | Bacteria | 1170 |
| 423 | Ga0495629_0773421 | 3300046459 | Bacteria | 634 |
| 424 | Ga0495638_0156254 | 3300046460 | Bacteria | 1319 |
| 425 | Ga0495651_0406577 | 3300046462 | Bacteria | 887 |
| 426 | Ga0495580_0523499 | 3300046472 | Bacteria | 790 |
| 427 | Ga0495639_0237519 | 3300046475 | Bacteria | 899 |
| 428 | Ga0495662_0200179 | 3300046476 | Bacteria | 984 |
| 429 | Ga0495585_0249918 | 3300046492 | Bacteria | 885 |
| 430 | Ga0495594_0313736 | 3300046499 | Bacteria | 893 |
| 431 | Ga0495594_0637008 | 3300046499 | Bacteria | 604 |
| 432 | Ga0495596_0195999 | 3300046500 | Bacteria | 785 |
| 433 | Ga0495607_0385885 | 3300046501 | Bacteria | 640 |
| 434 | Ga0495583_0114819 | 3300046506 | Bacteria | 1138 |
| 435 | Ga0495606_0157046 | 3300046507 | Bacteria | 1330 |
| 436 | Ga0495606_0596240 | 3300046507 | Bacteria | 543 |
| 437 | Ga0495608_0286731 | 3300046511 | Bacteria | 1021 |
| 438 | Ga0495608_0684532 | 3300046511 | Bacteria | 611 |
| 439 | Ga0495610_0037830 | 3300046512 | Bacteria | 2452 |
| 440 | Ga0495618_0615618 | 3300046514 | Bacteria | 645 |
| 441 | Ga0495620_0028952 | 3300046515 | Bacteria | 2569 |
| 442 | Ga0495628_0295619 | 3300046516 | Bacteria | 1200 |
| 443 | Ga0495628_0494126 | 3300046516 | Bacteria | 884 |
| 444 | Ga0495628_0554331 | 3300046516 | Bacteria | 825 |
| 445 | Ga0495628_0798800 | 3300046516 | Bacteria | 660 |
| 446 | Ga0495630_0076143 | 3300046517 | Bacteria | 2528 |
| 447 | Ga0495631_0142549 | 3300046518 | Bacteria | 1029 |
| 448 | Ga0495637_0097273 | 3300046520 | Bacteria | 1154 |
| 449 | Ga0495643_0057718 | 3300046522 | Bacteria | 2068 |
| 450 | Ga0495648_0118632 | 3300046524 | Bacteria | 1426 |
| 451 | Ga0495648_0195750 | 3300046524 | Bacteria | 1016 |
| 452 | Ga0495642_0406611 | 3300046528 | Bacteria | 600 |
| 453 | Ga0495652_0454922 | 3300046529 | Bacteria | 895 |
| 454 | Ga0495654_0156105 | 3300046530 | Bacteria | 1005 |
| 455 | Ga0495654_0300164 | 3300046530 | Bacteria | 656 |
| 456 | Ga0495665_0199638 | 3300046531 | Bacteria | 1037 |
| 457 | Ga0495640_0518561 | 3300046533 | Bacteria | 724 |
| 458 | Ga0495640_0637923 | 3300046533 | Bacteria | 641 |
| 459 | Ga0495586_0175465 | 3300046535 | Bacteria | 1211 |
| 460 | Ga0495587_0313429 | 3300046536 | Bacteria | 876 |
| 461 | Ga0495598_0055244 | 3300046537 | Bacteria | 1208 |
| 462 | Ga0495609_0057679 | 3300046538 | Bacteria | 1718 |
| 463 | Ga0495621_0033352 | 3300046539 | Bacteria | 1774 |
| 464 | Ga0495621_0173680 | 3300046539 | Bacteria | 857 |
| 465 | Ga0495597_0106827 | 3300046542 | Bacteria | 1176 |
| 466 | Ga0495645_0364316 | 3300046543 | Bacteria | 928 |
| 467 | Ga0495622_0013897 | 3300046557 | Bacteria | 3735 |
| 468 | Ga0495622_0196348 | 3300046557 | Bacteria | 900 |
| 469 | Ga0495633_0172675 | 3300046558 | Bacteria | 996 |
| 470 | Ga0495667_0542919 | 3300046559 | Bacteria | 726 |
| 471 | Ga0495656_0198473 | 3300046615 | Bacteria | 994 |
| 472 | Ga0495656_0212596 | 3300046615 | Bacteria | 964 |
| 473 | Ga0495611_0109267 | 3300046648 | Bacteria | 1287 |
| 474 | Ga0495611_0124710 | 3300046648 | Bacteria | 1201 |
| 475 | Ga0495625_0233537 | 3300046660 | Bacteria | 1200 |
| 476 | Ga0495635_0364266 | 3300046663 | Bacteria | 963 |
| 477 | Ga0495635_0564359 | 3300046663 | Bacteria | 745 |
| 478 | Ga0495661_0260921 | 3300046665 | Bacteria | 880 |
| 479 | Ga0495588_0161978 | 3300046674 | Bacteria | 1183 |
| 480 | Ga0495657_0285616 | 3300046675 | Bacteria | 986 |
| 481 | Ga0495599_0794622 | 3300046678 | Bacteria | 541 |
| 482 | Ga0495623_0300527 | 3300046679 | Bacteria | 887 |
| 483 | Ga0495646_0326846 | 3300046680 | Bacteria | 807 |
| 484 | Ga0495658_0441121 | 3300046683 | Bacteria | 831 |
| 485 | Ga0495669_0000800 | 3300046684 | Bacteria | 13438 |
| 486 | Ga0495669_0181733 | 3300046684 | Bacteria | 1003 |
| 487 | Ga0495613_0207949 | 3300046689 | Bacteria | 1377 |
| 488 | Ga0495613_0292549 | 3300046689 | Bacteria | 1129 |
| 489 | Ga0495613_0865850 | 3300046689 | Bacteria | 586 |
| 490 | Ga0495624_0273916 | 3300046690 | Bacteria | 1019 |
| 491 | Ga0495670_0094366 | 3300046691 | Bacteria | 1534 |
| 492 | Ga0495670_0168579 | 3300046691 | Bacteria | 1152 |
| 493 | Ga0495670_0233119 | 3300046691 | Bacteria | 979 |
| 494 | Ga0495589_0022026 | 3300046794 | Bacteria | 3255 |
| 495 | Ga0495600_0098708 | 3300046809 | Bacteria | 1904 |
| 496 | Ga0495581_0186355 | 3300047315 | Bacteria | 1214 |
| 497 | Ga0495581_0299695 | 3300047315 | Bacteria | 939 |
| 498 | Ga0495581_0581964 | 3300047315 | Bacteria | 649 |
| 499 | Ga0495674_0658061 | 3300047319 | Bacteria | 825 |
| 500 | Ga0495672_0193675 | 3300047320 | Bacteria | 1020 |
| 501 | Ga0495676_0166956 | 3300047321 | Bacteria | 1552 |
| 502 | Ga0495680_0347372 | 3300047322 | Bacteria | 1033 |
| 503 | Ga0495680_0800716 | 3300047322 | Bacteria | 615 |
| 504 | Ga0495685_101958 | 3300047447 | Bacteria | 947 |
| 505 | Ga0495673_0281080 | 3300047469 | Bacteria | 601 |
| 506 | Ga0495684_0463122 | 3300047471 | Bacteria | 878 |
| 507 | Ga0495684_0977560 | 3300047471 | Bacteria | 539 |
| 508 | Ga0495686_0115490 | 3300047472 | Bacteria | 1605 |
| 509 | Ga0495686_0212290 | 3300047472 | Bacteria | 1105 |
| 510 | Ga0495686_0352657 | 3300047472 | Bacteria | 799 |
| 511 | Ga0495593_0086707 | 3300047673 | Bacteria | 1614 |
| 512 | Ga0495602_0211523 | 3300048088 | Bacteria | 1471 |
| 513 | Ga0495602_0510171 | 3300048088 | Bacteria | 839 |
| 514 | Ga0495602_0730835 | 3300048088 | Bacteria | 669 |
| 515 | Ga0495615_0122441 | 3300048090 | Bacteria | 753 |
| 516 | Ga0496101_0329113 | 3300048904 | Bacteria | 1199 |
| 517 | Ga0496101_0564936 | 3300048904 | Bacteria | 899 |
| 518 | Ga0496103_0648828 | 3300048906 | Bacteria | 671 |
| 519 | Ga0496104_0079097 | 3300048907 | Bacteria | 3134 |
| 520 | Ga0496104_0627271 | 3300048907 | Bacteria | 984 |
| 521 | Ga0496105_0219128 | 3300048908 | Bacteria | 1549 |
| 522 | Ga0496106_1146568 | 3300048909 | Bacteria | 608 |
| 523 | Ga0496107_0364491 | 3300048910 | Bacteria | 1075 |
| 524 | Ga0496107_0462040 | 3300048910 | Bacteria | 942 |
| 525 | Ga0496108_0535968 | 3300048911 | Bacteria | 1022 |
| 526 | Ga0496108_1082232 | 3300048911 | Bacteria | 682 |
| 527 | Ga0496108_1233434 | 3300048911 | Bacteria | 631 |
| 528 | Ga0496109_0891407 | 3300048912 | Bacteria | 827 |
| 529 | Ga0496109_1366763 | 3300048912 | Bacteria | 644 |
| 530 | Ga0496110_0495233 | 3300048913 | Bacteria | 1113 |
| 531 | Ga0496110_0910663 | 3300048913 | Bacteria | 785 |
| 532 | Ga0496111_0123786 | 3300048914 | Bacteria | 1911 |
| 533 | Ga0496111_0199965 | 3300048914 | Bacteria | 1486 |
| 534 | Ga0496113_0190978 | 3300048916 | Bacteria | 1626 |
| 535 | Ga0496114_0499232 | 3300048917 | Bacteria | 1076 |
| 536 | Ga0496115_0645202 | 3300048918 | Bacteria | 837 |
| 537 | Ga0496126_0056847 | 3300048929 | Bacteria | 3535 |
| 538 | Ga0495682_0101372 | 3300049460 | Bacteria | 1032 |
| 539 | Ga0501291_056109 | 3300049514 | Bacteria | 729 |
| 540 | Ga0501032_0043367 | 3300049569 | Bacteria | 3047 |
| 541 | Ga0501034_0300621 | 3300049571 | Bacteria | 1541 |
| 542 | Ga0501034_0506316 | 3300049571 | Bacteria | 1121 |
| 543 | Ga0501036_1434049 | 3300049572 | Bacteria | 559 |
| 544 | Ga0501039_0085948 | 3300049575 | Bacteria | 2450 |
| 545 | Ga0501039_1127796 | 3300049575 | Bacteria | 607 |
| 546 | Ga0501039_1500613 | 3300049575 | Bacteria | 518 |
| 547 | Ga0501041_0698244 | 3300049577 | Bacteria | 649 |
| 548 | Ga0501042_0346416 | 3300049578 | Bacteria | 1074 |
| 549 | Ga0501042_0368060 | 3300049578 | Bacteria | 1040 |
| 550 | Ga0501046_0087055 | 3300049580 | Bacteria | 2408 |
| 551 | Ga0501046_0163676 | 3300049580 | Bacteria | 1672 |
