F471341

General Info

Members Datasets Scaffolds Average Seq Length
636 412 635 141

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_11317636|Ga0207693_113176361
Length 128
Sequence MGRSRGGLTTKIHAVVDADGLPIALKLTPGQAHDGRSADGLLESLDAGDILLADRGAWANIKPMPNRKNVPAFSAFLYRYRNLVECFFNRLKHFRAVATRYDKRDDNFLASVQLASIRIWLRHNESVT

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
236 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
241 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
242 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
243 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
247 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
248 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
338 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
354 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
370 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
371 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
372 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
378 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
379 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
380 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
381 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
382 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
383 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
386 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
387 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
388 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
389 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
390 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
391 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
392 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
399 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
400 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
403 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
404 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
405 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
406 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
409 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
410 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0
Rhizoplane 4.25
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10319136 3300003320 Bacteria 1322
2 JGI25405J52794_10148316 3300003911 Bacteria 534
3 Ga0070690_100395001 3300005330 Bacteria 1014
4 Ga0070670_101272407 3300005331 Bacteria 673
5 Ga0068869_100170591 3300005334 Bacteria 1699
6 Ga0070666_10134811 3300005335 Bacteria 1717
7 Ga0070666_10203354 3300005335 Bacteria 1393
8 Ga0070666_10468884 3300005335 Bacteria 911
9 Ga0068868_100232045 3300005338 Bacteria 1548
10 Ga0068868_100625599 3300005338 Bacteria 956
11 Ga0070660_100544555 3300005339 Bacteria 968
12 Ga0070689_100247915 3300005340 Bacteria 1469
13 Ga0070689_100445660 3300005340 Bacteria 1101
14 Ga0070691_10578150 3300005341 Bacteria 660
15 Ga0070687_100187038 3300005343 Bacteria 1245
16 Ga0070687_100264273 3300005343 Bacteria 1075
17 Ga0070661_100159912 3300005344 Bacteria 1706
18 Ga0070668_100404120 3300005347 Bacteria 1167
19 Ga0070669_100686740 3300005353 Bacteria 863
20 Ga0070675_100594931 3300005354 Bacteria 1003
21 Ga0070675_100708916 3300005354 Bacteria 917
22 Ga0070671_100389336 3300005355 Bacteria 1192
23 Ga0070674_100314372 3300005356 Bacteria 1253
24 Ga0070673_100282682 3300005364 Bacteria 1456
25 Ga0070688_100206560 3300005365 Bacteria 1377
26 Ga0070659_100423121 3300005366 Bacteria 1127
27 Ga0070667_100617351 3300005367 Bacteria 1000
28 Ga0070667_100893263 3300005367 Bacteria 827
29 Ga0070709_10331006 3300005434 Bacteria 1120
30 Ga0070714_100123094 3300005435 Bacteria 2309
31 Ga0070705_100238843 3300005440 Bacteria 1269
32 Ga0070700_100232014 3300005441 Bacteria 1314
33 Ga0070700_101354988 3300005441 Bacteria 600
34 Ga0070694_100393886 3300005444 Bacteria 1083
35 Ga0070663_100552616 3300005455 Bacteria 963
36 Ga0070678_100434545 3300005456 Bacteria 1147
37 Ga0070678_100456859 3300005456 Bacteria 1119
38 Ga0070662_100597875 3300005457 Bacteria 928
39 Ga0070662_100689140 3300005457 Bacteria 864
40 Ga0068867_100189581 3300005459 Bacteria 1640
41 Ga0068867_100350586 3300005459 Bacteria 1231
42 Ga0068867_100577234 3300005459 Bacteria 977
43 Ga0070685_10162681 3300005466 Bacteria 1424
44 Ga0070706_100489263 3300005467 Bacteria 1145
45 Ga0070707_101616538 3300005468 Bacteria 615
46 Ga0070698_100313401 3300005471 Bacteria 1500
47 Ga0070698_100643985 3300005471 Bacteria 1001
48 Ga0070679_100782721 3300005530 Bacteria 897
49 Ga0070697_100205007 3300005536 Bacteria 1677
50 Ga0070697_100540802 3300005536 Bacteria 1021
51 Ga0068853_100625321 3300005539 Bacteria 1024
52 Ga0068853_100797578 3300005539 Bacteria 904
53 Ga0068853_100855751 3300005539 Bacteria 872
54 Ga0070672_100397290 3300005543 Bacteria 1181
55 Ga0070672_100411862 3300005543 Bacteria 1160
56 Ga0070672_100707969 3300005543 Bacteria 882
57 Ga0070695_100688708 3300005545 Bacteria 810
58 Ga0070696_100471369 3300005546 Bacteria 994
59 Ga0070665_100435626 3300005548 Bacteria 1320
60 Ga0070665_101902417 3300005548 Bacteria 601
61 Ga0070704_100361859 3300005549 Bacteria 1228
62 Ga0068855_100793789 3300005563 Bacteria 1007
63 Ga0070664_100225810 3300005564 Bacteria 1677
64 Ga0068854_100320485 3300005578 Unclassified 1260
65 Ga0068856_101150740 3300005614 Bacteria 793
66 Ga0070702_100252822 3300005615 Bacteria 1195
67 Ga0070702_100341911 3300005615 Bacteria 1051
68 Ga0070702_100406835 3300005615 Bacteria 975
69 Ga0068852_100505776 3300005616 Bacteria 1204
70 Ga0068852_100616248 3300005616 Bacteria 1091
71 Ga0068852_100731478 3300005616 Bacteria 1001
72 Ga0068852_100808224 3300005616 Bacteria 952
73 Ga0068859_100244323 3300005617 Bacteria 1884
74 Ga0068864_100572369 3300005618 Bacteria 1094
75 Ga0068864_100856703 3300005618 Bacteria 896
76 Ga0068866_10186635 3300005718 Bacteria 1229
77 Ga0068866_10299707 3300005718 Bacteria 1003
78 Ga0068858_100346013 3300005842 Bacteria 1423
79 Ga0068860_100560266 3300005843 Bacteria 1145
80 Ga0068860_100872582 3300005843 Bacteria 915
81 Ga0068860_100938268 3300005843 Bacteria 882
82 Ga0068862_100312862 3300005844 Bacteria 1448
83 Ga0068862_101729899 3300005844 Bacteria 634
84 Ga0081455_10083951 3300005937 Bacteria 2601
85 Ga0081455_10304431 3300005937 Bacteria 1142
86 Ga0081538_10030964 3300005981 Bacteria 3619
87 Ga0081539_10164302 3300005985 Bacteria 1055
88 Ga0081539_10169805 3300005985 Bacteria 1032
89 Ga0081539_10385167 3300005985 Bacteria 584
90 Ga0070717_10369753 3300006028 Bacteria 1284
91 Ga0070717_10397643 3300006028 Bacteria 1237
92 Ga0075365_10338300 3300006038 Bacteria 1060
93 Ga0075368_10069558 3300006042 Bacteria 1420
94 Ga0075363_100167654 3300006048 Bacteria 1245
95 Ga0075432_10385126 3300006058 Bacteria 602
96 Ga0070715_10243337 3300006163 Bacteria 936
97 Ga0070716_100214425 3300006173 Bacteria 1289
98 Ga0075367_10095347 3300006178 Bacteria 1814
99 Ga0097621_100432146 3300006237 Bacteria 1183
100 Ga0068871_100355421 3300006358 Bacteria 1297
101 Ga0075430_100144437 3300006846 Bacteria 1981
102 Ga0068865_100370892 3300006881 Bacteria 1165
103 Ga0097620_100244335 3300006931 Bacteria 1884
104 Ga0105240_10390814 3300009093 Bacteria 1569
105 Ga0105240_10791253 3300009093 Bacteria 1028
106 Ga0111539_10570907 3300009094 Bacteria 1317
107 Ga0111539_11064239 3300009094 Bacteria 940
108 Ga0111539_11153486 3300009094 Bacteria 900
109 Ga0105245_10429144 3300009098 Bacteria 1326
110 Ga0105247_11592676 3300009101 Bacteria 536
111 Ga0105243_10093774 3300009148 Bacteria 2478
112 Ga0105243_10606818 3300009148 Bacteria 1054
113 Ga0105243_10658401 3300009148 Bacteria 1016
114 Ga0105243_10904623 3300009148 Bacteria 878
115 Ga0105241_10478520 3300009174 Bacteria 1106
116 Ga0105241_10516931 3300009174 Bacteria 1067
117 Ga0105242_10246042 3300009176 Bacteria 1610
118 Ga0105242_10554012 3300009176 Bacteria 1103
119 Ga0105242_11335881 3300009176 Bacteria 742
120 Ga0105248_10757025 3300009177 Bacteria 1096
121 Ga0105248_11124767 3300009177 Bacteria 888
122 Ga0105237_10374119 3300009545 Bacteria 1429
123 Ga0105238_10530280 3300009551 Bacteria 1181
124 Ga0105238_10754690 3300009551 Bacteria 987
125 Ga0105249_10329068 3300009553 Bacteria 1541
126 Ga0105249_12333153 3300009553 Bacteria 608
127 Ga0099796_10118101 3300010159 Bacteria 1016
128 Ga0105239_10771069 3300010375 Bacteria 1101
129 Ga0105239_10891467 3300010375 Bacteria 1021
130 Ga0105246_10342609 3300011119 Bacteria 1222
131 Ga0105246_10485202 3300011119 Bacteria 1046
132 Ga0157338_1005719 3300012515 Unclassified 1127
133 Ga0157369_10003558 3300013105 Bacteria 18510
134 Ga0157369_10522502 3300013105 Bacteria 1228
135 Ga0157378_10177412 3300013297 Bacteria 2002
136 Ga0157378_10450926 3300013297 Bacteria 1277
137 Ga0157378_10617084 3300013297 Bacteria 1097
138 Ga0163162_10419434 3300013306 Bacteria 1471
139 Ga0163162_10465644 3300013306 Bacteria 1395
140 Ga0163162_10671187 3300013306 Bacteria 1159
141 Ga0163162_12796065 3300013306 Bacteria 562
142 Ga0157375_10704517 3300013308 Bacteria 1163
143 Ga0163163_10790288 3300014325 Bacteria 1012
144 Ga0163163_11993983 3300014325 Bacteria 640
145 Ga0157380_10401638 3300014326 Bacteria 1300
146 Ga0157380_10422128 3300014326 Bacteria 1272
147 Ga0157377_10226864 3300014745 Bacteria 1199
148 Ga0157377_10454881 3300014745 Bacteria 885
149 Ga0157376_10592419 3300014969 Bacteria 1103
150 Ga0182007_10118846 3300015262 Bacteria 883
151 Ga0182005_1034174 3300015265 Bacteria 1383
152 Ga0163161_10497423 3300017792 Bacteria 992
153 Ga0213873_10027059 3300021358 Bacteria 1396
154 Ga0213872_10011011 3300021361 Bacteria 4290
155 Ga0213872_10030387 3300021361 Bacteria 2476
156 Ga0213872_10055944 3300021361 Bacteria 1787
157 Ga0213872_10149140 3300021361 Bacteria 1022
158 Ga0213874_10050111 3300021377 Bacteria 1278
159 Ga0213876_10023733 3300021384 Bacteria 3237
160 Ga0213876_10336794 3300021384 Bacteria 802
161 Ga0213875_10036016 3300021388 Bacteria 2333
162 Ga0213871_10027107 3300021441 Bacteria 1469
163 Ga0213871_10063017 3300021441 Bacteria 1035
164 Ga0207692_10270735 3300025898 Bacteria 1024
165 Ga0207642_10175029 3300025899 Bacteria 1164
166 Ga0207688_10273324 3300025901 Bacteria 1028
167 Ga0207680_10055136 3300025903 Bacteria 2394
168 Ga0207680_10204514 3300025903 Bacteria 1347
169 Ga0207680_10235222 3300025903 Bacteria 1260
170 Ga0207647_10119111 3300025904 Bacteria 1557
171 Ga0207685_10174967 3300025905 Bacteria 991
172 Ga0207699_10475628 3300025906 Bacteria 899
173 Ga0207645_10072709 3300025907 Bacteria 2201
174 Ga0207645_10073232 3300025907 Bacteria 2193
175 Ga0207643_10457882 3300025908 Bacteria 812
176 Ga0207654_10387519 3300025911 Bacteria 969
177 Ga0207707_10654465 3300025912 Bacteria 885
178 Ga0207695_10319174 3300025913 Bacteria 1443
179 Ga0207695_10702176 3300025913 Bacteria 892
180 Ga0207693_11317636 3300025915 Bacteria 539
181 Ga0207663_10017696 3300025916 Bacteria 3978
182 Ga0207662_10095938 3300025918 Bacteria 1831
183 Ga0207657_10313636 3300025919 Bacteria 1241
184 Ga0207657_10665675 3300025919 Bacteria 810
185 Ga0207649_10021569 3300025920 Bacteria 3710
186 Ga0207649_10573817 3300025920 Bacteria 865
187 Ga0207652_10475255 3300025921 Bacteria 1126
188 Ga0207681_10657595 3300025923 Bacteria 869
189 Ga0207694_11526876 3300025924 Bacteria 563
190 Ga0207650_10415149 3300025925 Bacteria 1116
191 Ga0207650_11171654 3300025925 Bacteria 654
192 Ga0207659_11008040 3300025926 Bacteria 716
193 Ga0207687_10696629 3300025927 Bacteria 862
194 Ga0207700_10474169 3300025928 Bacteria 1105
195 Ga0207706_10222117 3300025933 Bacteria 1654
196 Ga0207706_10599498 3300025933 Bacteria 946
197 Ga0207686_10123401 3300025934 Bacteria 1766
198 Ga0207686_10508584 3300025934 Bacteria 936
199 Ga0207709_10038008 3300025935 Bacteria 2863
200 Ga0207709_10554805 3300025935 Bacteria 904
201 Ga0207709_10628256 3300025935 Bacteria 853
202 Ga0207670_10569658 3300025936 Bacteria 927
203 Ga0207670_10632155 3300025936 Bacteria 881
204 Ga0207669_10437309 3300025937 Bacteria 1033
205 Ga0207669_10526105 3300025937 Bacteria 950
206 Ga0207704_10674911 3300025938 Bacteria 853
207 Ga0207665_10027888 3300025939 Bacteria 3730
208 Ga0207691_10174553 3300025940 Bacteria 1880
209 Ga0207691_10497434 3300025940 Bacteria 1035
210 Ga0207691_10498579 3300025940 Bacteria 1034
211 Ga0207711_10490292 3300025941 Bacteria 1145
212 Ga0207689_10542681 3300025942 Bacteria 976
213 Ga0207689_10589058 3300025942 Bacteria 935
214 Ga0207689_11100878 3300025942 Bacteria 670
215 Ga0207679_10645567 3300025945 Bacteria 957
216 Ga0207679_11028237 3300025945 Bacteria 755
217 Ga0207667_10716470 3300025949 Bacteria 1002
218 Ga0207651_11284221 3300025960 Bacteria 658
219 Ga0207712_10262193 3300025961 Bacteria 1402
220 Ga0207668_10797403 3300025972 Bacteria 836
221 Ga0207640_10599350 3300025981 Bacteria 932
222 Ga0207658_10623135 3300025986 Bacteria 971
223 Ga0207703_10362307 3300026035 Bacteria 1337
224 Ga0207639_10002990 3300026041 Bacteria 11380
225 Ga0207639_10657006 3300026041 Bacteria 970
226 Ga0207639_10766078 3300026041 Bacteria 898
227 Ga0207639_11849834 3300026041 Bacteria 564
228 Ga0207678_10444333 3300026067 Bacteria 1126
229 Ga0207678_11292257 3300026067 Bacteria 646
230 Ga0207708_10038597 3300026075 Bacteria 3638
231 Ga0207708_10310395 3300026075 Bacteria 1285
232 Ga0207702_10874174 3300026078 Bacteria 890
233 Ga0207641_10025835 3300026088 Bacteria 4843
234 Ga0207648_10541089 3300026089 Bacteria 1069
235 Ga0207648_10559031 3300026089 Bacteria 1052
236 Ga0207676_10505456 3300026095 Bacteria 1148
237 Ga0207676_11256590 3300026095 Bacteria 735
238 Ga0207674_11709402 3300026116 Bacteria 597
239 Ga0207675_100232312 3300026118 Bacteria 1780
240 Ga0207675_100657888 3300026118 Bacteria 1054
241 Ga0207683_10025033 3300026121 Bacteria 5146
242 Ga0207683_10615589 3300026121 Bacteria 1005
243 Ga0207683_10796843 3300026121 Bacteria 877
244 Ga0207683_11376328 3300026121 Bacteria 653
245 Ga0207698_10499738 3300026142 Bacteria 1183
246 Ga0207698_10991474 3300026142 Bacteria 850
247 Ga0207698_11306307 3300026142 Bacteria 740
248 Ga0209974_10228386 3300027876 Bacteria 695
249 Ga0268266_10436933 3300028379 Bacteria 1242
250 Ga0268266_10757470 3300028379 Bacteria 937
251 Ga0268265_10770703 3300028380 Bacteria 935
252 Ga0268265_10798719 3300028380 Bacteria 919
253 Ga0268264_11029626 3300028381 Bacteria 830
254 Ga0268264_11268438 3300028381 Bacteria 747
255 Ga0265326_10062338 3300028558 Bacteria 1054
256 Ga0265334_10192344 3300028573 Bacteria 710
257 Ga0265318_10100799 3300028577 Bacteria 1062
258 Ga0265338_10339643 3300028800 Bacteria 1082
259 Ga0265338_10709910 3300028800 Bacteria 693
260 Ga0265324_10086692 3300029957 Bacteria 1064
261 Ga0265330_10137848 3300031235 Bacteria 1037
262 Ga0265330_10189007 3300031235 Bacteria 872
263 Ga0265332_10164097 3300031238 Bacteria 927
264 Ga0265328_10100034 3300031239 Bacteria 1074
265 Ga0265328_10135239 3300031239 Bacteria 923
266 Ga0265320_10027217 3300031240 Bacteria 2984
267 Ga0265320_10145521 3300031240 Bacteria 1071
268 Ga0265325_10017004 3300031241 Bacteria 4053
269 Ga0265325_10183757 3300031241 Bacteria 972
270 Ga0265325_10210721 3300031241 Bacteria 892
271 Ga0265329_10075906 3300031242 Bacteria 1063
272 Ga0265329_10093342 3300031242 Bacteria 955
273 Ga0265329_10096743 3300031242 Bacteria 938
274 Ga0265340_10123751 3300031247 Bacteria 1188
275 Ga0265340_10137232 3300031247 Bacteria 1119
276 Ga0265340_10167051 3300031247 Bacteria 998
277 Ga0265339_10061812 3300031249 Bacteria 2014
278 Ga0265339_10142027 3300031249 Bacteria 1220
279 Ga0265339_10177780 3300031249 Bacteria 1061
280 Ga0265339_10336390 3300031249 Bacteria 714
281 Ga0265331_10007247 3300031250 Bacteria 6433
282 Ga0265331_10160903 3300031250 Bacteria 1017
283 Ga0265327_10124936 3300031251 Bacteria 1215
284 Ga0265316_10039062 3300031344 Bacteria 3815
285 Ga0265316_10244253 3300031344 Bacteria 1320
286 Ga0265316_10401175 3300031344 Bacteria 987
287 Ga0265316_10450361 3300031344 Bacteria 923
288 Ga0307513_10524425 3300031456 Bacteria 899
289 Ga0307408_100361649 3300031548 Bacteria 1235
290 Ga0265313_10005945 3300031595 Bacteria 8821
291 Ga0265313_10090117 3300031595 Bacteria 1378
292 Ga0265313_10098903 3300031595 Bacteria 1297
293 Ga0316579_10558170 3300031691 Bacteria 554
294 Ga0265314_10098058 3300031711 Bacteria 1891
295 Ga0265314_10166410 3300031711 Bacteria 1335
296 Ga0265314_10369479 3300031711 Bacteria 784
297 Ga0265342_10014539 3300031712 Bacteria 5222
298 Ga0265342_10062162 3300031712 Bacteria 2198
299 Ga0265342_10188212 3300031712 Bacteria 1127
300 Ga0265342_10253414 3300031712 Bacteria 938
301 Ga0307516_10557827 3300031730 Bacteria 799
302 Ga0307405_10371480 3300031731 Bacteria 1110
303 Ga0307405_10501645 3300031731 Bacteria 973
304 Ga0307413_10115514 3300031824 Bacteria 1806
305 Ga0307410_10220482 3300031852 Bacteria 1459
306 Ga0307410_10587364 3300031852 Bacteria 927
307 Ga0307406_10387754 3300031901 Bacteria 1103
308 Ga0307407_10365773 3300031903 Bacteria 1025
309 Ga0307407_10446227 3300031903 Bacteria 938
310 Ga0307412_10734072 3300031911 Bacteria 851
311 Ga0307409_100645660 3300031995 Bacteria 1051
312 Ga0307416_100236117 3300032002 Bacteria 1767
313 Ga0307416_100833847 3300032002 Bacteria 1019
314 Ga0307416_102053286 3300032002 Bacteria 674
315 Ga0307415_100461838 3300032126 Bacteria 1100
316 Ga0307415_101648258 3300032126 Bacteria 617
317 Ga0373948_0040224 3300034817 Bacteria 975
318 Ga0373950_0082247 3300034818 Unclassified 674
319 Ga0373934_0079607 3300035086 Bacteria 1316
320 Ga0373940_0222598 3300035088 Bacteria 627
321 Ga0373949_0064245 3300035090 Bacteria 950
322 Ga0373951_0053258 3300035091 Bacteria 999
323 Ga0373952_0066590 3300035092 Bacteria 892
324 Ga0373932_0131481 3300035112 Bacteria 844
325 Ga0373932_0243301 3300035112 Unclassified 654
326 Ga0373936_0173513 3300035113 Bacteria 943
327 Ga0373939_0122294 3300035114 Bacteria 919
328 Ga0373941_0080367 3300035115 Bacteria 1100
329 Ga0373945_0198780 3300035116 Bacteria 831
330 Ga0373956_0267646 3300035119 Bacteria 813
331 Ga0373960_0080931 3300035121 Bacteria 1022
332 Ga0373943_0135377 3300035170 Bacteria 1322
333 Ga0373943_0185957 3300035170 Bacteria 1144