| 552 | Ga0501047_0464319 | 3300049581 | Bacteria | 1094 |
| 553 | Ga0501047_0602153 | 3300049581 | Bacteria | 920 |
| 554 | Ga0501047_0893176 | 3300049581 | Bacteria | 702 |
| 555 | Ga0501048_0421845 | 3300049582 | Bacteria | 954 |
| 556 | Ga0501069_0636638 | 3300049585 | Bacteria | 641 |
| 557 | Ga0501072_0188075 | 3300049588 | Bacteria | 1647 |
| 558 | Ga0501073_0002968 | 3300049589 | Bacteria | 12720 |
| 559 | Ga0501073_0336866 | 3300049589 | Bacteria | 1041 |
| 560 | Ga0501075_0172089 | 3300049591 | Bacteria | 1653 |
| 561 | Ga0501076_0139064 | 3300049592 | Bacteria | 1972 |
| 562 | Ga0501223_003421 | 3300049663 | Bacteria | 3461 |
| 563 | Ga0501235_050712 | 3300049669 | Bacteria | 961 |
| 564 | Ga0501235_176894 | 3300049669 | Bacteria | 567 |
| 565 | Ga0501081_1414408 | 3300049743 | Bacteria | 528 |
| 566 | Ga0501083_0361065 | 3300049744 | Bacteria | 944 |
| 567 | Ga0501035_0222464 | 3300049822 | Bacteria | 1611 |
| 568 | Ga0501035_0251764 | 3300049822 | Bacteria | 1500 |
| 569 | Ga0501035_0533880 | 3300049822 | Bacteria | 962 |
| 570 | Ga0501044_0533368 | 3300049823 | Bacteria | 1072 |
| 571 | Ga0501044_0598238 | 3300049823 | Bacteria | 996 |
| 572 | Ga0501044_1145109 | 3300049823 | Bacteria | 646 |
| 573 | Ga0501045_1004770 | 3300049824 | Bacteria | 612 |
| 574 | nmdc:mga0yw44_207093_c1 | 3300050492 | Bacteria | 1297 |
| 575 | nmdc:mga0yw44_404114_c1 | 3300050492 | Bacteria | 924 |
| 576 | nmdc:mga04h51_294592_c1 | 3300050495 | Bacteria | 660 |
| 577 | nmdc:mga06r32_353164_c1 | 3300050510 | Bacteria | 1454 |
| 578 | nmdc:mga08y16_93425_c1 | 3300050511 | Bacteria | 3134 |
| 579 | nmdc:mga08y16_990725_c1 | 3300050511 | Bacteria | 821 |
| 580 | Ga0495601_0084814 | 3300053077 | Bacteria | 2035 |
| 581 | Ga0495601_0289352 | 3300053077 | Bacteria | 1068 |
| 582 | Ga0495601_0290115 | 3300053077 | Bacteria | 1066 |
| 583 | Ga0495612_0091456 | 3300053078 | Bacteria | 1288 |
| 584 | Ga0495655_0009621 | 3300053083 | Bacteria | 1881 |
| 585 | Ga0495595_0129533 | 3300053084 | Bacteria | 1232 |
| 586 | Ga0495619_0422551 | 3300053085 | Bacteria | 919 |
| 587 | Ga0495619_0468602 | 3300053085 | Bacteria | 867 |
| 588 | Ga0500578_0097481 | 3300053086 | Bacteria | 1863 |
| 589 | Ga0500643_042125 | 3300053087 | Bacteria | 1338 |
| 590 | Ga0500644_0495263 | 3300053088 | Bacteria | 537 |
| 591 | Ga0500647_0170669 | 3300053091 | Bacteria | 1004 |
| 592 | Ga0500583_0157084 | 3300053092 | Bacteria | 1132 |
| 593 | Ga0500651_0247053 | 3300053093 | Bacteria | 1038 |
| 594 | Ga0500566_0200894 | 3300053094 | Bacteria | 1006 |
| 595 | Ga0500641_0141420 | 3300053096 | Bacteria | 1040 |
| 596 | Ga0500555_067353 | 3300053103 | Bacteria | 951 |
| 597 | Ga0500556_0000097 | 3300053104 | Bacteria | 81329 |
| 598 | Ga0500556_0015300 | 3300053104 | Bacteria | 2363 |
| 599 | Ga0500569_004219 | 3300053109 | Bacteria | 3008 |
| 600 | Ga0500572_061630 | 3300053111 | Bacteria | 1141 |
| 601 | Ga0500591_121315 | 3300053115 | Bacteria | 1074 |
| 602 | Ga0500592_006928 | 3300053116 | Bacteria | 1803 |
| 603 | Ga0500593_132824 | 3300053117 | Bacteria | 991 |
| 604 | Ga0500595_014889 | 3300053119 | Bacteria | 2938 |
| 605 | Ga0500597_168324 | 3300053120 | Bacteria | 934 |
| 606 | Ga0500607_172486 | 3300053121 | Bacteria | 971 |
| 607 | Ga0500614_017625 | 3300053123 | Bacteria | 1616 |
| 608 | Ga0500626_207826 | 3300053128 | Bacteria | 765 |
| 609 | Ga0500642_0050308 | 3300053130 | Bacteria | 1836 |
| 610 | Ga0500652_089532 | 3300053131 | Bacteria | 1285 |
| 611 | Ga0500655_013484 | 3300053133 | Bacteria | 1492 |
| 612 | Ga0500658_0192750 | 3300053134 | Bacteria | 930 |
| 613 | Ga0500559_0021865 | 3300053136 | Bacteria | 2713 |
| 614 | Ga0500559_0027456 | 3300053136 | Bacteria | 2429 |
| 615 | Ga0500564_120361 | 3300053138 | Bacteria | 1144 |
| 616 | Ga0500577_0065047 | 3300053142 | Bacteria | 1414 |
| 617 | Ga0500590_180118 | 3300053148 | Bacteria | 918 |
| 618 | Ga0500616_0157975 | 3300053153 | Bacteria | 1042 |
| 619 | Ga0500619_031309 | 3300053154 | Bacteria | 1622 |
| 620 | Ga0500620_048707 | 3300053155 | Bacteria | 1414 |
| 621 | Ga0500638_142818 | 3300053162 | Bacteria | 1073 |
| 622 | Ga0500636_0519610 | 3300053177 | Bacteria | 521 |
| 623 | Ga0500637_0060481 | 3300053178 | Bacteria | 2169 |
| 624 | Ga0500570_131761 | 3300053724 | Bacteria | 947 |
| 625 | Ga0500576_086011 | 3300053725 | Bacteria | 1316 |
| 626 | Ga0500657_119870 | 3300053728 | Bacteria | 1044 |
| 627 | Ga0500625_040350 | 3300053729 | Bacteria | 2197 |
| 628 | Ga0500645_055611 | 3300053730 | Bacteria | 1149 |
| 629 | Ga0500552_013386 | 3300053733 | Bacteria | 1064 |
| 630 | Ga0500596_002487 | 3300053735 | Bacteria | 3634 |
| 631 | Ga0500661_000027 | 3300055283 | Bacteria | 21947 |
| 632 | Ga0500661_029515 | 3300055283 | Bacteria | 967 |
| 633 | Ga0466962_0118993 | 3300061719 | Bacteria | 1274 |
| 634 | Ga0466962_0338855 | 3300061719 | Bacteria | 748 |
| 635 | Ga0530510_0977703 | 3300061734 | Bacteria | 647 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0002968 | Ga0501073_0002968_2961_3458 | 113 |
| 2 | 3300048910 | Ga0496107_0462040 | Ga0496107_0462040_436_828 | 124 |
| 3 | 3300005843 | Ga0068860_100938268 | Ga0068860_1009382682 | 125 |
| 4 | 3300026067 | Ga0207678_11292257 | Ga0207678_112922572 | 125 |
| 5 | 3300035112 | Ga0373932_0131481 | Ga0373932_0131481_314_742 | 125 |
| 6 | 3300039438 | Ga0436360_0380265 | Ga0436360_0380265_462_890 | 125 |
| 7 | 3300053177 | Ga0500636_0519610 | Ga0500636_0519610_123_506 | 125 |
| 8 | 3300005459 | Ga0068867_100577234 | Ga0068867_1005772341 | 126 |
| 9 | 3300005718 | Ga0068866_10299707 | Ga0068866_102997072 | 126 |
| 10 | 3300025907 | Ga0207645_10073232 | Ga0207645_100732322 | 126 |
| 11 | 3300025915 | Ga0207693_11317636 | Ga0207693_113176361 | 126 |
| 12 | 3300046648 | Ga0495611_0124710 | Ga0495611_0124710_514_900 | 126 |
| 13 | 3300021361 | Ga0213872_10030387 | Ga0213872_100303873 | 133 |
| 14 | 3300031711 | Ga0265314_10098058 | Ga0265314_100980584 | 133 |
| 15 | 3300039447 | Ga0436361_1064448 | Ga0436361_1064448_10369_10776 | 133 |
| 16 | 3300046517 | Ga0495630_0076143 | Ga0495630_0076143_329_751 | 134 |
| 17 | 3300005367 | Ga0070667_100617351 | Ga0070667_1006173512 | 135 |
| 18 | 3300005536 | Ga0070697_100540802 | Ga0070697_1005408023 | 135 |
| 19 | 3300026121 | Ga0207683_11376328 | Ga0207683_113763281 | 137 |
| 20 | 3300013306 | Ga0163162_10419434 | Ga0163162_104194343 | 138 |
| 21 | 3300031691 | Ga0316579_10558170 | Ga0316579_105581702 | 138 |
| 22 | 3300048913 | Ga0496110_0910663 | Ga0496110_0910663_330_746 | 138 |
| 23 | 3300048914 | Ga0496111_0123786 | Ga0496111_0123786_433_849 | 138 |
| 24 | 3300049585 | Ga0501069_0636638 | Ga0501069_0636638_207_623 | 138 |
| 25 | 3300003320 | rootH2_10319136 | rootH2_103191363 | 140 |
| 26 | 3300003911 | JGI25405J52794_10148316 | JGI25405J52794_101483161 | 140 |
| 27 | 3300005330 | Ga0070690_100395001 | Ga0070690_1003950011 | 140 |
| 28 | 3300005331 | Ga0070670_101272407 | Ga0070670_1012724071 | 140 |
| 29 | 3300005334 | Ga0068869_100170591 | Ga0068869_1001705912 | 140 |
| 30 | 3300005335 | Ga0070666_10134811 | Ga0070666_101348111 | 140 |
| 31 | 3300005335 | Ga0070666_10203354 | Ga0070666_102033542 | 140 |
| 32 | 3300005335 | Ga0070666_10468884 | Ga0070666_104688842 | 140 |
| 33 | 3300005338 | Ga0068868_100232045 | Ga0068868_1002320453 | 140 |
| 34 | 3300005338 | Ga0068868_100625599 | Ga0068868_1006255992 | 140 |
| 35 | 3300005339 | Ga0070660_100544555 | Ga0070660_1005445552 | 140 |
| 36 | 3300005340 | Ga0070689_100247915 | Ga0070689_1002479152 | 140 |