334 Ga0373946_0187963 3300035171 Bacteria 983
335 Ga0373946_0744802 3300035171 Bacteria 514
336 Ga0373942_0073196 3300035207 Bacteria 1004
337 Ga0373961_0074216 3300035241 Bacteria 1058
338 Ga0373962_0041770 3300035242 Bacteria 1294
339 Ga0316574_0208120 3300035398 Bacteria 1255
340 Ga0373931_0168570 3300035691 Bacteria 1288
341 Ga0373935_0299873 3300035692 Bacteria 1135
342 Ga0373935_0558222 3300035692 Bacteria 835
343 Ga0373933_0215060 3300035724 Bacteria 1232
344 Ga0373947_0256137 3300035725 Bacteria 1158
345 Ga0373937_0613824 3300036401 Bacteria 1032
346 Ga0373937_0687320 3300036401 Bacteria 969
347 Ga0373937_1046627 3300036401 Bacteria 765
348 Ga0316582_1081620 3300036647 Bacteria 547
349 Ga0373925_0184893 3300037068 Bacteria 1651
350 Ga0373925_1371559 3300037068 Bacteria 579
351 Ga0395898_1209316 3300037466 Bacteria 687
352 Ga0395905_0327147 3300037471 Bacteria 1423
353 Ga0395905_0443817 3300037471 Bacteria 1195
354 Ga0395905_0459040 3300037471 Bacteria 1172
355 Ga0436364_0176825 3300037853 Bacteria 1484
356 Ga0436364_0230566 3300037853 Bacteria 3539
357 Ga0436364_0751518 3300037853 Bacteria 1337
358 Ga0436364_1290285 3300037853 Bacteria 1187
359 Ga0436365_0304394 3300039437 Bacteria 1198
360 Ga0436365_0889978 3300039437 Bacteria 1324
361 Ga0436365_0916403 3300039437 Bacteria 1244
362 Ga0436365_0953019 3300039437 Bacteria 1244
363 Ga0436365_1038530 3300039437 Bacteria 1160
364 Ga0436365_1543867 3300039437 Bacteria 1120
365 Ga0436365_1796423 3300039437 Bacteria 1667
366 Ga0436360_0084886 3300039438 Bacteria 2542
367 Ga0436360_0190664 3300039438 Bacteria 1533
368 Ga0436360_0300747 3300039438 Bacteria 627
369 Ga0436360_0380265 3300039438 Bacteria 1350
370 Ga0436360_0954986 3300039438 Bacteria 1332
371 Ga0436360_1090570 3300039438 Bacteria 548
372 Ga0436360_1281300 3300039438 Bacteria 885
373 Ga0436361_0144288 3300039447 Bacteria 4080
374 Ga0436361_0224788 3300039447 Bacteria 1829
375 Ga0436361_0323478 3300039447 Bacteria 793
376 Ga0436361_0369523 3300039447 Bacteria 1092
377 Ga0436361_0598041 3300039447 Bacteria 1167
378 Ga0436361_0658187 3300039447 Bacteria 2014
379 Ga0436361_1064448 3300039447 Bacteria 11122
380 Ga0436363_0191444 3300039450 Bacteria 1044
381 Ga0436363_1078731 3300039450 Bacteria 1763
382 Ga0436363_1141193 3300039450 Bacteria 1136
383 Ga0436362_0300804 3300039453 Bacteria 1832
384 Ga0436362_1204039 3300039453 Bacteria 798
385 Ga0439466_0055649 3300041411 Bacteria 1285
386 Ga0439465_0190882 3300041413 Bacteria 744
387 Ga0439465_0199016 3300041413 Bacteria 729
388 Ga0439465_0356782 3300041413 Bacteria 553
389 Ga0451793_1106380 3300041452 Bacteria 754
390 Ga0451797_0907562 3300041453 Bacteria 696
391 Ga0451798_1072412 3300041458 Bacteria 1061
392 Ga0451802_0228420 3300041460 Bacteria 624
393 Ga0451802_2096503 3300041460 Bacteria 1140
394 Ga0451807_1047851 3300041486 Bacteria 773
395 Ga0451837_1271536 3300041494 Bacteria 765
396 Ga0451837_1861520 3300041494 Bacteria 1016
397 Ga0451851_0809618 3300041507 Bacteria 970
398 Ga0451855_1985776 3300041511 Bacteria 941
399 Ga0451853_1763636 3300041512 Bacteria 706
400 Ga0439448_0067681 3300042005 Bacteria 1186
401 Ga0439450_008225 3300042008 Bacteria 1940
402 Ga0439454_003986 3300042011 Bacteria 1675
403 Ga0439457_005512 3300042014 Bacteria 3179
404 Ga0439463_099299 3300042016 Bacteria 750
405 Ga0450920_029371 3300042122 Bacteria 1079
406 Ga0450923_078411 3300042125 Bacteria 740
407 Ga0450923_095907 3300042125 Bacteria 680
408 Ga0450923_161470 3300042125 Bacteria 546
409 Ga0439434_0184347 3300042435 Bacteria 700
410 Ga0439459_0039346 3300042438 Bacteria 998
411 Ga0439460_0045690 3300042461 Bacteria 1299
412 Ga0439440_0079393 3300042993 Bacteria 865
413 Ga0466966_0188773 3300044684 Bacteria 1249
414 Ga0466971_0344004 3300044719 Bacteria 721
415 Ga0466968_0345083 3300044735 Bacteria 722
416 Ga0466957_0180413 3300044842 Bacteria 1379
417 Ga0451576_1414963 3300045051 Bacteria 723
418 Ga0466958_0326937 3300045836 Bacteria 986
419 Ga0466967_0610486 3300045976 Bacteria 1077
420 Ga0495592_0440415 3300046454 Bacteria 818
421 Ga0495592_0719637 3300046454 Bacteria 599
422 Ga0495629_0269178 3300046459 Bacteria 1170
423 Ga0495629_0773421 3300046459 Bacteria 634
424 Ga0495638_0156254 3300046460 Bacteria 1319
425 Ga0495651_0406577 3300046462 Bacteria 887
426 Ga0495580_0523499 3300046472 Bacteria 790
427 Ga0495639_0237519 3300046475 Bacteria 899
428 Ga0495662_0200179 3300046476 Bacteria 984
429 Ga0495585_0249918 3300046492 Bacteria 885
430 Ga0495594_0313736 3300046499 Bacteria 893
431 Ga0495594_0637008 3300046499 Bacteria 604
432 Ga0495596_0195999 3300046500 Bacteria 785
433 Ga0495607_0385885 3300046501 Bacteria 640
434 Ga0495583_0114819 3300046506 Bacteria 1138
435 Ga0495606_0157046 3300046507 Bacteria 1330
436 Ga0495606_0596240 3300046507 Bacteria 543
437 Ga0495608_0286731 3300046511 Bacteria 1021
438 Ga0495608_0684532 3300046511 Bacteria 611
439 Ga0495610_0037830 3300046512 Bacteria 2452
440 Ga0495618_0615618 3300046514 Bacteria 645
441 Ga0495620_0028952 3300046515 Bacteria 2569
442 Ga0495628_0295619 3300046516 Bacteria 1200
443 Ga0495628_0494126 3300046516 Bacteria 884
444 Ga0495628_0554331 3300046516 Bacteria 825
445 Ga0495628_0798800 3300046516 Bacteria 660
446 Ga0495630_0076143 3300046517 Bacteria 2528
447 Ga0495631_0142549 3300046518 Bacteria 1029
448 Ga0495637_0097273 3300046520 Bacteria 1154
449 Ga0495643_0057718 3300046522 Bacteria 2068
450 Ga0495648_0118632 3300046524 Bacteria 1426
451 Ga0495648_0195750 3300046524 Bacteria 1016
452 Ga0495642_0406611 3300046528 Bacteria 600
453 Ga0495652_0454922 3300046529 Bacteria 895
454 Ga0495654_0156105 3300046530 Bacteria 1005
455 Ga0495654_0300164 3300046530 Bacteria 656
456 Ga0495665_0199638 3300046531 Bacteria 1037
457 Ga0495640_0518561 3300046533 Bacteria 724
458 Ga0495640_0637923 3300046533 Bacteria 641
459 Ga0495586_0175465 3300046535 Bacteria 1211
460 Ga0495587_0313429 3300046536 Bacteria 876
461 Ga0495598_0055244 3300046537 Bacteria 1208
462 Ga0495609_0057679 3300046538 Bacteria 1718
463 Ga0495621_0033352 3300046539 Bacteria 1774
464 Ga0495621_0173680 3300046539 Bacteria 857
465 Ga0495597_0106827 3300046542 Bacteria 1176
466 Ga0495645_0364316 3300046543 Bacteria 928
467 Ga0495622_0013897 3300046557 Bacteria 3735
468 Ga0495622_0196348 3300046557 Bacteria 900
469 Ga0495633_0172675 3300046558 Bacteria 996
470 Ga0495667_0542919 3300046559 Bacteria 726
471 Ga0495656_0198473 3300046615 Bacteria 994
472 Ga0495656_0212596 3300046615 Bacteria 964
473 Ga0495611_0109267 3300046648 Bacteria 1287
474 Ga0495611_0124710 3300046648 Bacteria 1201
475 Ga0495625_0233537 3300046660 Bacteria 1200
476 Ga0495635_0364266 3300046663 Bacteria 963
477 Ga0495635_0564359 3300046663 Bacteria 745
478 Ga0495661_0260921 3300046665 Bacteria 880
479 Ga0495588_0161978 3300046674 Bacteria 1183
480 Ga0495657_0285616 3300046675 Bacteria 986
481 Ga0495599_0794622 3300046678 Bacteria 541
482 Ga0495623_0300527 3300046679 Bacteria 887
483 Ga0495646_0326846 3300046680 Bacteria 807
484 Ga0495658_0441121 3300046683 Bacteria 831
485 Ga0495669_0000800 3300046684 Bacteria 13438
486 Ga0495669_0181733 3300046684 Bacteria 1003
487 Ga0495613_0207949 3300046689 Bacteria 1377
488 Ga0495613_0292549 3300046689 Bacteria 1129
489 Ga0495613_0865850 3300046689 Bacteria 586
490 Ga0495624_0273916 3300046690 Bacteria 1019
491 Ga0495670_0094366 3300046691 Bacteria 1534
492 Ga0495670_0168579 3300046691 Bacteria 1152
493 Ga0495670_0233119 3300046691 Bacteria 979
494 Ga0495589_0022026 3300046794 Bacteria 3255
495 Ga0495600_0098708 3300046809 Bacteria 1904
496 Ga0495581_0186355 3300047315 Bacteria 1214
497 Ga0495581_0299695 3300047315 Bacteria 939
498 Ga0495581_0581964 3300047315 Bacteria 649
499 Ga0495674_0658061 3300047319 Bacteria 825
500 Ga0495672_0193675 3300047320 Bacteria 1020
501 Ga0495676_0166956 3300047321 Bacteria 1552
502 Ga0495680_0347372 3300047322 Bacteria 1033
503 Ga0495680_0800716 3300047322 Bacteria 615
504 Ga0495685_101958 3300047447 Bacteria 947
505 Ga0495673_0281080 3300047469 Bacteria 601
506 Ga0495684_0463122 3300047471 Bacteria 878
507 Ga0495684_0977560 3300047471 Bacteria 539
508 Ga0495686_0115490 3300047472 Bacteria 1605
509 Ga0495686_0212290 3300047472 Bacteria 1105
510 Ga0495686_0352657 3300047472 Bacteria 799
511 Ga0495593_0086707 3300047673 Bacteria 1614
512 Ga0495602_0211523 3300048088 Bacteria 1471
513 Ga0495602_0510171 3300048088 Bacteria 839
514 Ga0495602_0730835 3300048088 Bacteria 669
515 Ga0495615_0122441 3300048090 Bacteria 753
516 Ga0496101_0329113 3300048904 Bacteria 1199
517 Ga0496101_0564936 3300048904 Bacteria 899
518 Ga0496103_0648828 3300048906 Bacteria 671
519 Ga0496104_0079097 3300048907 Bacteria 3134
520 Ga0496104_0627271 3300048907 Bacteria 984
521 Ga0496105_0219128 3300048908 Bacteria 1549
522 Ga0496106_1146568 3300048909 Bacteria 608
523 Ga0496107_0364491 3300048910 Bacteria 1075
524 Ga0496107_0462040 3300048910 Bacteria 942
525 Ga0496108_0535968 3300048911 Bacteria 1022
526 Ga0496108_1082232 3300048911 Bacteria 682
527 Ga0496108_1233434 3300048911 Bacteria 631
528 Ga0496109_0891407 3300048912 Bacteria 827
529 Ga0496109_1366763 3300048912 Bacteria 644
530 Ga0496110_0495233 3300048913 Bacteria 1113
531 Ga0496110_0910663 3300048913 Bacteria 785
532 Ga0496111_0123786 3300048914 Bacteria 1911
533 Ga0496111_0199965 3300048914 Bacteria 1486
534 Ga0496113_0190978 3300048916 Bacteria 1626
535 Ga0496114_0499232 3300048917 Bacteria 1076
536 Ga0496115_0645202 3300048918 Bacteria 837
537 Ga0496126_0056847 3300048929 Bacteria 3535
538 Ga0495682_0101372 3300049460 Bacteria 1032
539 Ga0501291_056109 3300049514 Bacteria 729
540 Ga0501032_0043367 3300049569 Bacteria 3047
541 Ga0501034_0300621 3300049571 Bacteria 1541
542 Ga0501034_0506316 3300049571 Bacteria 1121
543 Ga0501036_1434049 3300049572 Bacteria 559
544 Ga0501039_0085948 3300049575 Bacteria 2450
545 Ga0501039_1127796 3300049575 Bacteria 607
546 Ga0501039_1500613 3300049575 Bacteria 518
547 Ga0501041_0698244 3300049577 Bacteria 649
548 Ga0501042_0346416 3300049578 Bacteria 1074
549 Ga0501042_0368060 3300049578 Bacteria 1040
550 Ga0501046_0087055 3300049580 Bacteria 2408
551 Ga0501046_0163676 3300049580 Bacteria 1672
552 Ga0501047_0464319 3300049581 Bacteria 1094
553 Ga0501047_0602153 3300049581 Bacteria 920
554 Ga0501047_0893176 3300049581 Bacteria 702
555 Ga0501048_0421845 3300049582 Bacteria 954
556 Ga0501069_0636638 3300049585 Bacteria 641
557 Ga0501072_0188075 3300049588 Bacteria 1647
558 Ga0501073_0002968 3300049589 Bacteria 12720
559 Ga0501073_0336866 3300049589 Bacteria 1041
560 Ga0501075_0172089 3300049591 Bacteria 1653
561 Ga0501076_0139064 3300049592 Bacteria 1972
562 Ga0501223_003421 3300049663 Bacteria 3461
563 Ga0501235_050712 3300049669 Bacteria 961
564 Ga0501235_176894 3300049669 Bacteria 567
565 Ga0501081_1414408 3300049743 Bacteria 528
566 Ga0501083_0361065 3300049744 Bacteria 944
567 Ga0501035_0222464 3300049822 Bacteria 1611
568 Ga0501035_0251764 3300049822 Bacteria 1500
569 Ga0501035_0533880 3300049822 Bacteria 962
570 Ga0501044_0533368 3300049823 Bacteria 1072
571 Ga0501044_0598238 3300049823 Bacteria 996
572 Ga0501044_1145109 3300049823 Bacteria 646
573 Ga0501045_1004770 3300049824 Bacteria 612
574 nmdc:mga0yw44_207093_c1 3300050492 Bacteria 1297
575 nmdc:mga0yw44_404114_c1 3300050492 Bacteria 924
576 nmdc:mga04h51_294592_c1 3300050495 Bacteria 660
577 nmdc:mga06r32_353164_c1 3300050510 Bacteria 1454
578 nmdc:mga08y16_93425_c1 3300050511 Bacteria 3134
579 nmdc:mga08y16_990725_c1 3300050511 Bacteria 821
580 Ga0495601_0084814 3300053077 Bacteria 2035
581 Ga0495601_0289352 3300053077 Bacteria 1068
582 Ga0495601_0290115 3300053077 Bacteria 1066
583 Ga0495612_0091456 3300053078 Bacteria 1288
584 Ga0495655_0009621 3300053083 Bacteria 1881
585 Ga0495595_0129533 3300053084 Bacteria 1232
586 Ga0495619_0422551 3300053085 Bacteria 919
587 Ga0495619_0468602 3300053085 Bacteria 867
588 Ga0500578_0097481 3300053086 Bacteria 1863
589 Ga0500643_042125 3300053087 Bacteria 1338
590 Ga0500644_0495263 3300053088 Bacteria 537
591 Ga0500647_0170669 3300053091 Bacteria 1004
592 Ga0500583_0157084 3300053092 Bacteria 1132
593 Ga0500651_0247053 3300053093 Bacteria 1038
594 Ga0500566_0200894 3300053094 Bacteria 1006
595 Ga0500641_0141420 3300053096 Bacteria 1040
596 Ga0500555_067353 3300053103 Bacteria 951
597 Ga0500556_0000097 3300053104 Bacteria 81329
598 Ga0500556_0015300 3300053104 Bacteria 2363
599 Ga0500569_004219 3300053109 Bacteria 3008
600 Ga0500572_061630 3300053111 Bacteria 1141
601 Ga0500591_121315 3300053115 Bacteria 1074
602 Ga0500592_006928 3300053116 Bacteria 1803
603 Ga0500593_132824 3300053117 Bacteria 991
604 Ga0500595_014889 3300053119 Bacteria 2938
605 Ga0500597_168324 3300053120 Bacteria 934
606 Ga0500607_172486 3300053121 Bacteria 971
607 Ga0500614_017625 3300053123 Bacteria 1616
608 Ga0500626_207826 3300053128 Bacteria 765
609 Ga0500642_0050308 3300053130 Bacteria 1836
610 Ga0500652_089532 3300053131 Bacteria 1285
611 Ga0500655_013484 3300053133 Bacteria 1492
612 Ga0500658_0192750 3300053134 Bacteria 930
613 Ga0500559_0021865 3300053136 Bacteria 2713
614 Ga0500559_0027456 3300053136 Bacteria 2429
615 Ga0500564_120361 3300053138 Bacteria 1144
616 Ga0500577_0065047 3300053142 Bacteria 1414
617 Ga0500590_180118 3300053148 Bacteria 918
618 Ga0500616_0157975 3300053153 Bacteria 1042
619 Ga0500619_031309 3300053154 Bacteria 1622
620 Ga0500620_048707 3300053155 Bacteria 1414
621 Ga0500638_142818 3300053162 Bacteria 1073
622 Ga0500636_0519610 3300053177 Bacteria 521
623 Ga0500637_0060481 3300053178 Bacteria 2169
624 Ga0500570_131761 3300053724 Bacteria 947
625 Ga0500576_086011 3300053725 Bacteria 1316
626 Ga0500657_119870 3300053728 Bacteria 1044
627 Ga0500625_040350 3300053729 Bacteria 2197
628 Ga0500645_055611 3300053730 Bacteria 1149
629 Ga0500552_013386 3300053733 Bacteria 1064
630 Ga0500596_002487 3300053735 Bacteria 3634
631 Ga0500661_000027 3300055283 Bacteria 21947
632 Ga0500661_029515 3300055283 Bacteria 967
633 Ga0466962_0118993 3300061719 Bacteria 1274
634 Ga0466962_0338855 3300061719 Bacteria 748
635 Ga0530510_0977703 3300061734 Bacteria 647

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0002968 Ga0501073_0002968_2961_3458 113
2 3300048910 Ga0496107_0462040 Ga0496107_0462040_436_828 124
3 3300005843 Ga0068860_100938268 Ga0068860_1009382682 125
4 3300026067 Ga0207678_11292257 Ga0207678_112922572 125
5 3300035112 Ga0373932_0131481 Ga0373932_0131481_314_742 125
6 3300039438 Ga0436360_0380265 Ga0436360_0380265_462_890 125
7 3300053177 Ga0500636_0519610 Ga0500636_0519610_123_506 125
8 3300005459 Ga0068867_100577234 Ga0068867_1005772341 126
9 3300005718 Ga0068866_10299707 Ga0068866_102997072 126
10 3300025907 Ga0207645_10073232 Ga0207645_100732322 126
11 3300025915 Ga0207693_11317636 Ga0207693_113176361 126
12 3300046648 Ga0495611_0124710 Ga0495611_0124710_514_900 126
13 3300021361 Ga0213872_10030387 Ga0213872_100303873 133
14 3300031711 Ga0265314_10098058 Ga0265314_100980584 133
15 3300039447 Ga0436361_1064448 Ga0436361_1064448_10369_10776 133
16 3300046517 Ga0495630_0076143 Ga0495630_0076143_329_751 134
17 3300005367 Ga0070667_100617351 Ga0070667_1006173512 135
18 3300005536 Ga0070697_100540802 Ga0070697_1005408023 135
19 3300026121 Ga0207683_11376328 Ga0207683_113763281 137
20 3300013306 Ga0163162_10419434 Ga0163162_104194343 138
21 3300031691 Ga0316579_10558170 Ga0316579_105581702 138
22 3300048913 Ga0496110_0910663 Ga0496110_0910663_330_746 138
23 3300048914 Ga0496111_0123786 Ga0496111_0123786_433_849 138
24 3300049585 Ga0501069_0636638 Ga0501069_0636638_207_623 138
25 3300003320 rootH2_10319136 rootH2_103191363 140
26 3300003911 JGI25405J52794_10148316 JGI25405J52794_101483161 140
27 3300005330 Ga0070690_100395001 Ga0070690_1003950011 140
28 3300005331 Ga0070670_101272407 Ga0070670_1012724071 140
29 3300005334 Ga0068869_100170591 Ga0068869_1001705912 140
30 3300005335 Ga0070666_10134811 Ga0070666_101348111 140
31 3300005335 Ga0070666_10203354 Ga0070666_102033542 140
32 3300005335 Ga0070666_10468884 Ga0070666_104688842 140
33 3300005338 Ga0068868_100232045 Ga0068868_1002320453 140
34 3300005338 Ga0068868_100625599 Ga0068868_1006255992 140
35 3300005339 Ga0070660_100544555 Ga0070660_1005445552 140
36 3300005340 Ga0070689_100247915 Ga0070689_1002479152 140
37 3300005340 Ga0070689_100445660 Ga0070689_1004456602 140
38 3300005341 Ga0070691_10578150 Ga0070691_105781501 140
39 3300005343 Ga0070687_100187038 Ga0070687_1001870382 140
40 3300005343 Ga0070687_100264273 Ga0070687_1002642732 140
41 3300005344 Ga0070661_100159912 Ga0070661_1001599122 140
42 3300005347 Ga0070668_100404120 Ga0070668_1004041202 140
43 3300005353 Ga0070669_100686740 Ga0070669_1006867402 140
44 3300005354 Ga0070675_100594931 Ga0070675_1005949312 140
45 3300005354 Ga0070675_100708916 Ga0070675_1007089161 140
46 3300005355 Ga0070671_100389336 Ga0070671_1003893362 140
47 3300005356 Ga0070674_100314372 Ga0070674_1003143723 140
48 3300005364 Ga0070673_100282682 Ga0070673_1002826822 140
49 3300005365 Ga0070688_100206560 Ga0070688_1002065601 140
50 3300005366 Ga0070659_100423121 Ga0070659_1004231212 140
51 3300005367 Ga0070667_100893263 Ga0070667_1008932631 140
52 3300005434 Ga0070709_10331006 Ga0070709_103310062 140
53 3300005435 Ga0070714_100123094 Ga0070714_1001230942 140
54 3300005440 Ga0070705_100238843 Ga0070705_1002388431 140
55 3300005441 Ga0070700_100232014 Ga0070700_1002320142 140
56 3300005441 Ga0070700_101354988 Ga0070700_1013549881 140
57 3300005444 Ga0070694_100393886 Ga0070694_1003938862 140
58 3300005455 Ga0070663_100552616 Ga0070663_1005526162 140
59 3300005456 Ga0070678_100434545 Ga0070678_1004345452 140
60 3300005456 Ga0070678_100456859 Ga0070678_1004568592 140
61 3300005457 Ga0070662_100597875 Ga0070662_1005978752 140
62 3300005457 Ga0070662_100689140 Ga0070662_1006891402 140
63 3300005459 Ga0068867_100189581 Ga0068867_1001895812 140
64 3300005459 Ga0068867_100350586 Ga0068867_1003505862 140
65 3300005466 Ga0070685_10162681 Ga0070685_101626812 140
66 3300005467 Ga0070706_100489263 Ga0070706_1004892632 140
67 3300005468 Ga0070707_101616538 Ga0070707_1016165381 140
68 3300005471 Ga0070698_100313401 Ga0070698_1003134013 140