| 37 | 3300005340 | Ga0070689_100445660 | Ga0070689_1004456602 | 140 |
| 38 | 3300005341 | Ga0070691_10578150 | Ga0070691_105781501 | 140 |
| 39 | 3300005343 | Ga0070687_100187038 | Ga0070687_1001870382 | 140 |
| 40 | 3300005343 | Ga0070687_100264273 | Ga0070687_1002642732 | 140 |
| 41 | 3300005344 | Ga0070661_100159912 | Ga0070661_1001599122 | 140 |
| 42 | 3300005347 | Ga0070668_100404120 | Ga0070668_1004041202 | 140 |
| 43 | 3300005353 | Ga0070669_100686740 | Ga0070669_1006867402 | 140 |
| 44 | 3300005354 | Ga0070675_100594931 | Ga0070675_1005949312 | 140 |
| 45 | 3300005354 | Ga0070675_100708916 | Ga0070675_1007089161 | 140 |
| 46 | 3300005355 | Ga0070671_100389336 | Ga0070671_1003893362 | 140 |
| 47 | 3300005356 | Ga0070674_100314372 | Ga0070674_1003143723 | 140 |
| 48 | 3300005364 | Ga0070673_100282682 | Ga0070673_1002826822 | 140 |
| 49 | 3300005365 | Ga0070688_100206560 | Ga0070688_1002065601 | 140 |
| 50 | 3300005366 | Ga0070659_100423121 | Ga0070659_1004231212 | 140 |
| 51 | 3300005367 | Ga0070667_100893263 | Ga0070667_1008932631 | 140 |
| 52 | 3300005434 | Ga0070709_10331006 | Ga0070709_103310062 | 140 |
| 53 | 3300005435 | Ga0070714_100123094 | Ga0070714_1001230942 | 140 |
| 54 | 3300005440 | Ga0070705_100238843 | Ga0070705_1002388431 | 140 |
| 55 | 3300005441 | Ga0070700_100232014 | Ga0070700_1002320142 | 140 |
| 56 | 3300005441 | Ga0070700_101354988 | Ga0070700_1013549881 | 140 |
| 57 | 3300005444 | Ga0070694_100393886 | Ga0070694_1003938862 | 140 |
| 58 | 3300005455 | Ga0070663_100552616 | Ga0070663_1005526162 | 140 |
| 59 | 3300005456 | Ga0070678_100434545 | Ga0070678_1004345452 | 140 |
| 60 | 3300005456 | Ga0070678_100456859 | Ga0070678_1004568592 | 140 |
| 61 | 3300005457 | Ga0070662_100597875 | Ga0070662_1005978752 | 140 |
| 62 | 3300005457 | Ga0070662_100689140 | Ga0070662_1006891402 | 140 |
| 63 | 3300005459 | Ga0068867_100189581 | Ga0068867_1001895812 | 140 |
| 64 | 3300005459 | Ga0068867_100350586 | Ga0068867_1003505862 | 140 |
| 65 | 3300005466 | Ga0070685_10162681 | Ga0070685_101626812 | 140 |
| 66 | 3300005467 | Ga0070706_100489263 | Ga0070706_1004892632 | 140 |
| 67 | 3300005468 | Ga0070707_101616538 | Ga0070707_1016165381 | 140 |
| 68 | 3300005471 | Ga0070698_100313401 | Ga0070698_1003134013 | 140 |
| 69 | 3300005471 | Ga0070698_100643985 | Ga0070698_1006439852 | 140 |
| 70 | 3300005530 | Ga0070679_100782721 | Ga0070679_1007827211 | 140 |
| 71 | 3300005536 | Ga0070697_100205007 | Ga0070697_1002050074 | 140 |
| 72 | 3300005539 | Ga0068853_100625321 | Ga0068853_1006253211 | 140 |
| 73 | 3300005539 | Ga0068853_100797578 | Ga0068853_1007975782 | 140 |
| 74 | 3300005539 | Ga0068853_100855751 | Ga0068853_1008557511 | 140 |
| 75 | 3300005543 | Ga0070672_100397290 | Ga0070672_1003972902 | 140 |
| 76 | 3300005543 | Ga0070672_100411862 | Ga0070672_1004118622 | 140 |
| 77 | 3300005543 | Ga0070672_100707969 | Ga0070672_1007079692 | 140 |
| 78 | 3300005545 | Ga0070695_100688708 | Ga0070695_1006887081 | 140 |
| 79 | 3300005546 | Ga0070696_100471369 | Ga0070696_1004713692 | 140 |
| 80 | 3300005548 | Ga0070665_100435626 | Ga0070665_1004356262 | 140 |
| 81 | 3300005548 | Ga0070665_101902417 | Ga0070665_1019024171 | 140 |
| 82 | 3300005549 | Ga0070704_100361859 | Ga0070704_1003618592 | 140 |
| 83 | 3300005563 | Ga0068855_100793789 | Ga0068855_1007937892 | 140 |
| 84 | 3300005564 | Ga0070664_100225810 | Ga0070664_1002258105 | 140 |
| 85 | 3300005578 | Ga0068854_100320485 | Ga0068854_1003204853 | 140 |
| 86 | 3300005614 | Ga0068856_101150740 | Ga0068856_1011507401 | 140 |
| 87 | 3300005615 | Ga0070702_100252822 | Ga0070702_1002528222 | 140 |
| 88 | 3300005615 | Ga0070702_100341911 | Ga0070702_1003419112 | 140 |
| 89 | 3300005615 | Ga0070702_100406835 | Ga0070702_1004068352 | 140 |
| 90 | 3300005616 | Ga0068852_100505776 | Ga0068852_1005057762 | 140 |
| 91 | 3300005616 | Ga0068852_100616248 | Ga0068852_1006162481 | 140 |
| 92 | 3300005616 | Ga0068852_100731478 | Ga0068852_1007314781 | 140 |
| 93 | 3300005616 | Ga0068852_100808224 | Ga0068852_1008082241 | 140 |
| 94 | 3300005617 | Ga0068859_100244323 | Ga0068859_1002443232 | 140 |
| 95 | 3300005618 | Ga0068864_100572369 | Ga0068864_1005723692 | 140 |
| 96 | 3300005618 | Ga0068864_100856703 | Ga0068864_1008567031 | 140 |
| 97 | 3300005718 | Ga0068866_10186635 | Ga0068866_101866352 | 140 |
| 98 | 3300005842 | Ga0068858_100346013 | Ga0068858_1003460133 | 140 |
| 99 | 3300005843 | Ga0068860_100560266 | Ga0068860_1005602663 | 140 |
| 100 | 3300005843 | Ga0068860_100872582 | Ga0068860_1008725822 | 140 |
| 101 | 3300005844 | Ga0068862_100312862 | Ga0068862_1003128622 | 140 |
| 102 | 3300005844 | Ga0068862_101729899 | Ga0068862_1017298991 | 140 |
| 103 | 3300005937 | Ga0081455_10083951 | Ga0081455_100839513 | 140 |
| 104 | 3300005937 | Ga0081455_10304431 | Ga0081455_103044312 | 140 |
| 105 | 3300005981 | Ga0081538_10030964 | Ga0081538_100309642 | 140 |
| 106 | 3300005985 | Ga0081539_10164302 | Ga0081539_101643022 | 140 |
| 107 | 3300005985 | Ga0081539_10169805 | Ga0081539_101698053 | 140 |
| 108 | 3300005985 | Ga0081539_10385167 | Ga0081539_103851671 | 140 |
| 109 | 3300006028 | Ga0070717_10369753 | Ga0070717_103697532 | 140 |
| 110 | 3300006028 | Ga0070717_10397643 | Ga0070717_103976432 | 140 |
| 111 | 3300006038 | Ga0075365_10338300 | Ga0075365_103383001 | 140 |
| 112 | 3300006042 | Ga0075368_10069558 | Ga0075368_100695582 | 140 |
| 113 | 3300006048 | Ga0075363_100167654 | Ga0075363_1001676541 | 140 |
| 114 | 3300006058 | Ga0075432_10385126 | Ga0075432_103851262 | 140 |
| 115 | 3300006163 | Ga0070715_10243337 | Ga0070715_102433372 | 140 |
| 116 | 3300006173 | Ga0070716_100214425 | Ga0070716_1002144253 | 140 |
| 117 | 3300006178 | Ga0075367_10095347 | Ga0075367_100953474 | 140 |
| 118 | 3300006237 | Ga0097621_100432146 | Ga0097621_1004321463 | 140 |
| 119 | 3300006358 | Ga0068871_100355421 | Ga0068871_1003554213 | 140 |
| 120 | 3300006846 | Ga0075430_100144437 | Ga0075430_1001444374 | 140 |
| 121 | 3300006881 | Ga0068865_100370892 | Ga0068865_1003708922 | 140 |
| 122 | 3300006931 | Ga0097620_100244335 | Ga0097620_1002443352 | 140 |
| 123 | 3300009093 | Ga0105240_10390814 | Ga0105240_103908142 | 140 |
| 124 | 3300009093 | Ga0105240_10791253 | Ga0105240_107912531 | 140 |
| 125 | 3300009094 | Ga0111539_10570907 | Ga0111539_105709073 | 140 |
| 126 | 3300009094 | Ga0111539_11064239 | Ga0111539_110642391 | 140 |
| 127 | 3300009094 | Ga0111539_11153486 | Ga0111539_111534862 | 140 |
| 128 | 3300009098 | Ga0105245_10429144 | Ga0105245_104291441 | 140 |
| 129 | 3300009101 | Ga0105247_11592676 | Ga0105247_115926761 | 140 |
| 130 | 3300009148 | Ga0105243_10093774 | Ga0105243_100937741 | 140 |
| 131 | 3300009148 | Ga0105243_10606818 | Ga0105243_106068182 | 140 |
| 132 | 3300009148 | Ga0105243_10658401 | Ga0105243_106584011 | 140 |
| 133 | 3300009148 | Ga0105243_10904623 | Ga0105243_109046231 | 140 |
| 134 | 3300009174 | Ga0105241_10478520 | Ga0105241_104785201 | 140 |
| 135 | 3300009174 | Ga0105241_10516931 | Ga0105241_105169312 | 140 |
| 136 | 3300009176 | Ga0105242_10246042 | Ga0105242_102460422 | 140 |
| 137 | 3300009176 | Ga0105242_10554012 | Ga0105242_105540123 | 140 |
| 138 | 3300009176 | Ga0105242_11335881 | Ga0105242_113358811 | 140 |
| 139 | 3300009177 | Ga0105248_10757025 | Ga0105248_107570252 | 140 |
| 140 | 3300009177 | Ga0105248_11124767 | Ga0105248_111247672 | 140 |
| 141 | 3300009545 | Ga0105237_10374119 | Ga0105237_103741192 | 140 |
| 142 | 3300009551 | Ga0105238_10530280 | Ga0105238_105302802 | 140 |
| 143 | 3300009551 | Ga0105238_10754690 | Ga0105238_107546901 | 140 |
| 144 | 3300009553 | Ga0105249_10329068 | Ga0105249_103290682 | 140 |
| 145 | 3300009553 | Ga0105249_12333153 | Ga0105249_123331531 | 140 |
| 146 | 3300010159 | Ga0099796_10118101 | Ga0099796_101181013 | 140 |
| 147 | 3300010375 | Ga0105239_10771069 | Ga0105239_107710691 | 140 |
| 148 | 3300010375 | Ga0105239_10891467 | Ga0105239_108914673 | 140 |
| 149 | 3300011119 | Ga0105246_10342609 | Ga0105246_103426091 | 140 |
| 150 | 3300011119 | Ga0105246_10485202 | Ga0105246_104852021 | 140 |
| 151 | 3300012515 | Ga0157338_1005719 | Ga0157338_10057193 | 140 |
| 152 | 3300013105 | Ga0157369_10003558 | Ga0157369_1000355817 | 140 |
| 153 | 3300013105 | Ga0157369_10522502 | Ga0157369_105225022 | 140 |
| 154 | 3300013297 | Ga0157378_10177412 | Ga0157378_101774124 | 140 |
| 155 | 3300013297 | Ga0157378_10450926 | Ga0157378_104509263 | 140 |
| 156 | 3300013297 | Ga0157378_10617084 | Ga0157378_106170841 | 140 |
| 157 | 3300013306 | Ga0163162_10465644 | Ga0163162_104656441 | 140 |
| 158 | 3300013306 | Ga0163162_10671187 | Ga0163162_106711873 | 140 |
| 159 | 3300013306 | Ga0163162_12796065 | Ga0163162_127960652 | 140 |
| 160 | 3300013308 | Ga0157375_10704517 | Ga0157375_107045172 | 140 |
| 161 | 3300014325 | Ga0163163_10790288 | Ga0163163_107902882 | 140 |
| 162 | 3300014325 | Ga0163163_11993983 | Ga0163163_119939832 | 140 |
| 163 | 3300014326 | Ga0157380_10401638 | Ga0157380_104016383 | 140 |
| 164 | 3300014326 | Ga0157380_10422128 | Ga0157380_104221282 | 140 |
| 165 | 3300014745 | Ga0157377_10226864 | Ga0157377_102268642 | 140 |
| 166 | 3300014745 | Ga0157377_10454881 | Ga0157377_104548811 | 140 |
| 167 | 3300014969 | Ga0157376_10592419 | Ga0157376_105924192 | 140 |
| 168 | 3300015262 | Ga0182007_10118846 | Ga0182007_101188461 | 140 |
| 169 | 3300015265 | Ga0182005_1034174 | Ga0182005_10341743 | 140 |
| 170 | 3300017792 | Ga0163161_10497423 | Ga0163161_104974232 | 140 |
| 171 | 3300021358 | Ga0213873_10027059 | Ga0213873_100270591 | 140 |
| 172 | 3300021361 | Ga0213872_10011011 | Ga0213872_100110114 | 140 |
| 173 | 3300021361 | Ga0213872_10055944 | Ga0213872_100559441 | 140 |
| 174 | 3300021361 | Ga0213872_10149140 | Ga0213872_101491402 | 140 |
| 175 | 3300021377 | Ga0213874_10050111 | Ga0213874_100501111 | 140 |
| 176 | 3300021384 | Ga0213876_10023733 | Ga0213876_100237332 | 140 |
| 177 | 3300021384 | Ga0213876_10336794 | Ga0213876_103367942 | 140 |
| 178 | 3300021388 | Ga0213875_10036016 | Ga0213875_100360162 | 140 |
| 179 | 3300021441 | Ga0213871_10027107 | Ga0213871_100271072 | 140 |
| 180 | 3300021441 | Ga0213871_10063017 | Ga0213871_100630173 | 140 |
| 181 | 3300025898 | Ga0207692_10270735 | Ga0207692_102707351 | 140 |
| 182 | 3300025899 | Ga0207642_10175029 | Ga0207642_101750292 | 140 |
| 183 | 3300025901 | Ga0207688_10273324 | Ga0207688_102733242 | 140 |
| 184 | 3300025903 | Ga0207680_10055136 | Ga0207680_100551363 | 140 |
| 185 | 3300025903 | Ga0207680_10204514 | Ga0207680_102045141 | 140 |
| 186 | 3300025903 | Ga0207680_10235222 | Ga0207680_102352222 | 140 |
| 187 | 3300025904 | Ga0207647_10119111 | Ga0207647_101191112 | 140 |
| 188 | 3300025905 | Ga0207685_10174967 | Ga0207685_101749673 | 140 |
| 189 | 3300025906 | Ga0207699_10475628 | Ga0207699_104756281 | 140 |
| 190 | 3300025907 | Ga0207645_10072709 | Ga0207645_100727092 | 140 |
| 191 | 3300025908 | Ga0207643_10457882 | Ga0207643_104578821 | 140 |
| 192 | 3300025911 | Ga0207654_10387519 | Ga0207654_103875192 | 140 |
| 193 | 3300025912 | Ga0207707_10654465 | Ga0207707_106544652 | 140 |
| 194 | 3300025913 | Ga0207695_10319174 | Ga0207695_103191742 | 140 |
| 195 | 3300025913 | Ga0207695_10702176 | Ga0207695_107021762 | 140 |
| 196 | 3300025916 | Ga0207663_10017696 | Ga0207663_100176965 | 140 |
| 197 | 3300025918 | Ga0207662_10095938 | Ga0207662_100959383 | 140 |
| 198 | 3300025919 | Ga0207657_10313636 | Ga0207657_103136361 | 140 |
| 199 | 3300025919 | Ga0207657_10665675 | Ga0207657_106656751 | 140 |
| 200 | 3300025920 | Ga0207649_10021569 | Ga0207649_100215694 | 140 |
| 201 | 3300025920 | Ga0207649_10573817 | Ga0207649_105738172 | 140 |
| 202 | 3300025921 | Ga0207652_10475255 | Ga0207652_104752551 | 140 |
| 203 | 3300025923 | Ga0207681_10657595 | Ga0207681_106575952 | 140 |
| 204 | 3300025924 | Ga0207694_11526876 | Ga0207694_115268761 | 140 |
| 205 | 3300025925 | Ga0207650_10415149 | Ga0207650_104151493 | 140 |
| 206 | 3300025925 | Ga0207650_11171654 | Ga0207650_111716541 | 140 |
| 207 | 3300025926 | Ga0207659_11008040 | Ga0207659_110080401 | 140 |
| 208 | 3300025927 | Ga0207687_10696629 | Ga0207687_106966291 | 140 |
| 209 | 3300025928 | Ga0207700_10474169 | Ga0207700_104741692 | 140 |
| 210 | 3300025933 | Ga0207706_10222117 | Ga0207706_102221173 | 140 |
| 211 | 3300025933 | Ga0207706_10599498 | Ga0207706_105994982 | 140 |
| 212 | 3300025934 | Ga0207686_10123401 | Ga0207686_101234012 | 140 |
| 213 | 3300025934 | Ga0207686_10508584 | Ga0207686_105085842 | 140 |
| 214 | 3300025935 | Ga0207709_10038008 | Ga0207709_100380082 | 140 |
| 215 | 3300025935 | Ga0207709_10554805 | Ga0207709_105548051 | 140 |
| 216 | 3300025935 | Ga0207709_10628256 | Ga0207709_106282562 | 140 |
| 217 | 3300025936 | Ga0207670_10569658 | Ga0207670_105696581 | 140 |
| 218 | 3300025936 | Ga0207670_10632155 | Ga0207670_106321552 | 140 |
| 219 | 3300025937 | Ga0207669_10437309 | Ga0207669_104373092 | 140 |
| 220 | 3300025937 | Ga0207669_10526105 | Ga0207669_105261052 | 140 |
| 221 | 3300025938 | Ga0207704_10674911 | Ga0207704_106749112 | 140 |
| 222 | 3300025939 | Ga0207665_10027888 | Ga0207665_100278885 | 140 |
| 223 | 3300025940 | Ga0207691_10174553 | Ga0207691_101745531 | 140 |
| 224 | 3300025940 | Ga0207691_10174553 | Ga0207691_101745533 | 140 |
| 225 | 3300025940 | Ga0207691_10497434 | Ga0207691_104974342 | 140 |
| 226 | 3300025940 | Ga0207691_10498579 | Ga0207691_104985792 | 140 |
| 227 | 3300025941 | Ga0207711_10490292 | Ga0207711_104902923 | 140 |
| 228 | 3300025942 | Ga0207689_10542681 | Ga0207689_105426811 | 140 |
| 229 | 3300025942 | Ga0207689_10589058 | Ga0207689_105890582 | 140 |
| 230 | 3300025942 | Ga0207689_11100878 | Ga0207689_111008781 | 140 |
| 231 | 3300025945 | Ga0207679_10645567 | Ga0207679_106455671 | 140 |
| 232 | 3300025945 | Ga0207679_11028237 | Ga0207679_110282371 | 140 |
| 233 | 3300025949 | Ga0207667_10716470 | Ga0207667_107164702 | 140 |
| 234 | 3300025960 | Ga0207651_11284221 | Ga0207651_112842211 | 140 |
| 235 | 3300025961 | Ga0207712_10262193 | Ga0207712_102621932 | 140 |
| 236 | 3300025972 | Ga0207668_10797403 | Ga0207668_107974032 | 140 |
| 237 | 3300025981 | Ga0207640_10599350 | Ga0207640_105993502 | 140 |
| 238 | 3300025986 | Ga0207658_10623135 | Ga0207658_106231352 | 140 |
| 239 | 3300026035 | Ga0207703_10362307 | Ga0207703_103623073 | 140 |
| 240 | 3300026041 | Ga0207639_10002990 | Ga0207639_100029904 | 140 |
| 241 | 3300026041 | Ga0207639_10657006 | Ga0207639_106570062 | 140 |
| 242 | 3300026041 | Ga0207639_10766078 | Ga0207639_107660782 | 140 |
| 243 | 3300026041 | Ga0207639_11849834 | Ga0207639_118498341 | 140 |
| 244 | 3300026067 | Ga0207678_10444333 | Ga0207678_104443333 | 140 |
| 245 | 3300026075 | Ga0207708_10038597 | Ga0207708_100385973 | 140 |
| 246 | 3300026075 | Ga0207708_10310395 | Ga0207708_103103952 | 140 |
| 247 | 3300026078 | Ga0207702_10874174 | Ga0207702_108741741 | 140 |
| 248 | 3300026088 | Ga0207641_10025835 | Ga0207641_100258359 | 140 |
| 249 | 3300026089 | Ga0207648_10541089 | Ga0207648_105410891 | 140 |
| 250 | 3300026089 | Ga0207648_10559031 | Ga0207648_105590311 | 140 |
| 251 | 3300026095 | Ga0207676_10505456 | Ga0207676_105054562 | 140 |