69 3300005471 Ga0070698_100643985 Ga0070698_1006439852 140
70 3300005530 Ga0070679_100782721 Ga0070679_1007827211 140
71 3300005536 Ga0070697_100205007 Ga0070697_1002050074 140
72 3300005539 Ga0068853_100625321 Ga0068853_1006253211 140
73 3300005539 Ga0068853_100797578 Ga0068853_1007975782 140
74 3300005539 Ga0068853_100855751 Ga0068853_1008557511 140
75 3300005543 Ga0070672_100397290 Ga0070672_1003972902 140
76 3300005543 Ga0070672_100411862 Ga0070672_1004118622 140
77 3300005543 Ga0070672_100707969 Ga0070672_1007079692 140
78 3300005545 Ga0070695_100688708 Ga0070695_1006887081 140
79 3300005546 Ga0070696_100471369 Ga0070696_1004713692 140
80 3300005548 Ga0070665_100435626 Ga0070665_1004356262 140
81 3300005548 Ga0070665_101902417 Ga0070665_1019024171 140
82 3300005549 Ga0070704_100361859 Ga0070704_1003618592 140
83 3300005563 Ga0068855_100793789 Ga0068855_1007937892 140
84 3300005564 Ga0070664_100225810 Ga0070664_1002258105 140
85 3300005578 Ga0068854_100320485 Ga0068854_1003204853 140
86 3300005614 Ga0068856_101150740 Ga0068856_1011507401 140
87 3300005615 Ga0070702_100252822 Ga0070702_1002528222 140
88 3300005615 Ga0070702_100341911 Ga0070702_1003419112 140
89 3300005615 Ga0070702_100406835 Ga0070702_1004068352 140
90 3300005616 Ga0068852_100505776 Ga0068852_1005057762 140
91 3300005616 Ga0068852_100616248 Ga0068852_1006162481 140
92 3300005616 Ga0068852_100731478 Ga0068852_1007314781 140
93 3300005616 Ga0068852_100808224 Ga0068852_1008082241 140
94 3300005617 Ga0068859_100244323 Ga0068859_1002443232 140
95 3300005618 Ga0068864_100572369 Ga0068864_1005723692 140
96 3300005618 Ga0068864_100856703 Ga0068864_1008567031 140
97 3300005718 Ga0068866_10186635 Ga0068866_101866352 140
98 3300005842 Ga0068858_100346013 Ga0068858_1003460133 140
99 3300005843 Ga0068860_100560266 Ga0068860_1005602663 140
100 3300005843 Ga0068860_100872582 Ga0068860_1008725822 140
101 3300005844 Ga0068862_100312862 Ga0068862_1003128622 140
102 3300005844 Ga0068862_101729899 Ga0068862_1017298991 140
103 3300005937 Ga0081455_10083951 Ga0081455_100839513 140
104 3300005937 Ga0081455_10304431 Ga0081455_103044312 140
105 3300005981 Ga0081538_10030964 Ga0081538_100309642 140
106 3300005985 Ga0081539_10164302 Ga0081539_101643022 140
107 3300005985 Ga0081539_10169805 Ga0081539_101698053 140
108 3300005985 Ga0081539_10385167 Ga0081539_103851671 140
109 3300006028 Ga0070717_10369753 Ga0070717_103697532 140
110 3300006028 Ga0070717_10397643 Ga0070717_103976432 140
111 3300006038 Ga0075365_10338300 Ga0075365_103383001 140
112 3300006042 Ga0075368_10069558 Ga0075368_100695582 140
113 3300006048 Ga0075363_100167654 Ga0075363_1001676541 140
114 3300006058 Ga0075432_10385126 Ga0075432_103851262 140
115 3300006163 Ga0070715_10243337 Ga0070715_102433372 140
116 3300006173 Ga0070716_100214425 Ga0070716_1002144253 140
117 3300006178 Ga0075367_10095347 Ga0075367_100953474 140
118 3300006237 Ga0097621_100432146 Ga0097621_1004321463 140
119 3300006358 Ga0068871_100355421 Ga0068871_1003554213 140
120 3300006846 Ga0075430_100144437 Ga0075430_1001444374 140
121 3300006881 Ga0068865_100370892 Ga0068865_1003708922 140
122 3300006931 Ga0097620_100244335 Ga0097620_1002443352 140
123 3300009093 Ga0105240_10390814 Ga0105240_103908142 140
124 3300009093 Ga0105240_10791253 Ga0105240_107912531 140
125 3300009094 Ga0111539_10570907 Ga0111539_105709073 140
126 3300009094 Ga0111539_11064239 Ga0111539_110642391 140
127 3300009094 Ga0111539_11153486 Ga0111539_111534862 140
128 3300009098 Ga0105245_10429144 Ga0105245_104291441 140
129 3300009101 Ga0105247_11592676 Ga0105247_115926761 140
130 3300009148 Ga0105243_10093774 Ga0105243_100937741 140
131 3300009148 Ga0105243_10606818 Ga0105243_106068182 140
132 3300009148 Ga0105243_10658401 Ga0105243_106584011 140
133 3300009148 Ga0105243_10904623 Ga0105243_109046231 140
134 3300009174 Ga0105241_10478520 Ga0105241_104785201 140
135 3300009174 Ga0105241_10516931 Ga0105241_105169312 140
136 3300009176 Ga0105242_10246042 Ga0105242_102460422 140
137 3300009176 Ga0105242_10554012 Ga0105242_105540123 140
138 3300009176 Ga0105242_11335881 Ga0105242_113358811 140
139 3300009177 Ga0105248_10757025 Ga0105248_107570252 140
140 3300009177 Ga0105248_11124767 Ga0105248_111247672 140
141 3300009545 Ga0105237_10374119 Ga0105237_103741192 140
142 3300009551 Ga0105238_10530280 Ga0105238_105302802 140
143 3300009551 Ga0105238_10754690 Ga0105238_107546901 140
144 3300009553 Ga0105249_10329068 Ga0105249_103290682 140
145 3300009553 Ga0105249_12333153 Ga0105249_123331531 140
146 3300010159 Ga0099796_10118101 Ga0099796_101181013 140
147 3300010375 Ga0105239_10771069 Ga0105239_107710691 140
148 3300010375 Ga0105239_10891467 Ga0105239_108914673 140
149 3300011119 Ga0105246_10342609 Ga0105246_103426091 140
150 3300011119 Ga0105246_10485202 Ga0105246_104852021 140
151 3300012515 Ga0157338_1005719 Ga0157338_10057193 140
152 3300013105 Ga0157369_10003558 Ga0157369_1000355817 140
153 3300013105 Ga0157369_10522502 Ga0157369_105225022 140
154 3300013297 Ga0157378_10177412 Ga0157378_101774124 140
155 3300013297 Ga0157378_10450926 Ga0157378_104509263 140
156 3300013297 Ga0157378_10617084 Ga0157378_106170841 140
157 3300013306 Ga0163162_10465644 Ga0163162_104656441 140
158 3300013306 Ga0163162_10671187 Ga0163162_106711873 140
159 3300013306 Ga0163162_12796065 Ga0163162_127960652 140
160 3300013308 Ga0157375_10704517 Ga0157375_107045172 140
161 3300014325 Ga0163163_10790288 Ga0163163_107902882 140
162 3300014325 Ga0163163_11993983 Ga0163163_119939832 140
163 3300014326 Ga0157380_10401638 Ga0157380_104016383 140
164 3300014326 Ga0157380_10422128 Ga0157380_104221282 140
165 3300014745 Ga0157377_10226864 Ga0157377_102268642 140
166 3300014745 Ga0157377_10454881 Ga0157377_104548811 140
167 3300014969 Ga0157376_10592419 Ga0157376_105924192 140
168 3300015262 Ga0182007_10118846 Ga0182007_101188461 140
169 3300015265 Ga0182005_1034174 Ga0182005_10341743 140
170 3300017792 Ga0163161_10497423 Ga0163161_104974232 140
171 3300021358 Ga0213873_10027059 Ga0213873_100270591 140
172 3300021361 Ga0213872_10011011 Ga0213872_100110114 140
173 3300021361 Ga0213872_10055944 Ga0213872_100559441 140
174 3300021361 Ga0213872_10149140 Ga0213872_101491402 140
175 3300021377 Ga0213874_10050111 Ga0213874_100501111 140
176 3300021384 Ga0213876_10023733 Ga0213876_100237332 140
177 3300021384 Ga0213876_10336794 Ga0213876_103367942 140
178 3300021388 Ga0213875_10036016 Ga0213875_100360162 140
179 3300021441 Ga0213871_10027107 Ga0213871_100271072 140
180 3300021441 Ga0213871_10063017 Ga0213871_100630173 140
181 3300025898 Ga0207692_10270735 Ga0207692_102707351 140
182 3300025899 Ga0207642_10175029 Ga0207642_101750292 140
183 3300025901 Ga0207688_10273324 Ga0207688_102733242 140
184 3300025903 Ga0207680_10055136 Ga0207680_100551363 140
185 3300025903 Ga0207680_10204514 Ga0207680_102045141 140
186 3300025903 Ga0207680_10235222 Ga0207680_102352222 140
187 3300025904 Ga0207647_10119111 Ga0207647_101191112 140
188 3300025905 Ga0207685_10174967 Ga0207685_101749673 140
189 3300025906 Ga0207699_10475628 Ga0207699_104756281 140
190 3300025907 Ga0207645_10072709 Ga0207645_100727092 140
191 3300025908 Ga0207643_10457882 Ga0207643_104578821 140
192 3300025911 Ga0207654_10387519 Ga0207654_103875192 140
193 3300025912 Ga0207707_10654465 Ga0207707_106544652 140
194 3300025913 Ga0207695_10319174 Ga0207695_103191742 140
195 3300025913 Ga0207695_10702176 Ga0207695_107021762 140
196 3300025916 Ga0207663_10017696 Ga0207663_100176965 140
197 3300025918 Ga0207662_10095938 Ga0207662_100959383 140
198 3300025919 Ga0207657_10313636 Ga0207657_103136361 140
199 3300025919 Ga0207657_10665675 Ga0207657_106656751 140
200 3300025920 Ga0207649_10021569 Ga0207649_100215694 140
201 3300025920 Ga0207649_10573817 Ga0207649_105738172 140
202 3300025921 Ga0207652_10475255 Ga0207652_104752551 140
203 3300025923 Ga0207681_10657595 Ga0207681_106575952 140
204 3300025924 Ga0207694_11526876 Ga0207694_115268761 140
205 3300025925 Ga0207650_10415149 Ga0207650_104151493 140
206 3300025925 Ga0207650_11171654 Ga0207650_111716541 140
207 3300025926 Ga0207659_11008040 Ga0207659_110080401 140
208 3300025927 Ga0207687_10696629 Ga0207687_106966291 140
209 3300025928 Ga0207700_10474169 Ga0207700_104741692 140
210 3300025933 Ga0207706_10222117 Ga0207706_102221173 140
211 3300025933 Ga0207706_10599498 Ga0207706_105994982 140
212 3300025934 Ga0207686_10123401 Ga0207686_101234012 140
213 3300025934 Ga0207686_10508584 Ga0207686_105085842 140
214 3300025935 Ga0207709_10038008 Ga0207709_100380082 140
215 3300025935 Ga0207709_10554805 Ga0207709_105548051 140
216 3300025935 Ga0207709_10628256 Ga0207709_106282562 140
217 3300025936 Ga0207670_10569658 Ga0207670_105696581 140
218 3300025936 Ga0207670_10632155 Ga0207670_106321552 140
219 3300025937 Ga0207669_10437309 Ga0207669_104373092 140
220 3300025937 Ga0207669_10526105 Ga0207669_105261052 140
221 3300025938 Ga0207704_10674911 Ga0207704_106749112 140
222 3300025939 Ga0207665_10027888 Ga0207665_100278885 140
223 3300025940 Ga0207691_10174553 Ga0207691_101745531 140
224 3300025940 Ga0207691_10174553 Ga0207691_101745533 140
225 3300025940 Ga0207691_10497434 Ga0207691_104974342 140
226 3300025940 Ga0207691_10498579 Ga0207691_104985792 140
227 3300025941 Ga0207711_10490292 Ga0207711_104902923 140
228 3300025942 Ga0207689_10542681 Ga0207689_105426811 140
229 3300025942 Ga0207689_10589058 Ga0207689_105890582 140
230 3300025942 Ga0207689_11100878 Ga0207689_111008781 140
231 3300025945 Ga0207679_10645567 Ga0207679_106455671 140
232 3300025945 Ga0207679_11028237 Ga0207679_110282371 140
233 3300025949 Ga0207667_10716470 Ga0207667_107164702 140
234 3300025960 Ga0207651_11284221 Ga0207651_112842211 140
235 3300025961 Ga0207712_10262193 Ga0207712_102621932 140
236 3300025972 Ga0207668_10797403 Ga0207668_107974032 140
237 3300025981 Ga0207640_10599350 Ga0207640_105993502 140
238 3300025986 Ga0207658_10623135 Ga0207658_106231352 140
239 3300026035 Ga0207703_10362307 Ga0207703_103623073 140
240 3300026041 Ga0207639_10002990 Ga0207639_100029904 140
241 3300026041 Ga0207639_10657006 Ga0207639_106570062 140
242 3300026041 Ga0207639_10766078 Ga0207639_107660782 140
243 3300026041 Ga0207639_11849834 Ga0207639_118498341 140
244 3300026067 Ga0207678_10444333 Ga0207678_104443333 140
245 3300026075 Ga0207708_10038597 Ga0207708_100385973 140
246 3300026075 Ga0207708_10310395 Ga0207708_103103952 140
247 3300026078 Ga0207702_10874174 Ga0207702_108741741 140
248 3300026088 Ga0207641_10025835 Ga0207641_100258359 140
249 3300026089 Ga0207648_10541089 Ga0207648_105410891 140
250 3300026089 Ga0207648_10559031 Ga0207648_105590311 140
251 3300026095 Ga0207676_10505456 Ga0207676_105054562 140
252 3300026095 Ga0207676_11256590 Ga0207676_112565902 140
253 3300026116 Ga0207674_11709402 Ga0207674_117094022 140
254 3300026118 Ga0207675_100232312 Ga0207675_1002323122 140
255 3300026118 Ga0207675_100657888 Ga0207675_1006578881 140
256 3300026121 Ga0207683_10025033 Ga0207683_100250336 140
257 3300026121 Ga0207683_10615589 Ga0207683_106155891 140
258 3300026121 Ga0207683_10796843 Ga0207683_107968432 140
259 3300026142 Ga0207698_10499738 Ga0207698_104997382 140
260 3300026142 Ga0207698_10991474 Ga0207698_109914741 140
261 3300026142 Ga0207698_11306307 Ga0207698_113063072 140
262 3300027876 Ga0209974_10228386 Ga0209974_102283861 140
263 3300028379 Ga0268266_10436933 Ga0268266_104369333 140
264 3300028379 Ga0268266_10757470 Ga0268266_107574702 140
265 3300028380 Ga0268265_10770703 Ga0268265_107707031 140
266 3300028380 Ga0268265_10798719 Ga0268265_107987192 140
267 3300028381 Ga0268264_11029626 Ga0268264_110296261 140
268 3300028381 Ga0268264_11268438 Ga0268264_112684382 140
269 3300028558 Ga0265326_10062338 Ga0265326_100623382 140
270 3300028573 Ga0265334_10192344 Ga0265334_101923441 140
271 3300028577 Ga0265318_10100799 Ga0265318_101007992 140
272 3300028800 Ga0265338_10339643 Ga0265338_103396432 140
273 3300028800 Ga0265338_10709910 Ga0265338_107099102 140
274 3300029957 Ga0265324_10086692 Ga0265324_100866921 140
275 3300031235 Ga0265330_10137848 Ga0265330_101378482 140
276 3300031235 Ga0265330_10189007 Ga0265330_101890072 140
277 3300031238 Ga0265332_10164097 Ga0265332_101640972 140
278 3300031239 Ga0265328_10100034 Ga0265328_101000342 140
279 3300031239 Ga0265328_10135239 Ga0265328_101352391 140
280 3300031240 Ga0265320_10027217 Ga0265320_100272172 140
281 3300031240 Ga0265320_10145521 Ga0265320_101455211 140
282 3300031241 Ga0265325_10017004 Ga0265325_100170044 140
283 3300031241 Ga0265325_10183757 Ga0265325_101837572 140
284 3300031241 Ga0265325_10210721 Ga0265325_102107212 140
285 3300031242 Ga0265329_10075906 Ga0265329_100759062 140
286 3300031242 Ga0265329_10093342 Ga0265329_100933422 140
287 3300031242 Ga0265329_10096743 Ga0265329_100967431 140
288 3300031247 Ga0265340_10123751 Ga0265340_101237511 140
289 3300031247 Ga0265340_10137232 Ga0265340_101372322 140
290 3300031247 Ga0265340_10167051 Ga0265340_101670512 140
291 3300031249 Ga0265339_10061812 Ga0265339_100618122 140
292 3300031249 Ga0265339_10142027 Ga0265339_101420272 140
293 3300031249 Ga0265339_10177780 Ga0265339_101777803 140
294 3300031249 Ga0265339_10336390 Ga0265339_103363902 140
295 3300031250 Ga0265331_10007247 Ga0265331_100072476 140
296 3300031250 Ga0265331_10160903 Ga0265331_101609032 140
297 3300031251 Ga0265327_10124936 Ga0265327_101249363 140
298 3300031344 Ga0265316_10039062 Ga0265316_100390621 140
299 3300031344 Ga0265316_10244253 Ga0265316_102442532 140
300 3300031344 Ga0265316_10401175 Ga0265316_104011752 140
301 3300031344 Ga0265316_10450361 Ga0265316_104503612 140
302 3300031456 Ga0307513_10524425 Ga0307513_105244251 140
303 3300031548 Ga0307408_100361649 Ga0307408_1003616493 140
304 3300031595 Ga0265313_10005945 Ga0265313_1000594510 140
305 3300031595 Ga0265313_10090117 Ga0265313_100901172 140
306 3300031595 Ga0265313_10098903 Ga0265313_100989033 140
307 3300031711 Ga0265314_10166410 Ga0265314_101664101 140
308 3300031711 Ga0265314_10369479 Ga0265314_103694792 140
309 3300031712 Ga0265342_10014539 Ga0265342_100145391 140
310 3300031712 Ga0265342_10062162 Ga0265342_100621623 140
311 3300031712 Ga0265342_10188212 Ga0265342_101882121 140
312 3300031712 Ga0265342_10253414 Ga0265342_102534141 140
313 3300031730 Ga0307516_10557827 Ga0307516_105578271 140
314 3300031731 Ga0307405_10371480 Ga0307405_103714802 140
315 3300031731 Ga0307405_10501645 Ga0307405_105016451 140
316 3300031824 Ga0307413_10115514 Ga0307413_101155143 140
317 3300031852 Ga0307410_10220482 Ga0307410_102204823 140
318 3300031852 Ga0307410_10587364 Ga0307410_105873641 140
319 3300031901 Ga0307406_10387754 Ga0307406_103877541 140
320 3300031903 Ga0307407_10365773 Ga0307407_103657731 140
321 3300031903 Ga0307407_10446227 Ga0307407_104462272 140
322 3300031911 Ga0307412_10734072 Ga0307412_107340722 140
323 3300031995 Ga0307409_100645660 Ga0307409_1006456602 140
324 3300032002 Ga0307416_100236117 Ga0307416_1002361172 140
325 3300032002 Ga0307416_100833847 Ga0307416_1008338472 140
326 3300032002 Ga0307416_102053286 Ga0307416_1020532861 140
327 3300032126 Ga0307415_100461838 Ga0307415_1004618382 140
328 3300032126 Ga0307415_101648258 Ga0307415_1016482581 140
329 3300034817 Ga0373948_0040224 Ga0373948_0040224_79_507 140
330 3300034818 Ga0373950_0082247 Ga0373950_0082247_124_552 140
331 3300035086 Ga0373934_0079607 Ga0373934_0079607_439_861 140
332 3300035088 Ga0373940_0222598 Ga0373940_0222598_108_536 140
333 3300035090 Ga0373949_0064245 Ga0373949_0064245_54_482 140
334 3300035091 Ga0373951_0053258 Ga0373951_0053258_37_465 140
335 3300035092 Ga0373952_0066590 Ga0373952_0066590_311_739 140
336 3300035112 Ga0373932_0243301 Ga0373932_0243301_53_481 140
337 3300035113 Ga0373936_0173513 Ga0373936_0173513_56_478 140
338 3300035114 Ga0373939_0122294 Ga0373939_0122294_25_453 140
339 3300035115 Ga0373941_0080367 Ga0373941_0080367_235_663 140
340 3300035116 Ga0373945_0198780 Ga0373945_0198780_22_444 140
341 3300035119 Ga0373956_0267646 Ga0373956_0267646_215_643 140
342 3300035121 Ga0373960_0080931 Ga0373960_0080931_530_958 140
343 3300035170 Ga0373943_0135377 Ga0373943_0135377_775_1197 140
344 3300035170 Ga0373943_0185957 Ga0373943_0185957_667_1095 140
345 3300035171 Ga0373946_0187963 Ga0373946_0187963_515_937 140
346 3300035171 Ga0373946_0744802 Ga0373946_0744802_30_452 140
347 3300035207 Ga0373942_0073196 Ga0373942_0073196_111_539 140
348 3300035241 Ga0373961_0074216 Ga0373961_0074216_466_894 140
349 3300035242 Ga0373962_0041770 Ga0373962_0041770_197_625 140
350 3300035398 Ga0316574_0208120 Ga0316574_0208120_214_642 140
351 3300035691 Ga0373931_0168570 Ga0373931_0168570_56_484 140
352 3300035692 Ga0373935_0299873 Ga0373935_0299873_681_1103 140
353 3300035692 Ga0373935_0558222 Ga0373935_0558222_327_755 140
354 3300035724 Ga0373933_0215060 Ga0373933_0215060_80_508 140
355 3300035725 Ga0373947_0256137 Ga0373947_0256137_665_1087 140
356 3300036401 Ga0373937_0613824 Ga0373937_0613824_212_634 140
357 3300036401 Ga0373937_0687320 Ga0373937_0687320_528_956 140
358 3300036401 Ga0373937_1046627 Ga0373937_1046627_278_700 140
359 3300036647 Ga0316582_1081620 Ga0316582_1081620_79_507 140
360 3300037068 Ga0373925_0184893 Ga0373925_0184893_820_1242 140
361 3300037068 Ga0373925_1371559 Ga0373925_1371559_105_533 140
362 3300037466 Ga0395898_1209316 Ga0395898_1209316_191_619 140
363 3300037471 Ga0395905_0327147 Ga0395905_0327147_969_1391 140
364 3300037471 Ga0395905_0443817 Ga0395905_0443817_763_1185 140
365 3300037471 Ga0395905_0459040 Ga0395905_0459040_295_717 140
366 3300037853 Ga0436364_0176825 Ga0436364_0176825_878_1306 140
367 3300037853 Ga0436364_0230566 Ga0436364_0230566_1398_1820 140
368 3300037853 Ga0436364_0751518 Ga0436364_0751518_353_775 140
369 3300037853 Ga0436364_1290285 Ga0436364_1290285_40_468 140
370 3300039437 Ga0436365_0304394 Ga0436365_0304394_101_529 140
371 3300039437 Ga0436365_0889978 Ga0436365_0889978_359_781 140
372 3300039437 Ga0436365_0916403 Ga0436365_0916403_677_1099 140
373 3300039437 Ga0436365_0953019 Ga0436365_0953019_692_1114 140
374 3300039437 Ga0436365_1038530 Ga0436365_1038530_567_989 140
375 3300039437 Ga0436365_1543867 Ga0436365_1543867_129_551 140