| 252 | 3300026095 | Ga0207676_11256590 | Ga0207676_112565902 | 140 |
| 253 | 3300026116 | Ga0207674_11709402 | Ga0207674_117094022 | 140 |
| 254 | 3300026118 | Ga0207675_100232312 | Ga0207675_1002323122 | 140 |
| 255 | 3300026118 | Ga0207675_100657888 | Ga0207675_1006578881 | 140 |
| 256 | 3300026121 | Ga0207683_10025033 | Ga0207683_100250336 | 140 |
| 257 | 3300026121 | Ga0207683_10615589 | Ga0207683_106155891 | 140 |
| 258 | 3300026121 | Ga0207683_10796843 | Ga0207683_107968432 | 140 |
| 259 | 3300026142 | Ga0207698_10499738 | Ga0207698_104997382 | 140 |
| 260 | 3300026142 | Ga0207698_10991474 | Ga0207698_109914741 | 140 |
| 261 | 3300026142 | Ga0207698_11306307 | Ga0207698_113063072 | 140 |
| 262 | 3300027876 | Ga0209974_10228386 | Ga0209974_102283861 | 140 |
| 263 | 3300028379 | Ga0268266_10436933 | Ga0268266_104369333 | 140 |
| 264 | 3300028379 | Ga0268266_10757470 | Ga0268266_107574702 | 140 |
| 265 | 3300028380 | Ga0268265_10770703 | Ga0268265_107707031 | 140 |
| 266 | 3300028380 | Ga0268265_10798719 | Ga0268265_107987192 | 140 |
| 267 | 3300028381 | Ga0268264_11029626 | Ga0268264_110296261 | 140 |
| 268 | 3300028381 | Ga0268264_11268438 | Ga0268264_112684382 | 140 |
| 269 | 3300028558 | Ga0265326_10062338 | Ga0265326_100623382 | 140 |
| 270 | 3300028573 | Ga0265334_10192344 | Ga0265334_101923441 | 140 |
| 271 | 3300028577 | Ga0265318_10100799 | Ga0265318_101007992 | 140 |
| 272 | 3300028800 | Ga0265338_10339643 | Ga0265338_103396432 | 140 |
| 273 | 3300028800 | Ga0265338_10709910 | Ga0265338_107099102 | 140 |
| 274 | 3300029957 | Ga0265324_10086692 | Ga0265324_100866921 | 140 |
| 275 | 3300031235 | Ga0265330_10137848 | Ga0265330_101378482 | 140 |
| 276 | 3300031235 | Ga0265330_10189007 | Ga0265330_101890072 | 140 |
| 277 | 3300031238 | Ga0265332_10164097 | Ga0265332_101640972 | 140 |
| 278 | 3300031239 | Ga0265328_10100034 | Ga0265328_101000342 | 140 |
| 279 | 3300031239 | Ga0265328_10135239 | Ga0265328_101352391 | 140 |
| 280 | 3300031240 | Ga0265320_10027217 | Ga0265320_100272172 | 140 |
| 281 | 3300031240 | Ga0265320_10145521 | Ga0265320_101455211 | 140 |
| 282 | 3300031241 | Ga0265325_10017004 | Ga0265325_100170044 | 140 |
| 283 | 3300031241 | Ga0265325_10183757 | Ga0265325_101837572 | 140 |
| 284 | 3300031241 | Ga0265325_10210721 | Ga0265325_102107212 | 140 |
| 285 | 3300031242 | Ga0265329_10075906 | Ga0265329_100759062 | 140 |
| 286 | 3300031242 | Ga0265329_10093342 | Ga0265329_100933422 | 140 |
| 287 | 3300031242 | Ga0265329_10096743 | Ga0265329_100967431 | 140 |
| 288 | 3300031247 | Ga0265340_10123751 | Ga0265340_101237511 | 140 |
| 289 | 3300031247 | Ga0265340_10137232 | Ga0265340_101372322 | 140 |
| 290 | 3300031247 | Ga0265340_10167051 | Ga0265340_101670512 | 140 |
| 291 | 3300031249 | Ga0265339_10061812 | Ga0265339_100618122 | 140 |
| 292 | 3300031249 | Ga0265339_10142027 | Ga0265339_101420272 | 140 |
| 293 | 3300031249 | Ga0265339_10177780 | Ga0265339_101777803 | 140 |
| 294 | 3300031249 | Ga0265339_10336390 | Ga0265339_103363902 | 140 |
| 295 | 3300031250 | Ga0265331_10007247 | Ga0265331_100072476 | 140 |
| 296 | 3300031250 | Ga0265331_10160903 | Ga0265331_101609032 | 140 |
| 297 | 3300031251 | Ga0265327_10124936 | Ga0265327_101249363 | 140 |
| 298 | 3300031344 | Ga0265316_10039062 | Ga0265316_100390621 | 140 |
| 299 | 3300031344 | Ga0265316_10244253 | Ga0265316_102442532 | 140 |
| 300 | 3300031344 | Ga0265316_10401175 | Ga0265316_104011752 | 140 |
| 301 | 3300031344 | Ga0265316_10450361 | Ga0265316_104503612 | 140 |
| 302 | 3300031456 | Ga0307513_10524425 | Ga0307513_105244251 | 140 |
| 303 | 3300031548 | Ga0307408_100361649 | Ga0307408_1003616493 | 140 |
| 304 | 3300031595 | Ga0265313_10005945 | Ga0265313_1000594510 | 140 |
| 305 | 3300031595 | Ga0265313_10090117 | Ga0265313_100901172 | 140 |
| 306 | 3300031595 | Ga0265313_10098903 | Ga0265313_100989033 | 140 |
| 307 | 3300031711 | Ga0265314_10166410 | Ga0265314_101664101 | 140 |
| 308 | 3300031711 | Ga0265314_10369479 | Ga0265314_103694792 | 140 |
| 309 | 3300031712 | Ga0265342_10014539 | Ga0265342_100145391 | 140 |
| 310 | 3300031712 | Ga0265342_10062162 | Ga0265342_100621623 | 140 |
| 311 | 3300031712 | Ga0265342_10188212 | Ga0265342_101882121 | 140 |
| 312 | 3300031712 | Ga0265342_10253414 | Ga0265342_102534141 | 140 |
| 313 | 3300031730 | Ga0307516_10557827 | Ga0307516_105578271 | 140 |
| 314 | 3300031731 | Ga0307405_10371480 | Ga0307405_103714802 | 140 |
| 315 | 3300031731 | Ga0307405_10501645 | Ga0307405_105016451 | 140 |
| 316 | 3300031824 | Ga0307413_10115514 | Ga0307413_101155143 | 140 |
| 317 | 3300031852 | Ga0307410_10220482 | Ga0307410_102204823 | 140 |
| 318 | 3300031852 | Ga0307410_10587364 | Ga0307410_105873641 | 140 |
| 319 | 3300031901 | Ga0307406_10387754 | Ga0307406_103877541 | 140 |
| 320 | 3300031903 | Ga0307407_10365773 | Ga0307407_103657731 | 140 |
| 321 | 3300031903 | Ga0307407_10446227 | Ga0307407_104462272 | 140 |
| 322 | 3300031911 | Ga0307412_10734072 | Ga0307412_107340722 | 140 |
| 323 | 3300031995 | Ga0307409_100645660 | Ga0307409_1006456602 | 140 |
| 324 | 3300032002 | Ga0307416_100236117 | Ga0307416_1002361172 | 140 |
| 325 | 3300032002 | Ga0307416_100833847 | Ga0307416_1008338472 | 140 |
| 326 | 3300032002 | Ga0307416_102053286 | Ga0307416_1020532861 | 140 |
| 327 | 3300032126 | Ga0307415_100461838 | Ga0307415_1004618382 | 140 |
| 328 | 3300032126 | Ga0307415_101648258 | Ga0307415_1016482581 | 140 |
| 329 | 3300034817 | Ga0373948_0040224 | Ga0373948_0040224_79_507 | 140 |
| 330 | 3300034818 | Ga0373950_0082247 | Ga0373950_0082247_124_552 | 140 |
| 331 | 3300035086 | Ga0373934_0079607 | Ga0373934_0079607_439_861 | 140 |
| 332 | 3300035088 | Ga0373940_0222598 | Ga0373940_0222598_108_536 | 140 |
| 333 | 3300035090 | Ga0373949_0064245 | Ga0373949_0064245_54_482 | 140 |
| 334 | 3300035091 | Ga0373951_0053258 | Ga0373951_0053258_37_465 | 140 |
| 335 | 3300035092 | Ga0373952_0066590 | Ga0373952_0066590_311_739 | 140 |
| 336 | 3300035112 | Ga0373932_0243301 | Ga0373932_0243301_53_481 | 140 |
| 337 | 3300035113 | Ga0373936_0173513 | Ga0373936_0173513_56_478 | 140 |
| 338 | 3300035114 | Ga0373939_0122294 | Ga0373939_0122294_25_453 | 140 |
| 339 | 3300035115 | Ga0373941_0080367 | Ga0373941_0080367_235_663 | 140 |
| 340 | 3300035116 | Ga0373945_0198780 | Ga0373945_0198780_22_444 | 140 |
| 341 | 3300035119 | Ga0373956_0267646 | Ga0373956_0267646_215_643 | 140 |
| 342 | 3300035121 | Ga0373960_0080931 | Ga0373960_0080931_530_958 | 140 |
| 343 | 3300035170 | Ga0373943_0135377 | Ga0373943_0135377_775_1197 | 140 |
| 344 | 3300035170 | Ga0373943_0185957 | Ga0373943_0185957_667_1095 | 140 |
| 345 | 3300035171 | Ga0373946_0187963 | Ga0373946_0187963_515_937 | 140 |
| 346 | 3300035171 | Ga0373946_0744802 | Ga0373946_0744802_30_452 | 140 |
| 347 | 3300035207 | Ga0373942_0073196 | Ga0373942_0073196_111_539 | 140 |
| 348 | 3300035241 | Ga0373961_0074216 | Ga0373961_0074216_466_894 | 140 |
| 349 | 3300035242 | Ga0373962_0041770 | Ga0373962_0041770_197_625 | 140 |
| 350 | 3300035398 | Ga0316574_0208120 | Ga0316574_0208120_214_642 | 140 |
| 351 | 3300035691 | Ga0373931_0168570 | Ga0373931_0168570_56_484 | 140 |
| 352 | 3300035692 | Ga0373935_0299873 | Ga0373935_0299873_681_1103 | 140 |
| 353 | 3300035692 | Ga0373935_0558222 | Ga0373935_0558222_327_755 | 140 |
| 354 | 3300035724 | Ga0373933_0215060 | Ga0373933_0215060_80_508 | 140 |
| 355 | 3300035725 | Ga0373947_0256137 | Ga0373947_0256137_665_1087 | 140 |
| 356 | 3300036401 | Ga0373937_0613824 | Ga0373937_0613824_212_634 | 140 |
| 357 | 3300036401 | Ga0373937_0687320 | Ga0373937_0687320_528_956 | 140 |
| 358 | 3300036401 | Ga0373937_1046627 | Ga0373937_1046627_278_700 | 140 |
| 359 | 3300036647 | Ga0316582_1081620 | Ga0316582_1081620_79_507 | 140 |
| 360 | 3300037068 | Ga0373925_0184893 | Ga0373925_0184893_820_1242 | 140 |
| 361 | 3300037068 | Ga0373925_1371559 | Ga0373925_1371559_105_533 | 140 |
| 362 | 3300037466 | Ga0395898_1209316 | Ga0395898_1209316_191_619 | 140 |
| 363 | 3300037471 | Ga0395905_0327147 | Ga0395905_0327147_969_1391 | 140 |
| 364 | 3300037471 | Ga0395905_0443817 | Ga0395905_0443817_763_1185 | 140 |
| 365 | 3300037471 | Ga0395905_0459040 | Ga0395905_0459040_295_717 | 140 |
| 366 | 3300037853 | Ga0436364_0176825 | Ga0436364_0176825_878_1306 | 140 |
| 367 | 3300037853 | Ga0436364_0230566 | Ga0436364_0230566_1398_1820 | 140 |
| 368 | 3300037853 | Ga0436364_0751518 | Ga0436364_0751518_353_775 | 140 |
| 369 | 3300037853 | Ga0436364_1290285 | Ga0436364_1290285_40_468 | 140 |
| 370 | 3300039437 | Ga0436365_0304394 | Ga0436365_0304394_101_529 | 140 |
| 371 | 3300039437 | Ga0436365_0889978 | Ga0436365_0889978_359_781 | 140 |
| 372 | 3300039437 | Ga0436365_0916403 | Ga0436365_0916403_677_1099 | 140 |
| 373 | 3300039437 | Ga0436365_0953019 | Ga0436365_0953019_692_1114 | 140 |
| 374 | 3300039437 | Ga0436365_1038530 | Ga0436365_1038530_567_989 | 140 |
| 375 | 3300039437 | Ga0436365_1543867 | Ga0436365_1543867_129_551 | 140 |
| 376 | 3300039437 | Ga0436365_1796423 | Ga0436365_1796423_181_609 | 140 |
| 377 | 3300039438 | Ga0436360_0084886 | Ga0436360_0084886_128_556 | 140 |
| 378 | 3300039438 | Ga0436360_0190664 | Ga0436360_0190664_349_771 | 140 |
| 379 | 3300039438 | Ga0436360_0300747 | Ga0436360_0300747_81_503 | 140 |
| 380 | 3300039438 | Ga0436360_0954986 | Ga0436360_0954986_470_892 | 140 |
| 381 | 3300039438 | Ga0436360_1090570 | Ga0436360_1090570_39_467 | 140 |
| 382 | 3300039438 | Ga0436360_1281300 | Ga0436360_1281300_129_557 | 140 |
| 383 | 3300039447 | Ga0436361_0144288 | Ga0436361_0144288_446_868 | 140 |
| 384 | 3300039447 | Ga0436361_0224788 | Ga0436361_0224788_728_1156 | 140 |
| 385 | 3300039447 | Ga0436361_0323478 | Ga0436361_0323478_198_620 | 140 |
| 386 | 3300039447 | Ga0436361_0369523 | Ga0436361_0369523_547_975 | 140 |
| 387 | 3300039447 | Ga0436361_0598041 | Ga0436361_0598041_256_684 | 140 |
| 388 | 3300039447 | Ga0436361_0658187 | Ga0436361_0658187_1202_1624 | 140 |
| 389 | 3300039450 | Ga0436363_0191444 | Ga0436363_0191444_60_488 | 140 |
| 390 | 3300039450 | Ga0436363_1078731 | Ga0436363_1078731_892_1314 | 140 |
| 391 | 3300039450 | Ga0436363_1141193 | Ga0436363_1141193_187_609 | 140 |
| 392 | 3300039453 | Ga0436362_0300804 | Ga0436362_0300804_353_775 | 140 |
| 393 | 3300039453 | Ga0436362_1204039 | Ga0436362_1204039_101_523 | 140 |
| 394 | 3300041411 | Ga0439466_0055649 | Ga0439466_0055649_791_1219 | 140 |
| 395 | 3300041413 | Ga0439465_0190882 | Ga0439465_0190882_289_717 | 140 |
| 396 | 3300041413 | Ga0439465_0199016 | Ga0439465_0199016_220_648 | 140 |
| 397 | 3300041413 | Ga0439465_0356782 | Ga0439465_0356782_43_465 | 140 |
| 398 | 3300041452 | Ga0451793_1106380 | Ga0451793_1106380_110_538 | 140 |
| 399 | 3300041453 | Ga0451797_0907562 | Ga0451797_0907562_78_506 | 140 |
| 400 | 3300041458 | Ga0451798_1072412 | Ga0451798_1072412_400_828 | 140 |
| 401 | 3300041460 | Ga0451802_0228420 | Ga0451802_0228420_67_495 | 140 |
| 402 | 3300041460 | Ga0451802_2096503 | Ga0451802_2096503_140_568 | 140 |
| 403 | 3300041486 | Ga0451807_1047851 | Ga0451807_1047851_324_752 | 140 |
| 404 | 3300041494 | Ga0451837_1271536 | Ga0451837_1271536_171_599 | 140 |
| 405 | 3300041494 | Ga0451837_1861520 | Ga0451837_1861520_353_781 | 140 |
| 406 | 3300041507 | Ga0451851_0809618 | Ga0451851_0809618_509_937 | 140 |
| 407 | 3300041511 | Ga0451855_1985776 | Ga0451855_1985776_25_453 | 140 |
| 408 | 3300041512 | Ga0451853_1763636 | Ga0451853_1763636_199_627 | 140 |
| 409 | 3300042005 | Ga0439448_0067681 | Ga0439448_0067681_543_971 | 140 |
| 410 | 3300042008 | Ga0439450_008225 | Ga0439450_008225_1019_1447 | 140 |
| 411 | 3300042011 | Ga0439454_003986 | Ga0439454_003986_374_802 | 140 |
| 412 | 3300042014 | Ga0439457_005512 | Ga0439457_005512_465_893 | 140 |
| 413 | 3300042016 | Ga0439463_099299 | Ga0439463_099299_37_465 | 140 |
| 414 | 3300042122 | Ga0450920_029371 | Ga0450920_029371_538_966 | 140 |
| 415 | 3300042125 | Ga0450923_078411 | Ga0450923_078411_93_521 | 140 |
| 416 | 3300042125 | Ga0450923_095907 | Ga0450923_095907_52_480 | 140 |
| 417 | 3300042125 | Ga0450923_161470 | Ga0450923_161470_11_439 | 140 |
| 418 | 3300042435 | Ga0439434_0184347 | Ga0439434_0184347_104_532 | 140 |
| 419 | 3300042438 | Ga0439459_0039346 | Ga0439459_0039346_143_571 | 140 |
| 420 | 3300042461 | Ga0439460_0045690 | Ga0439460_0045690_521_949 | 140 |
| 421 | 3300042993 | Ga0439440_0079393 | Ga0439440_0079393_82_510 | 140 |
| 422 | 3300044684 | Ga0466966_0188773 | Ga0466966_0188773_88_510 | 140 |
| 423 | 3300044719 | Ga0466971_0344004 | Ga0466971_0344004_12_434 | 140 |
| 424 | 3300044735 | Ga0466968_0345083 | Ga0466968_0345083_46_474 | 140 |
| 425 | 3300044842 | Ga0466957_0180413 | Ga0466957_0180413_307_729 | 140 |
| 426 | 3300045051 | Ga0451576_1414963 | Ga0451576_1414963_203_631 | 140 |
| 427 | 3300045836 | Ga0466958_0326937 | Ga0466958_0326937_477_899 | 140 |
| 428 | 3300045976 | Ga0466967_0610486 | Ga0466967_0610486_43_465 | 140 |
| 429 | 3300046454 | Ga0495592_0440415 | Ga0495592_0440415_342_770 | 140 |
| 430 | 3300046454 | Ga0495592_0719637 | Ga0495592_0719637_29_451 | 140 |
| 431 | 3300046459 | Ga0495629_0269178 | Ga0495629_0269178_85_513 | 140 |
| 432 | 3300046459 | Ga0495629_0773421 | Ga0495629_0773421_45_473 | 140 |
| 433 | 3300046460 | Ga0495638_0156254 | Ga0495638_0156254_274_702 | 140 |
| 434 | 3300046462 | Ga0495651_0406577 | Ga0495651_0406577_54_482 | 140 |
| 435 | 3300046472 | Ga0495580_0523499 | Ga0495580_0523499_24_452 | 140 |
| 436 | 3300046475 | Ga0495639_0237519 | Ga0495639_0237519_35_457 | 140 |
| 437 | 3300046476 | Ga0495662_0200179 | Ga0495662_0200179_51_479 | 140 |
| 438 | 3300046492 | Ga0495585_0249918 | Ga0495585_0249918_71_493 | 140 |
| 439 | 3300046499 | Ga0495594_0313736 | Ga0495594_0313736_24_452 | 140 |
| 440 | 3300046499 | Ga0495594_0637008 | Ga0495594_0637008_67_495 | 140 |
| 441 | 3300046500 | Ga0495596_0195999 | Ga0495596_0195999_337_765 | 140 |
| 442 | 3300046501 | Ga0495607_0385885 | Ga0495607_0385885_142_570 | 140 |
| 443 | 3300046506 | Ga0495583_0114819 | Ga0495583_0114819_290_718 | 140 |
| 444 | 3300046507 | Ga0495606_0157046 | Ga0495606_0157046_238_666 | 140 |
| 445 | 3300046507 | Ga0495606_0596240 | Ga0495606_0596240_94_522 | 140 |
| 446 | 3300046511 | Ga0495608_0286731 | Ga0495608_0286731_55_483 | 140 |
| 447 | 3300046511 | Ga0495608_0684532 | Ga0495608_0684532_130_558 | 140 |
| 448 | 3300046512 | Ga0495610_0037830 | Ga0495610_0037830_980_1408 | 140 |
| 449 | 3300046514 | Ga0495618_0615618 | Ga0495618_0615618_193_621 | 140 |
| 450 | 3300046515 | Ga0495620_0028952 | Ga0495620_0028952_330_758 | 140 |
| 451 | 3300046516 | Ga0495628_0295619 | Ga0495628_0295619_164_592 | 140 |
| 452 | 3300046516 | Ga0495628_0494126 | Ga0495628_0494126_384_806 | 140 |
| 453 | 3300046516 | Ga0495628_0554331 | Ga0495628_0554331_309_737 | 140 |
| 454 | 3300046516 | Ga0495628_0798800 | Ga0495628_0798800_166_594 | 140 |
| 455 | 3300046518 | Ga0495631_0142549 | Ga0495631_0142549_539_967 | 140 |
| 456 | 3300046520 | Ga0495637_0097273 | Ga0495637_0097273_13_441 | 140 |
| 457 | 3300046522 | Ga0495643_0057718 | Ga0495643_0057718_1214_1642 | 140 |
| 458 | 3300046524 | Ga0495648_0118632 | Ga0495648_0118632_441_869 | 140 |