376 3300039437 Ga0436365_1796423 Ga0436365_1796423_181_609 140
377 3300039438 Ga0436360_0084886 Ga0436360_0084886_128_556 140
378 3300039438 Ga0436360_0190664 Ga0436360_0190664_349_771 140
379 3300039438 Ga0436360_0300747 Ga0436360_0300747_81_503 140
380 3300039438 Ga0436360_0954986 Ga0436360_0954986_470_892 140
381 3300039438 Ga0436360_1090570 Ga0436360_1090570_39_467 140
382 3300039438 Ga0436360_1281300 Ga0436360_1281300_129_557 140
383 3300039447 Ga0436361_0144288 Ga0436361_0144288_446_868 140
384 3300039447 Ga0436361_0224788 Ga0436361_0224788_728_1156 140
385 3300039447 Ga0436361_0323478 Ga0436361_0323478_198_620 140
386 3300039447 Ga0436361_0369523 Ga0436361_0369523_547_975 140
387 3300039447 Ga0436361_0598041 Ga0436361_0598041_256_684 140
388 3300039447 Ga0436361_0658187 Ga0436361_0658187_1202_1624 140
389 3300039450 Ga0436363_0191444 Ga0436363_0191444_60_488 140
390 3300039450 Ga0436363_1078731 Ga0436363_1078731_892_1314 140
391 3300039450 Ga0436363_1141193 Ga0436363_1141193_187_609 140
392 3300039453 Ga0436362_0300804 Ga0436362_0300804_353_775 140
393 3300039453 Ga0436362_1204039 Ga0436362_1204039_101_523 140
394 3300041411 Ga0439466_0055649 Ga0439466_0055649_791_1219 140
395 3300041413 Ga0439465_0190882 Ga0439465_0190882_289_717 140
396 3300041413 Ga0439465_0199016 Ga0439465_0199016_220_648 140
397 3300041413 Ga0439465_0356782 Ga0439465_0356782_43_465 140
398 3300041452 Ga0451793_1106380 Ga0451793_1106380_110_538 140
399 3300041453 Ga0451797_0907562 Ga0451797_0907562_78_506 140
400 3300041458 Ga0451798_1072412 Ga0451798_1072412_400_828 140
401 3300041460 Ga0451802_0228420 Ga0451802_0228420_67_495 140
402 3300041460 Ga0451802_2096503 Ga0451802_2096503_140_568 140
403 3300041486 Ga0451807_1047851 Ga0451807_1047851_324_752 140
404 3300041494 Ga0451837_1271536 Ga0451837_1271536_171_599 140
405 3300041494 Ga0451837_1861520 Ga0451837_1861520_353_781 140
406 3300041507 Ga0451851_0809618 Ga0451851_0809618_509_937 140
407 3300041511 Ga0451855_1985776 Ga0451855_1985776_25_453 140
408 3300041512 Ga0451853_1763636 Ga0451853_1763636_199_627 140
409 3300042005 Ga0439448_0067681 Ga0439448_0067681_543_971 140
410 3300042008 Ga0439450_008225 Ga0439450_008225_1019_1447 140
411 3300042011 Ga0439454_003986 Ga0439454_003986_374_802 140
412 3300042014 Ga0439457_005512 Ga0439457_005512_465_893 140
413 3300042016 Ga0439463_099299 Ga0439463_099299_37_465 140
414 3300042122 Ga0450920_029371 Ga0450920_029371_538_966 140
415 3300042125 Ga0450923_078411 Ga0450923_078411_93_521 140
416 3300042125 Ga0450923_095907 Ga0450923_095907_52_480 140
417 3300042125 Ga0450923_161470 Ga0450923_161470_11_439 140
418 3300042435 Ga0439434_0184347 Ga0439434_0184347_104_532 140
419 3300042438 Ga0439459_0039346 Ga0439459_0039346_143_571 140
420 3300042461 Ga0439460_0045690 Ga0439460_0045690_521_949 140
421 3300042993 Ga0439440_0079393 Ga0439440_0079393_82_510 140
422 3300044684 Ga0466966_0188773 Ga0466966_0188773_88_510 140
423 3300044719 Ga0466971_0344004 Ga0466971_0344004_12_434 140
424 3300044735 Ga0466968_0345083 Ga0466968_0345083_46_474 140
425 3300044842 Ga0466957_0180413 Ga0466957_0180413_307_729 140
426 3300045051 Ga0451576_1414963 Ga0451576_1414963_203_631 140
427 3300045836 Ga0466958_0326937 Ga0466958_0326937_477_899 140
428 3300045976 Ga0466967_0610486 Ga0466967_0610486_43_465 140
429 3300046454 Ga0495592_0440415 Ga0495592_0440415_342_770 140
430 3300046454 Ga0495592_0719637 Ga0495592_0719637_29_451 140
431 3300046459 Ga0495629_0269178 Ga0495629_0269178_85_513 140
432 3300046459 Ga0495629_0773421 Ga0495629_0773421_45_473 140
433 3300046460 Ga0495638_0156254 Ga0495638_0156254_274_702 140
434 3300046462 Ga0495651_0406577 Ga0495651_0406577_54_482 140
435 3300046472 Ga0495580_0523499 Ga0495580_0523499_24_452 140
436 3300046475 Ga0495639_0237519 Ga0495639_0237519_35_457 140
437 3300046476 Ga0495662_0200179 Ga0495662_0200179_51_479 140
438 3300046492 Ga0495585_0249918 Ga0495585_0249918_71_493 140
439 3300046499 Ga0495594_0313736 Ga0495594_0313736_24_452 140
440 3300046499 Ga0495594_0637008 Ga0495594_0637008_67_495 140
441 3300046500 Ga0495596_0195999 Ga0495596_0195999_337_765 140
442 3300046501 Ga0495607_0385885 Ga0495607_0385885_142_570 140
443 3300046506 Ga0495583_0114819 Ga0495583_0114819_290_718 140
444 3300046507 Ga0495606_0157046 Ga0495606_0157046_238_666 140
445 3300046507 Ga0495606_0596240 Ga0495606_0596240_94_522 140
446 3300046511 Ga0495608_0286731 Ga0495608_0286731_55_483 140
447 3300046511 Ga0495608_0684532 Ga0495608_0684532_130_558 140
448 3300046512 Ga0495610_0037830 Ga0495610_0037830_980_1408 140
449 3300046514 Ga0495618_0615618 Ga0495618_0615618_193_621 140
450 3300046515 Ga0495620_0028952 Ga0495620_0028952_330_758 140
451 3300046516 Ga0495628_0295619 Ga0495628_0295619_164_592 140
452 3300046516 Ga0495628_0494126 Ga0495628_0494126_384_806 140
453 3300046516 Ga0495628_0554331 Ga0495628_0554331_309_737 140
454 3300046516 Ga0495628_0798800 Ga0495628_0798800_166_594 140
455 3300046518 Ga0495631_0142549 Ga0495631_0142549_539_967 140
456 3300046520 Ga0495637_0097273 Ga0495637_0097273_13_441 140
457 3300046522 Ga0495643_0057718 Ga0495643_0057718_1214_1642 140
458 3300046524 Ga0495648_0118632 Ga0495648_0118632_441_869 140
459 3300046524 Ga0495648_0195750 Ga0495648_0195750_514_942 140
460 3300046528 Ga0495642_0406611 Ga0495642_0406611_100_528 140
461 3300046529 Ga0495652_0454922 Ga0495652_0454922_10_438 140
462 3300046530 Ga0495654_0156105 Ga0495654_0156105_123_551 140
463 3300046530 Ga0495654_0300164 Ga0495654_0300164_89_517 140
464 3300046531 Ga0495665_0199638 Ga0495665_0199638_409_831 140
465 3300046533 Ga0495640_0518561 Ga0495640_0518561_87_515 140
466 3300046533 Ga0495640_0637923 Ga0495640_0637923_59_487 140
467 3300046535 Ga0495586_0175465 Ga0495586_0175465_572_1000 140
468 3300046536 Ga0495587_0313429 Ga0495587_0313429_19_447 140
469 3300046537 Ga0495598_0055244 Ga0495598_0055244_534_962 140
470 3300046538 Ga0495609_0057679 Ga0495609_0057679_719_1147 140
471 3300046539 Ga0495621_0033352 Ga0495621_0033352_710_1138 140
472 3300046539 Ga0495621_0173680 Ga0495621_0173680_88_516 140
473 3300046542 Ga0495597_0106827 Ga0495597_0106827_621_1049 140
474 3300046543 Ga0495645_0364316 Ga0495645_0364316_28_456 140
475 3300046557 Ga0495622_0013897 Ga0495622_0013897_2981_3409 140
476 3300046557 Ga0495622_0196348 Ga0495622_0196348_109_537 140
477 3300046558 Ga0495633_0172675 Ga0495633_0172675_553_981 140
478 3300046559 Ga0495667_0542919 Ga0495667_0542919_207_635 140
479 3300046615 Ga0495656_0198473 Ga0495656_0198473_552_980 140
480 3300046615 Ga0495656_0212596 Ga0495656_0212596_518_946 140
481 3300046648 Ga0495611_0109267 Ga0495611_0109267_81_503 140
482 3300046660 Ga0495625_0233537 Ga0495625_0233537_429_857 140
483 3300046663 Ga0495635_0364266 Ga0495635_0364266_122_550 140
484 3300046663 Ga0495635_0564359 Ga0495635_0564359_147_575 140
485 3300046665 Ga0495661_0260921 Ga0495661_0260921_438_866 140
486 3300046674 Ga0495588_0161978 Ga0495588_0161978_238_666 140
487 3300046675 Ga0495657_0285616 Ga0495657_0285616_28_456 140
488 3300046678 Ga0495599_0794622 Ga0495599_0794622_27_449 140
489 3300046679 Ga0495623_0300527 Ga0495623_0300527_300_728 140
490 3300046680 Ga0495646_0326846 Ga0495646_0326846_72_500 140
491 3300046683 Ga0495658_0441121 Ga0495658_0441121_141_569 140
492 3300046684 Ga0495669_0000800 Ga0495669_0000800_11051_11479 140
493 3300046684 Ga0495669_0181733 Ga0495669_0181733_424_852 140
494 3300046689 Ga0495613_0207949 Ga0495613_0207949_733_1161 140
495 3300046689 Ga0495613_0292549 Ga0495613_0292549_157_579 140
496 3300046689 Ga0495613_0865850 Ga0495613_0865850_79_507 140
497 3300046690 Ga0495624_0273916 Ga0495624_0273916_539_967 140
498 3300046691 Ga0495670_0094366 Ga0495670_0094366_1019_1447 140
499 3300046691 Ga0495670_0168579 Ga0495670_0168579_711_1139 140
500 3300046691 Ga0495670_0233119 Ga0495670_0233119_278_706 140
501 3300046794 Ga0495589_0022026 Ga0495589_0022026_746_1174 140
502 3300046809 Ga0495600_0098708 Ga0495600_0098708_36_464 140
503 3300047315 Ga0495581_0186355 Ga0495581_0186355_539_967 140
504 3300047315 Ga0495581_0299695 Ga0495581_0299695_363_791 140
505 3300047315 Ga0495581_0581964 Ga0495581_0581964_199_621 140
506 3300047319 Ga0495674_0658061 Ga0495674_0658061_383_811 140
507 3300047320 Ga0495672_0193675 Ga0495672_0193675_573_1001 140
508 3300047321 Ga0495676_0166956 Ga0495676_0166956_433_861 140
509 3300047322 Ga0495680_0347372 Ga0495680_0347372_100_528 140
510 3300047322 Ga0495680_0800716 Ga0495680_0800716_123_551 140
511 3300047447 Ga0495685_101958 Ga0495685_101958_501_929 140
512 3300047469 Ga0495673_0281080 Ga0495673_0281080_42_470 140
513 3300047471 Ga0495684_0463122 Ga0495684_0463122_20_448 140
514 3300047471 Ga0495684_0977560 Ga0495684_0977560_34_462 140
515 3300047472 Ga0495686_0115490 Ga0495686_0115490_757_1185 140
516 3300047472 Ga0495686_0212290 Ga0495686_0212290_75_503 140
517 3300047472 Ga0495686_0352657 Ga0495686_0352657_292_720 140
518 3300047673 Ga0495593_0086707 Ga0495593_0086707_760_1188 140
519 3300048088 Ga0495602_0211523 Ga0495602_0211523_419_847 140
520 3300048088 Ga0495602_0510171 Ga0495602_0510171_70_498 140
521 3300048088 Ga0495602_0730835 Ga0495602_0730835_185_613 140
522 3300048090 Ga0495615_0122441 Ga0495615_0122441_122_550 140
523 3300048904 Ga0496101_0329113 Ga0496101_0329113_347_775 140
524 3300048904 Ga0496101_0564936 Ga0496101_0564936_394_822 140
525 3300048906 Ga0496103_0648828 Ga0496103_0648828_193_621 140
526 3300048907 Ga0496104_0079097 Ga0496104_0079097_404_832 140
527 3300048907 Ga0496104_0627271 Ga0496104_0627271_405_833 140
528 3300048908 Ga0496105_0219128 Ga0496105_0219128_633_1061 140
529 3300048909 Ga0496106_1146568 Ga0496106_1146568_41_469 140
530 3300048910 Ga0496107_0364491 Ga0496107_0364491_147_569 140
531 3300048911 Ga0496108_0535968 Ga0496108_0535968_340_768 140
532 3300048911 Ga0496108_1082232 Ga0496108_1082232_192_614 140
533 3300048911 Ga0496108_1233434 Ga0496108_1233434_80_508 140
534 3300048912 Ga0496109_0891407 Ga0496109_0891407_49_477 140
535 3300048912 Ga0496109_1366763 Ga0496109_1366763_111_539 140
536 3300048913 Ga0496110_0495233 Ga0496110_0495233_315_743 140
537 3300048914 Ga0496111_0199965 Ga0496111_0199965_86_514 140
538 3300048916 Ga0496113_0190978 Ga0496113_0190978_116_544 140
539 3300048917 Ga0496114_0499232 Ga0496114_0499232_435_863 140
540 3300048918 Ga0496115_0645202 Ga0496115_0645202_117_545 140
541 3300048929 Ga0496126_0056847 Ga0496126_0056847_168_596 140
542 3300049460 Ga0495682_0101372 Ga0495682_0101372_477_905 140
543 3300049514 Ga0501291_056109 Ga0501291_056109_86_514 140
544 3300049569 Ga0501032_0043367 Ga0501032_0043367_2203_2631 140
545 3300049571 Ga0501034_0300621 Ga0501034_0300621_718_1140 140
546 3300049571 Ga0501034_0506316 Ga0501034_0506316_558_986 140
547 3300049572 Ga0501036_1434049 Ga0501036_1434049_90_518 140
548 3300049575 Ga0501039_0085948 Ga0501039_0085948_205_627 140
549 3300049575 Ga0501039_1127796 Ga0501039_1127796_165_587 140
550 3300049575 Ga0501039_1500613 Ga0501039_1500613_14_436 140
551 3300049577 Ga0501041_0698244 Ga0501041_0698244_17_439 140
552 3300049578 Ga0501042_0346416 Ga0501042_0346416_364_786 140
553 3300049578 Ga0501042_0368060 Ga0501042_0368060_549_977 140
554 3300049580 Ga0501046_0087055 Ga0501046_0087055_1789_2217 140
555 3300049580 Ga0501046_0163676 Ga0501046_0163676_735_1163 140
556 3300049581 Ga0501047_0464319 Ga0501047_0464319_571_999 140
557 3300049581 Ga0501047_0602153 Ga0501047_0602153_121_549 140
558 3300049581 Ga0501047_0893176 Ga0501047_0893176_177_605 140
559 3300049582 Ga0501048_0421845 Ga0501048_0421845_384_812 140
560 3300049588 Ga0501072_0188075 Ga0501072_0188075_60_482 140
561 3300049589 Ga0501073_0336866 Ga0501073_0336866_457_885 140
562 3300049591 Ga0501075_0172089 Ga0501075_0172089_972_1397 140
563 3300049592 Ga0501076_0139064 Ga0501076_0139064_388_810 140
564 3300049663 Ga0501223_003421 Ga0501223_003421_2581_3009 140
565 3300049669 Ga0501235_050712 Ga0501235_050712_322_750 140
566 3300049669 Ga0501235_176894 Ga0501235_176894_48_476 140
567 3300049743 Ga0501081_1414408 Ga0501081_1414408_83_505 140
568 3300049744 Ga0501083_0361065 Ga0501083_0361065_40_468 140
569 3300049822 Ga0501035_0222464 Ga0501035_0222464_262_690 140
570 3300049822 Ga0501035_0251764 Ga0501035_0251764_99_521 140
571 3300049822 Ga0501035_0533880 Ga0501035_0533880_481_909 140
572 3300049823 Ga0501044_0533368 Ga0501044_0533368_78_506 140
573 3300049823 Ga0501044_0598238 Ga0501044_0598238_52_480 140
574 3300049823 Ga0501044_1145109 Ga0501044_1145109_13_441 140
575 3300049824 Ga0501045_1004770 Ga0501045_1004770_89_511 140
576 3300050492 nmdc:mga0yw44_207093_c1 nmdc:mga0yw44_207093_c1_633_1061 140
577 3300050492 nmdc:mga0yw44_404114_c1 nmdc:mga0yw44_404114_c1_71_499 140
578 3300050495 nmdc:mga04h51_294592_c1 nmdc:mga04h51_294592_c1_47_475 140
579 3300050510 nmdc:mga06r32_353164_c1 nmdc:mga06r32_353164_c1_622_1050 140
580 3300050511 nmdc:mga08y16_93425_c1 nmdc:mga08y16_93425_c1_1732_2160 140
581 3300050511 nmdc:mga08y16_990725_c1 nmdc:mga08y16_990725_c1_26_454 140
582 3300053077 Ga0495601_0084814 Ga0495601_0084814_28_456 140
583 3300053077 Ga0495601_0289352 Ga0495601_0289352_18_446 140
584 3300053077 Ga0495601_0290115 Ga0495601_0290115_624_1046 140
585 3300053078 Ga0495612_0091456 Ga0495612_0091456_740_1162 140
586 3300053083 Ga0495655_0009621 Ga0495655_0009621_472_900 140
587 3300053084 Ga0495595_0129533 Ga0495595_0129533_267_695 140
588 3300053085 Ga0495619_0422551 Ga0495619_0422551_473_901 140
589 3300053085 Ga0495619_0468602 Ga0495619_0468602_428_856 140
590 3300053086 Ga0500578_0097481 Ga0500578_0097481_539_967 140
591 3300053087 Ga0500643_042125 Ga0500643_042125_396_824 140
592 3300053088 Ga0500644_0495263 Ga0500644_0495263_22_450 140
593 3300053091 Ga0500647_0170669 Ga0500647_0170669_65_493 140
594 3300053092 Ga0500583_0157084 Ga0500583_0157084_54_482 140
595 3300053093 Ga0500651_0247053 Ga0500651_0247053_103_531 140
596 3300053094 Ga0500566_0200894 Ga0500566_0200894_563_991 140
597 3300053096 Ga0500641_0141420 Ga0500641_0141420_573_1001 140
598 3300053103 Ga0500555_067353 Ga0500555_067353_78_506 140
599 3300053104 Ga0500556_0000097 Ga0500556_0000097_25614_26042 140
600 3300053104 Ga0500556_0015300 Ga0500556_0015300_42_470 140
601 3300053109 Ga0500569_004219 Ga0500569_004219_443_871 140
602 3300053111 Ga0500572_061630 Ga0500572_061630_15_443 140
603 3300053115 Ga0500591_121315 Ga0500591_121315_582_1010 140
604 3300053116 Ga0500592_006928 Ga0500592_006928_220_648 140
605 3300053117 Ga0500593_132824 Ga0500593_132824_144_572 140
606 3300053119 Ga0500595_014889 Ga0500595_014889_2260_2682 140
607 3300053120 Ga0500597_168324 Ga0500597_168324_481_909 140
608 3300053121 Ga0500607_172486 Ga0500607_172486_513_941 140
609 3300053123 Ga0500614_017625 Ga0500614_017625_848_1276 140
610 3300053128 Ga0500626_207826 Ga0500626_207826_262_690 140
611 3300053130 Ga0500642_0050308 Ga0500642_0050308_120_548 140
612 3300053131 Ga0500652_089532 Ga0500652_089532_414_842 140
613 3300053133 Ga0500655_013484 Ga0500655_013484_64_492 140
614 3300053134 Ga0500658_0192750 Ga0500658_0192750_483_911 140
615 3300053136 Ga0500559_0021865 Ga0500559_0021865_1362_1790 140
616 3300053136 Ga0500559_0027456 Ga0500559_0027456_760_1182 140
617 3300053138 Ga0500564_120361 Ga0500564_120361_276_704 140
618 3300053142 Ga0500577_0065047 Ga0500577_0065047_966_1394 140
619 3300053148 Ga0500590_180118 Ga0500590_180118_451_879 140
620 3300053153 Ga0500616_0157975 Ga0500616_0157975_175_603 140
621 3300053154 Ga0500619_031309 Ga0500619_031309_418_846 140
622 3300053155 Ga0500620_048707 Ga0500620_048707_656_1084 140
623 3300053162 Ga0500638_142818 Ga0500638_142818_123_551 140
624 3300053178 Ga0500637_0060481 Ga0500637_0060481_1269_1697 140
625 3300053724 Ga0500570_131761 Ga0500570_131761_371_799 140
626 3300053725 Ga0500576_086011 Ga0500576_086011_800_1228 140
627 3300053728 Ga0500657_119870 Ga0500657_119870_164_592 140
628 3300053729 Ga0500625_040350 Ga0500625_040350_1599_2027 140
629 3300053730 Ga0500645_055611 Ga0500645_055611_163_591 140
630 3300053733 Ga0500552_013386 Ga0500552_013386_123_551 140
631 3300053735 Ga0500596_002487 Ga0500596_002487_833_1261 140
632 3300055283 Ga0500661_000027 Ga0500661_000027_20717_21139 140
633 3300055283 Ga0500661_029515 Ga0500661_029515_120_548 140
634 3300061719 Ga0466962_0118993 Ga0466962_0118993_195_623 140
635 3300061719 Ga0466962_0338855 Ga0466962_0338855_76_498 140
636 3300061734 Ga0530510_0977703 Ga0530510_0977703_11_433 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01609

DDE_Tnp_1

Transposase DDE domain

2

62

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o3s-assembly1.cif.gz_A nmr solution structure of luffin p1 0.7519 103 140
6dmx-assembly2.cif.gz_G hbz56 in complex with kix and c-myb 0.7369 93 139
2bc4-assembly2.cif.gz_D crystal structure of hla-dm 0.6435 8 32
6puz-assembly1.cif.gz_A structure of hiv cleaved synaptic complex (csc) intasome bound with magnesium and insti xz446 (compound 4f) 0.642 25 130
6o3s-assembly1.cif.gz_A nmr solution structure of luffin p1 0.6294 103 140
ID Description Score Start End Superfamily
af_Q9FI63_292_491_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8498 49 76 3.80.10.10
af_Q9UAW8_52_341_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8423 49 78 3.20.20.190
af_P96360_116_274_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8256 2 131 3.90.180.10
af_Q10049_64_320_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7836 49 80 3.20.20.190
af_P96360_116_274_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.7665 2 131 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A246U1Q3-F1-model_v4 Transposase 0.9227 13 139 GO:0003677
GO:0004803
GO:0006313
AF-A0A258J2M2-F1-model_v4 Uncharacterized protein 0.9219 9 136 GO:0003677
GO:0004803
GO:0006313
AF-A0A222E3F1-F1-model_v4 Transposase DDE domain protein 0.9166 9 130 GO:0016020
AF-A0A1G1SSM7-F1-model_v4 Transposase 0.9149 9 135
AF-A0A1G1SXX5-F1-model_v4 Transposase IS4-like domain-containing protein 0.9135 15 134 GO:0003677
GO:0004803
GO:0006313

Feature Viewer

pLDDT pTM Quality
86.93 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map