| 459 | 3300046524 | Ga0495648_0195750 | Ga0495648_0195750_514_942 | 140 |
| 460 | 3300046528 | Ga0495642_0406611 | Ga0495642_0406611_100_528 | 140 |
| 461 | 3300046529 | Ga0495652_0454922 | Ga0495652_0454922_10_438 | 140 |
| 462 | 3300046530 | Ga0495654_0156105 | Ga0495654_0156105_123_551 | 140 |
| 463 | 3300046530 | Ga0495654_0300164 | Ga0495654_0300164_89_517 | 140 |
| 464 | 3300046531 | Ga0495665_0199638 | Ga0495665_0199638_409_831 | 140 |
| 465 | 3300046533 | Ga0495640_0518561 | Ga0495640_0518561_87_515 | 140 |
| 466 | 3300046533 | Ga0495640_0637923 | Ga0495640_0637923_59_487 | 140 |
| 467 | 3300046535 | Ga0495586_0175465 | Ga0495586_0175465_572_1000 | 140 |
| 468 | 3300046536 | Ga0495587_0313429 | Ga0495587_0313429_19_447 | 140 |
| 469 | 3300046537 | Ga0495598_0055244 | Ga0495598_0055244_534_962 | 140 |
| 470 | 3300046538 | Ga0495609_0057679 | Ga0495609_0057679_719_1147 | 140 |
| 471 | 3300046539 | Ga0495621_0033352 | Ga0495621_0033352_710_1138 | 140 |
| 472 | 3300046539 | Ga0495621_0173680 | Ga0495621_0173680_88_516 | 140 |
| 473 | 3300046542 | Ga0495597_0106827 | Ga0495597_0106827_621_1049 | 140 |
| 474 | 3300046543 | Ga0495645_0364316 | Ga0495645_0364316_28_456 | 140 |
| 475 | 3300046557 | Ga0495622_0013897 | Ga0495622_0013897_2981_3409 | 140 |
| 476 | 3300046557 | Ga0495622_0196348 | Ga0495622_0196348_109_537 | 140 |
| 477 | 3300046558 | Ga0495633_0172675 | Ga0495633_0172675_553_981 | 140 |
| 478 | 3300046559 | Ga0495667_0542919 | Ga0495667_0542919_207_635 | 140 |
| 479 | 3300046615 | Ga0495656_0198473 | Ga0495656_0198473_552_980 | 140 |
| 480 | 3300046615 | Ga0495656_0212596 | Ga0495656_0212596_518_946 | 140 |
| 481 | 3300046648 | Ga0495611_0109267 | Ga0495611_0109267_81_503 | 140 |
| 482 | 3300046660 | Ga0495625_0233537 | Ga0495625_0233537_429_857 | 140 |
| 483 | 3300046663 | Ga0495635_0364266 | Ga0495635_0364266_122_550 | 140 |
| 484 | 3300046663 | Ga0495635_0564359 | Ga0495635_0564359_147_575 | 140 |
| 485 | 3300046665 | Ga0495661_0260921 | Ga0495661_0260921_438_866 | 140 |
| 486 | 3300046674 | Ga0495588_0161978 | Ga0495588_0161978_238_666 | 140 |
| 487 | 3300046675 | Ga0495657_0285616 | Ga0495657_0285616_28_456 | 140 |
| 488 | 3300046678 | Ga0495599_0794622 | Ga0495599_0794622_27_449 | 140 |
| 489 | 3300046679 | Ga0495623_0300527 | Ga0495623_0300527_300_728 | 140 |
| 490 | 3300046680 | Ga0495646_0326846 | Ga0495646_0326846_72_500 | 140 |
| 491 | 3300046683 | Ga0495658_0441121 | Ga0495658_0441121_141_569 | 140 |
| 492 | 3300046684 | Ga0495669_0000800 | Ga0495669_0000800_11051_11479 | 140 |
| 493 | 3300046684 | Ga0495669_0181733 | Ga0495669_0181733_424_852 | 140 |
| 494 | 3300046689 | Ga0495613_0207949 | Ga0495613_0207949_733_1161 | 140 |
| 495 | 3300046689 | Ga0495613_0292549 | Ga0495613_0292549_157_579 | 140 |
| 496 | 3300046689 | Ga0495613_0865850 | Ga0495613_0865850_79_507 | 140 |
| 497 | 3300046690 | Ga0495624_0273916 | Ga0495624_0273916_539_967 | 140 |
| 498 | 3300046691 | Ga0495670_0094366 | Ga0495670_0094366_1019_1447 | 140 |
| 499 | 3300046691 | Ga0495670_0168579 | Ga0495670_0168579_711_1139 | 140 |
| 500 | 3300046691 | Ga0495670_0233119 | Ga0495670_0233119_278_706 | 140 |
| 501 | 3300046794 | Ga0495589_0022026 | Ga0495589_0022026_746_1174 | 140 |
| 502 | 3300046809 | Ga0495600_0098708 | Ga0495600_0098708_36_464 | 140 |
| 503 | 3300047315 | Ga0495581_0186355 | Ga0495581_0186355_539_967 | 140 |
| 504 | 3300047315 | Ga0495581_0299695 | Ga0495581_0299695_363_791 | 140 |
| 505 | 3300047315 | Ga0495581_0581964 | Ga0495581_0581964_199_621 | 140 |
| 506 | 3300047319 | Ga0495674_0658061 | Ga0495674_0658061_383_811 | 140 |
| 507 | 3300047320 | Ga0495672_0193675 | Ga0495672_0193675_573_1001 | 140 |
| 508 | 3300047321 | Ga0495676_0166956 | Ga0495676_0166956_433_861 | 140 |
| 509 | 3300047322 | Ga0495680_0347372 | Ga0495680_0347372_100_528 | 140 |
| 510 | 3300047322 | Ga0495680_0800716 | Ga0495680_0800716_123_551 | 140 |
| 511 | 3300047447 | Ga0495685_101958 | Ga0495685_101958_501_929 | 140 |
| 512 | 3300047469 | Ga0495673_0281080 | Ga0495673_0281080_42_470 | 140 |
| 513 | 3300047471 | Ga0495684_0463122 | Ga0495684_0463122_20_448 | 140 |
| 514 | 3300047471 | Ga0495684_0977560 | Ga0495684_0977560_34_462 | 140 |
| 515 | 3300047472 | Ga0495686_0115490 | Ga0495686_0115490_757_1185 | 140 |
| 516 | 3300047472 | Ga0495686_0212290 | Ga0495686_0212290_75_503 | 140 |
| 517 | 3300047472 | Ga0495686_0352657 | Ga0495686_0352657_292_720 | 140 |
| 518 | 3300047673 | Ga0495593_0086707 | Ga0495593_0086707_760_1188 | 140 |
| 519 | 3300048088 | Ga0495602_0211523 | Ga0495602_0211523_419_847 | 140 |
| 520 | 3300048088 | Ga0495602_0510171 | Ga0495602_0510171_70_498 | 140 |
| 521 | 3300048088 | Ga0495602_0730835 | Ga0495602_0730835_185_613 | 140 |
| 522 | 3300048090 | Ga0495615_0122441 | Ga0495615_0122441_122_550 | 140 |
| 523 | 3300048904 | Ga0496101_0329113 | Ga0496101_0329113_347_775 | 140 |
| 524 | 3300048904 | Ga0496101_0564936 | Ga0496101_0564936_394_822 | 140 |
| 525 | 3300048906 | Ga0496103_0648828 | Ga0496103_0648828_193_621 | 140 |
| 526 | 3300048907 | Ga0496104_0079097 | Ga0496104_0079097_404_832 | 140 |
| 527 | 3300048907 | Ga0496104_0627271 | Ga0496104_0627271_405_833 | 140 |
| 528 | 3300048908 | Ga0496105_0219128 | Ga0496105_0219128_633_1061 | 140 |
| 529 | 3300048909 | Ga0496106_1146568 | Ga0496106_1146568_41_469 | 140 |
| 530 | 3300048910 | Ga0496107_0364491 | Ga0496107_0364491_147_569 | 140 |
| 531 | 3300048911 | Ga0496108_0535968 | Ga0496108_0535968_340_768 | 140 |
| 532 | 3300048911 | Ga0496108_1082232 | Ga0496108_1082232_192_614 | 140 |
| 533 | 3300048911 | Ga0496108_1233434 | Ga0496108_1233434_80_508 | 140 |
| 534 | 3300048912 | Ga0496109_0891407 | Ga0496109_0891407_49_477 | 140 |
| 535 | 3300048912 | Ga0496109_1366763 | Ga0496109_1366763_111_539 | 140 |
| 536 | 3300048913 | Ga0496110_0495233 | Ga0496110_0495233_315_743 | 140 |
| 537 | 3300048914 | Ga0496111_0199965 | Ga0496111_0199965_86_514 | 140 |
| 538 | 3300048916 | Ga0496113_0190978 | Ga0496113_0190978_116_544 | 140 |
| 539 | 3300048917 | Ga0496114_0499232 | Ga0496114_0499232_435_863 | 140 |
| 540 | 3300048918 | Ga0496115_0645202 | Ga0496115_0645202_117_545 | 140 |
| 541 | 3300048929 | Ga0496126_0056847 | Ga0496126_0056847_168_596 | 140 |
| 542 | 3300049460 | Ga0495682_0101372 | Ga0495682_0101372_477_905 | 140 |
| 543 | 3300049514 | Ga0501291_056109 | Ga0501291_056109_86_514 | 140 |
| 544 | 3300049569 | Ga0501032_0043367 | Ga0501032_0043367_2203_2631 | 140 |
| 545 | 3300049571 | Ga0501034_0300621 | Ga0501034_0300621_718_1140 | 140 |
| 546 | 3300049571 | Ga0501034_0506316 | Ga0501034_0506316_558_986 | 140 |
| 547 | 3300049572 | Ga0501036_1434049 | Ga0501036_1434049_90_518 | 140 |
| 548 | 3300049575 | Ga0501039_0085948 | Ga0501039_0085948_205_627 | 140 |
| 549 | 3300049575 | Ga0501039_1127796 | Ga0501039_1127796_165_587 | 140 |
| 550 | 3300049575 | Ga0501039_1500613 | Ga0501039_1500613_14_436 | 140 |
| 551 | 3300049577 | Ga0501041_0698244 | Ga0501041_0698244_17_439 | 140 |
| 552 | 3300049578 | Ga0501042_0346416 | Ga0501042_0346416_364_786 | 140 |
| 553 | 3300049578 | Ga0501042_0368060 | Ga0501042_0368060_549_977 | 140 |
| 554 | 3300049580 | Ga0501046_0087055 | Ga0501046_0087055_1789_2217 | 140 |
| 555 | 3300049580 | Ga0501046_0163676 | Ga0501046_0163676_735_1163 | 140 |
| 556 | 3300049581 | Ga0501047_0464319 | Ga0501047_0464319_571_999 | 140 |
| 557 | 3300049581 | Ga0501047_0602153 | Ga0501047_0602153_121_549 | 140 |
| 558 | 3300049581 | Ga0501047_0893176 | Ga0501047_0893176_177_605 | 140 |
| 559 | 3300049582 | Ga0501048_0421845 | Ga0501048_0421845_384_812 | 140 |
| 560 | 3300049588 | Ga0501072_0188075 | Ga0501072_0188075_60_482 | 140 |
| 561 | 3300049589 | Ga0501073_0336866 | Ga0501073_0336866_457_885 | 140 |
| 562 | 3300049591 | Ga0501075_0172089 | Ga0501075_0172089_972_1397 | 140 |
| 563 | 3300049592 | Ga0501076_0139064 | Ga0501076_0139064_388_810 | 140 |
| 564 | 3300049663 | Ga0501223_003421 | Ga0501223_003421_2581_3009 | 140 |
| 565 | 3300049669 | Ga0501235_050712 | Ga0501235_050712_322_750 | 140 |
| 566 | 3300049669 | Ga0501235_176894 | Ga0501235_176894_48_476 | 140 |
| 567 | 3300049743 | Ga0501081_1414408 | Ga0501081_1414408_83_505 | 140 |
| 568 | 3300049744 | Ga0501083_0361065 | Ga0501083_0361065_40_468 | 140 |
| 569 | 3300049822 | Ga0501035_0222464 | Ga0501035_0222464_262_690 | 140 |
| 570 | 3300049822 | Ga0501035_0251764 | Ga0501035_0251764_99_521 | 140 |
| 571 | 3300049822 | Ga0501035_0533880 | Ga0501035_0533880_481_909 | 140 |
| 572 | 3300049823 | Ga0501044_0533368 | Ga0501044_0533368_78_506 | 140 |
| 573 | 3300049823 | Ga0501044_0598238 | Ga0501044_0598238_52_480 | 140 |
| 574 | 3300049823 | Ga0501044_1145109 | Ga0501044_1145109_13_441 | 140 |
| 575 | 3300049824 | Ga0501045_1004770 | Ga0501045_1004770_89_511 | 140 |
| 576 | 3300050492 | nmdc:mga0yw44_207093_c1 | nmdc:mga0yw44_207093_c1_633_1061 | 140 |
| 577 | 3300050492 | nmdc:mga0yw44_404114_c1 | nmdc:mga0yw44_404114_c1_71_499 | 140 |
| 578 | 3300050495 | nmdc:mga04h51_294592_c1 | nmdc:mga04h51_294592_c1_47_475 | 140 |
| 579 | 3300050510 | nmdc:mga06r32_353164_c1 | nmdc:mga06r32_353164_c1_622_1050 | 140 |
| 580 | 3300050511 | nmdc:mga08y16_93425_c1 | nmdc:mga08y16_93425_c1_1732_2160 | 140 |
| 581 | 3300050511 | nmdc:mga08y16_990725_c1 | nmdc:mga08y16_990725_c1_26_454 | 140 |
| 582 | 3300053077 | Ga0495601_0084814 | Ga0495601_0084814_28_456 | 140 |
| 583 | 3300053077 | Ga0495601_0289352 | Ga0495601_0289352_18_446 | 140 |
| 584 | 3300053077 | Ga0495601_0290115 | Ga0495601_0290115_624_1046 | 140 |
| 585 | 3300053078 | Ga0495612_0091456 | Ga0495612_0091456_740_1162 | 140 |
| 586 | 3300053083 | Ga0495655_0009621 | Ga0495655_0009621_472_900 | 140 |
| 587 | 3300053084 | Ga0495595_0129533 | Ga0495595_0129533_267_695 | 140 |
| 588 | 3300053085 | Ga0495619_0422551 | Ga0495619_0422551_473_901 | 140 |
| 589 | 3300053085 | Ga0495619_0468602 | Ga0495619_0468602_428_856 | 140 |
| 590 | 3300053086 | Ga0500578_0097481 | Ga0500578_0097481_539_967 | 140 |
| 591 | 3300053087 | Ga0500643_042125 | Ga0500643_042125_396_824 | 140 |
| 592 | 3300053088 | Ga0500644_0495263 | Ga0500644_0495263_22_450 | 140 |
| 593 | 3300053091 | Ga0500647_0170669 | Ga0500647_0170669_65_493 | 140 |
| 594 | 3300053092 | Ga0500583_0157084 | Ga0500583_0157084_54_482 | 140 |
| 595 | 3300053093 | Ga0500651_0247053 | Ga0500651_0247053_103_531 | 140 |
| 596 | 3300053094 | Ga0500566_0200894 | Ga0500566_0200894_563_991 | 140 |
| 597 | 3300053096 | Ga0500641_0141420 | Ga0500641_0141420_573_1001 | 140 |
| 598 | 3300053103 | Ga0500555_067353 | Ga0500555_067353_78_506 | 140 |
| 599 | 3300053104 | Ga0500556_0000097 | Ga0500556_0000097_25614_26042 | 140 |
| 600 | 3300053104 | Ga0500556_0015300 | Ga0500556_0015300_42_470 | 140 |
| 601 | 3300053109 | Ga0500569_004219 | Ga0500569_004219_443_871 | 140 |
| 602 | 3300053111 | Ga0500572_061630 | Ga0500572_061630_15_443 | 140 |
| 603 | 3300053115 | Ga0500591_121315 | Ga0500591_121315_582_1010 | 140 |
| 604 | 3300053116 | Ga0500592_006928 | Ga0500592_006928_220_648 | 140 |
| 605 | 3300053117 | Ga0500593_132824 | Ga0500593_132824_144_572 | 140 |
| 606 | 3300053119 | Ga0500595_014889 | Ga0500595_014889_2260_2682 | 140 |
| 607 | 3300053120 | Ga0500597_168324 | Ga0500597_168324_481_909 | 140 |
| 608 | 3300053121 | Ga0500607_172486 | Ga0500607_172486_513_941 | 140 |
| 609 | 3300053123 | Ga0500614_017625 | Ga0500614_017625_848_1276 | 140 |
| 610 | 3300053128 | Ga0500626_207826 | Ga0500626_207826_262_690 | 140 |
| 611 | 3300053130 | Ga0500642_0050308 | Ga0500642_0050308_120_548 | 140 |
| 612 | 3300053131 | Ga0500652_089532 | Ga0500652_089532_414_842 | 140 |
| 613 | 3300053133 | Ga0500655_013484 | Ga0500655_013484_64_492 | 140 |
| 614 | 3300053134 | Ga0500658_0192750 | Ga0500658_0192750_483_911 | 140 |
| 615 | 3300053136 | Ga0500559_0021865 | Ga0500559_0021865_1362_1790 | 140 |
| 616 | 3300053136 | Ga0500559_0027456 | Ga0500559_0027456_760_1182 | 140 |
| 617 | 3300053138 | Ga0500564_120361 | Ga0500564_120361_276_704 | 140 |
| 618 | 3300053142 | Ga0500577_0065047 | Ga0500577_0065047_966_1394 | 140 |
| 619 | 3300053148 | Ga0500590_180118 | Ga0500590_180118_451_879 | 140 |
| 620 | 3300053153 | Ga0500616_0157975 | Ga0500616_0157975_175_603 | 140 |
| 621 | 3300053154 | Ga0500619_031309 | Ga0500619_031309_418_846 | 140 |
| 622 | 3300053155 | Ga0500620_048707 | Ga0500620_048707_656_1084 | 140 |
| 623 | 3300053162 | Ga0500638_142818 | Ga0500638_142818_123_551 | 140 |
| 624 | 3300053178 | Ga0500637_0060481 | Ga0500637_0060481_1269_1697 | 140 |
| 625 | 3300053724 | Ga0500570_131761 | Ga0500570_131761_371_799 | 140 |
| 626 | 3300053725 | Ga0500576_086011 | Ga0500576_086011_800_1228 | 140 |
| 627 | 3300053728 | Ga0500657_119870 | Ga0500657_119870_164_592 | 140 |
| 628 | 3300053729 | Ga0500625_040350 | Ga0500625_040350_1599_2027 | 140 |
| 629 | 3300053730 | Ga0500645_055611 | Ga0500645_055611_163_591 | 140 |
| 630 | 3300053733 | Ga0500552_013386 | Ga0500552_013386_123_551 | 140 |
| 631 | 3300053735 | Ga0500596_002487 | Ga0500596_002487_833_1261 | 140 |
| 632 | 3300055283 | Ga0500661_000027 | Ga0500661_000027_20717_21139 | 140 |
| 633 | 3300055283 | Ga0500661_029515 | Ga0500661_029515_120_548 | 140 |
| 634 | 3300061719 | Ga0466962_0118993 | Ga0466962_0118993_195_623 | 140 |
| 635 | 3300061719 | Ga0466962_0338855 | Ga0466962_0338855_76_498 | 140 |
| 636 | 3300061734 | Ga0530510_0977703 | Ga0530510_0977703_11_433 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6o3s-assembly1.cif.gz_A | nmr solution structure of luffin p1 | 0.7519 | 103 | 140 |
| 6dmx-assembly2.cif.gz_G | hbz56 in complex with kix and c-myb | 0.7369 | 93 | 139 |
| 2bc4-assembly2.cif.gz_D | crystal structure of hla-dm | 0.6435 | 8 | 32 |
| 6puz-assembly1.cif.gz_A | structure of hiv cleaved synaptic complex (csc) intasome bound with magnesium and insti xz446 (compound 4f) | 0.642 | 25 | 130 |
| 6o3s-assembly1.cif.gz_A | nmr solution structure of luffin p1 | 0.6294 | 103 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9FI63_292_491_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.8498 | 49 | 76 | 3.80.10.10 |
| af_Q9UAW8_52_341_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8423 | 49 | 78 | 3.20.20.190 |
| af_P96360_116_274_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.8256 | 2 | 131 | 3.90.180.10 |
| af_Q10049_64_320_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.7836 | 49 | 80 | 3.20.20.190 |
| af_P96360_116_274_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.7665 | 2 | 131 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A246U1Q3-F1-model_v4 | Transposase | 0.9227 | 13 | 139 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A258J2M2-F1-model_v4 | Uncharacterized protein | 0.9219 | 9 | 136 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A222E3F1-F1-model_v4 | Transposase DDE domain protein | 0.9166 | 9 | 130 |
GO:0016020
|
| AF-A0A1G1SSM7-F1-model_v4 | Transposase | 0.9149 | 9 | 135 |
|
| AF-A0A1G1SXX5-F1-model_v4 | Transposase IS4-like domain-containing protein | 0.9135 | 15 | 134 |
GO:0003677
GO:0004803 GO:0006313 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar