F471320

General Info

Members Datasets Scaffolds Average Seq Length
636 346 603 289

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100369102|Ga0070684_1003691021
Length 340
Sequence VGHRRPRRCGADCYSPARPPAPHWSRLSPAGLPDVVNPGGALAPPRDKLDGVMPRPEYLVIITGLSGSGKSYVQSTLEDVGFYCCDNLPIELIEPFLEEVGAHENADRVGIVVDVRTHDFANVFPTFYRERIQKLVPHVVLIFLDASDEVLARRYSETRRPHPLAQNQPLLDAIVSERAALTEVKSLANMVLDTSQFSVHELKSEVMRRFELKDEKVTMLVTIVTFGFKYAMPYNVDLLFDVRFLPNPHFVESLRPKTGLDPEIVAYLKAQPGYDIFYDKLFDFVSYLLPQYQKEMKSYLTIGIGCTGGKHRSVAIGQRLADDLAGRGYAVEIVHRDCKR

Samples

Sample ID Description Type Environment
1 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
2 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
3 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
4 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
5 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
6 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
7 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
8 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
9 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
10 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
11 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
12 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
13 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
14 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
15 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
16 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
17 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
18 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
19 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
20 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
21 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
22 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
23 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
24 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
25 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
26 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
27 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
28 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
254 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
257 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
258 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
259 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
260 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
261 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
262 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
263 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
264 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
265 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
288 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
289 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
290 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
291 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
292 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
293 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
294 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
295 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
296 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
297 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
298 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
299 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
300 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
301 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
304 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
305 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
306 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
314 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
315 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
316 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
317 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
318 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
319 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
320 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
321 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
322 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
327 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
343 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
344 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
345 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
346 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 1.42
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10045331 3300001990 Bacteria 1343
2 JGI25162J39368_1007939 3300002737 Bacteria 1579
3 JGI25407J50210_10003315 3300003373 Bacteria 3838
4 Ga0055538_1000126 3300003751 Bacteria 58193
5 Ga0065707_10082720 3300005295 Bacteria 12520
6 Ga0065707_10116780 3300005295 Bacteria 2193
7 Ga0065707_10123525 3300005295 Bacteria 2063
8 Ga0070676_10006744 3300005328 Bacteria 6149
9 Ga0070683_100000068 3300005329 Bacteria 72997
10 Ga0070690_100001073 3300005330 Bacteria 14017
11 Ga0070690_100135706 3300005330 Unclassified 1666
12 Ga0070690_100210215 3300005330 Bacteria 1358
13 Ga0070670_100000307 3300005331 Bacteria 42018
14 Ga0070670_100031503 3300005331 Bacteria 4567
15 Ga0068869_100003954 3300005334 Bacteria 9154
16 Ga0068869_100136693 3300005334 Bacteria 1889
17 Ga0068869_100202865 3300005334 Bacteria 1564
18 Ga0070666_10000124 3300005335 Bacteria 53897
19 Ga0070666_10052647 3300005335 Unclassified 2743
20 Ga0070680_100010960 3300005336 Bacteria 7008
21 Ga0070680_100048137 3300005336 Bacteria 3474
22 Ga0070682_100000001 3300005337 Bacteria 569837
23 Ga0070682_100204792 3300005337 Unclassified 1394
24 Ga0068868_100003075 3300005338 Bacteria 11612
25 Ga0068868_100054885 3300005338 Bacteria 3142
26 Ga0070660_100031892 3300005339 Bacteria 3962
27 Ga0070689_100000158 3300005340 Bacteria 39830
28 Ga0070689_100000313 3300005340 Bacteria 28319
29 Ga0070689_100302634 3300005340 Bacteria 1331
30 Ga0070687_100002787 3300005343 Bacteria 6647
31 Ga0070687_100019380 3300005343 Bacteria 3164
32 Ga0070661_100091668 3300005344 Bacteria 2251
33 Ga0070668_100301993 3300005347 Unclassified 1343
34 Ga0070669_100058795 3300005353 Bacteria 2822
35 Ga0070675_100000048 3300005354 Bacteria 73894
36 Ga0070675_100000972 3300005354 Bacteria 20492
37 Ga0070675_100351520 3300005354 Bacteria 1307
38 Ga0070671_100029539 3300005355 Bacteria 4519
39 Ga0070674_100000802 3300005356 Bacteria 16179
40 Ga0070673_100000143 3300005364 Bacteria 33944
41 Ga0070688_100000873 3300005365 Bacteria 14990
42 Ga0070688_100032751 3300005365 Bacteria 3137
43 Ga0070659_100055925 3300005366 Bacteria 3111
44 Ga0070667_100283096 3300005367 Bacteria 1489
45 Ga0070714_100150207 3300005435 Bacteria 2099
46 Ga0070714_100340749 3300005435 Bacteria 1406
47 Ga0070713_100037861 3300005436 Bacteria 3903
48 Ga0070710_10097847 3300005437 Bacteria 1742
49 Ga0070701_10000590 3300005438 Bacteria 12673
50 Ga0070700_100000025 3300005441 Bacteria 126198
51 Ga0070700_100008756 3300005441 Bacteria 5524
52 Ga0070694_100017884 3300005444 Bacteria 4486
53 Ga0070694_100023393 3300005444 Bacteria 3973
54 Ga0070708_100015454 3300005445 Bacteria 6307
55 Ga0070708_100028093 3300005445 Bacteria 4837
56 Ga0070708_100050180 3300005445 Bacteria 3694
57 Ga0070708_100188626 3300005445 Bacteria 1928
58 Ga0070708_100303585 3300005445 Bacteria 1503
59 Ga0070708_100347490 3300005445 Unclassified 1398
60 Ga0070678_100000378 3300005456 Bacteria 20834
61 Ga0070678_100059795 3300005456 Bacteria 2802
62 Ga0070662_100014731 3300005457 Bacteria 5226
63 Ga0070681_10023873 3300005458 Bacteria 6156
64 Ga0070681_10222263 3300005458 Bacteria 1804
65 Ga0068867_100017876 3300005459 Bacteria 5036
66 Ga0068867_100066323 3300005459 Bacteria 2688
67 Ga0068867_100122130 3300005459 Unclassified 2015
68 Ga0070685_10001043 3300005466 Bacteria 14871
69 Ga0070685_10088965 3300005466 Bacteria 1866
70 Ga0070706_100043744 3300005467 Bacteria 4137
71 Ga0070706_100063371 3300005467 Bacteria 3416
72 Ga0070706_100251593 3300005467 Bacteria 1649
73 Ga0070706_100333815 3300005467 Bacteria 1414
74 Ga0070706_100372606 3300005467 Bacteria 1330
75 Ga0070707_100000111 3300005468 Bacteria 75249
76 Ga0070707_100004121 3300005468 Bacteria 13642
77 Ga0070707_100011738 3300005468 Bacteria 8177
78 Ga0070707_100023978 3300005468 Bacteria 5773
79 Ga0070707_100053740 3300005468 Bacteria 3862
80 Ga0070707_100054608 3300005468 Bacteria 3830
81 Ga0070707_100332233 3300005468 Bacteria 1477
82 Ga0070707_100357795 3300005468 Bacteria 1418
83 Ga0070698_100039345 3300005471 Bacteria 4868
84 Ga0070698_100078905 3300005471 Unclassified 3290
85 Ga0070698_100129104 3300005471 Bacteria 2484
86 Ga0070698_100145050 3300005471 Bacteria 2324
87 Ga0070698_100207217 3300005471 Bacteria 1896
88 Ga0070698_100226469 3300005471 Bacteria 1803
89 Ga0070699_100013096 3300005518 Bacteria 7148
90 Ga0070699_100017241 3300005518 Bacteria 6202
91 Ga0070699_100037743 3300005518 Bacteria 4183
92 Ga0070699_100067647 3300005518 Unclassified 3102
93 Ga0070699_100107172 3300005518 Bacteria 2451
94 Ga0070699_100173255 3300005518 Bacteria 1912
95 Ga0070699_100196556 3300005518 Bacteria 1793
96 Ga0070699_100340823 3300005518 Bacteria 1349
97 Ga0070699_100531375 3300005518 Bacteria 1070
98 Ga0070679_100194369 3300005530 Bacteria 1997
99 Ga0070684_100000096 3300005535 Bacteria 56546
100 Ga0070684_100369102 3300005535 Bacteria 1321
101 Ga0070697_100016123 3300005536 Bacteria 5875
102 Ga0070697_100054865 3300005536 Bacteria 3239
103 Ga0070697_100065749 3300005536 Bacteria 2964
104 Ga0070697_100129779 3300005536 Bacteria 2113
105 Ga0070697_100385692 3300005536 Unclassified 1214
106 Ga0068853_100217588 3300005539 Bacteria 1743
107 Ga0070672_100000197 3300005543 Bacteria 33442
108 Ga0070672_100000816 3300005543 Bacteria 18609
109 Ga0070672_100089388 3300005543 Bacteria 2482
110 Ga0070686_100000174 3300005544 Bacteria 45207
111 Ga0070686_100001516 3300005544 Bacteria 13050
112 Ga0070686_100087711 3300005544 Bacteria 2075
113 Ga0070686_100119575 3300005544 Bacteria 1807
114 Ga0070695_100010445 3300005545 Bacteria 5543
115 Ga0070695_100053395 3300005545 Bacteria 2599
116 Ga0070695_100163353 3300005545 Bacteria 1565
117 Ga0070696_100018688 3300005546 Bacteria 4688
118 Ga0070696_100071775 3300005546 Bacteria 2437
119 Ga0070696_100140375 3300005546 Unclassified 1766
120 Ga0070696_100142984 3300005546 Bacteria 1750
121 Ga0070696_100254960 3300005546 Bacteria 1328
122 Ga0070693_100033852 3300005547 Bacteria 2823
123 Ga0070665_100492611 3300005548 Bacteria 1237
124 Ga0070704_100053926 3300005549 Bacteria 2843
125 Ga0070704_100107701 3300005549 Unclassified 2114
126 Ga0070704_100112327 3300005549 Bacteria 2076
127 Ga0070664_100001536 3300005564 Bacteria 18433
128 Ga0070664_100017169 3300005564 Bacteria 5941
129 Ga0068857_100017024 3300005577 Bacteria 6367
130 Ga0068854_100013751 3300005578 Bacteria 5320
131 Ga0068854_100048947 3300005578 Unclassified 3018
132 Ga0068854_100119965 3300005578 Bacteria 1995
133 Ga0070702_100008166 3300005615 Bacteria 5057
134 Ga0070702_100174268 3300005615 Bacteria 1402
135 Ga0068859_100003507 3300005617 Bacteria 15972
136 Ga0068864_100000997 3300005618 Bacteria 23676
137 Ga0068861_100325594 3300005719 Bacteria 1340
138 Ga0068858_100002023 3300005842 Bacteria 20688
139 Ga0068860_100103379 3300005843 Bacteria 2719
140 Ga0081455_10002418 3300005937 Bacteria 22266
141 Ga0081455_10031389 3300005937 Bacteria 4808
142 Ga0081538_10002079 3300005981 Bacteria 19940
143 Ga0081538_10002290 3300005981 Bacteria 18910
144 Ga0081538_10018162 3300005981 Bacteria 5299
145 Ga0070717_10000082 3300006028 Bacteria 77627
146 Ga0070717_10115019 3300006028 Bacteria 2299
147 Ga0070717_10264531 3300006028 Unclassified 1522
148 Ga0070715_10064716 3300006163 Bacteria 1616
149 Ga0070715_10111335 3300006163 Bacteria 1292
150 Ga0070716_100049868 3300006173 Bacteria 2374
151 Ga0070716_100107551 3300006173 Bacteria 1722
152 Ga0097621_100007547 3300006237 Bacteria 7788
153 Ga0097621_100015212 3300006237 Bacteria 5783
154 Ga0097621_100196611 3300006237 Bacteria 1749
155 Ga0097621_100211511 3300006237 Bacteria 1687
156 Ga0068871_100018386 3300006358 Bacteria 5311
157 Ga0068871_100023078 3300006358 Bacteria 4806
158 Ga0075428_100003895 3300006844 Bacteria 16401
159 Ga0075428_100044459 3300006844 Bacteria 4881
160 Ga0075428_100080946 3300006844 Bacteria 3545
161 Ga0075428_100476298 3300006844 Bacteria 1336
162 Ga0075428_100893862 3300006844 Bacteria 942
163 Ga0075430_100001814 3300006846 Bacteria 17479
164 Ga0075430_100001931 3300006846 Bacteria 17021
165 Ga0075430_100002247 3300006846 Bacteria 16012
166 Ga0075430_100037853 3300006846 Bacteria 4089
167 Ga0075430_100173673 3300006846 Bacteria 1793
168 Ga0075431_100002763 3300006847 Bacteria 17017
169 Ga0075431_100010356 3300006847 Bacteria 9369
170 Ga0075431_100012438 3300006847 Bacteria 8590
171 Ga0075431_100058652 3300006847 Bacteria 3973
172 Ga0075431_100082208 3300006847 Bacteria 3325
173 Ga0075431_100355227 3300006847 Bacteria 1473
174 Ga0075433_10078793 3300006852 Bacteria 2903
175 Ga0075433_10143132 3300006852 Bacteria 2125
176 Ga0075433_10182979 3300006852 Bacteria 1864
177 Ga0075433_10316434 3300006852 Bacteria 1381
178 Ga0075434_100218520 3300006871 Unclassified 1926
179 Ga0075434_100271478 3300006871 Bacteria 1715
180 Ga0075434_100275753 3300006871 Bacteria 1701
181 Ga0075434_100370437 3300006871 Bacteria 1453
182 Ga0075429_100001796 3300006880 Bacteria 17765
183 Ga0075429_100032924 3300006880 Bacteria 4505
184 Ga0075429_100050232 3300006880 Bacteria 3628
185 Ga0075429_100439037 3300006880 Bacteria 1144
186 Ga0068865_100033932 3300006881 Bacteria 3420
187 Ga0075436_100010008 3300006914 Bacteria 6486
188 Ga0075436_100029754 3300006914 Bacteria 3756
189 Ga0075436_100033049 3300006914 Bacteria 3564
190 Ga0075436_100041870 3300006914 Bacteria 3159
191 Ga0075436_100154885 3300006914 Bacteria 1614
192 Ga0097620_100003507 3300006931 Bacteria 15972
193 Ga0075435_100020219 3300007076 Bacteria 5097
194 Ga0075435_100044239 3300007076 Bacteria 3566
195 Ga0075435_100054757 3300007076 Bacteria 3220
196 Ga0075435_100138974 3300007076 Bacteria 2037
197 Ga0099794_10053906 3300007265 Unclassified 1940
198 Ga0105251_10023712 3300009011 Bacteria 3162
199 Ga0105244_10017743 3300009036 Bacteria 4015
200 Ga0105244_10020062 3300009036 Bacteria 3716
201 Ga0105244_10024614 3300009036 Bacteria 3283
202 Ga0105240_10634056 3300009093 Bacteria 1173
203 Ga0111539_10000052 3300009094 Bacteria 116307
204 Ga0111539_10000081 3300009094 Bacteria 97006
205 Ga0111539_10111448 3300009094 Bacteria 3211
206 Ga0111539_10233267 3300009094 Bacteria 2142
207 Ga0105245_10000226 3300009098 Bacteria 53639
208 Ga0105245_10001090 3300009098 Bacteria 24615
209 Ga0105245_10003826 3300009098 Bacteria 13380
210 Ga0105245_10093804 3300009098 Bacteria 2766
211 Ga0114129_10063361 3300009147 Bacteria 5162
212 Ga0114129_10091236 3300009147 Bacteria 4221
213 Ga0114129_10128329 3300009147 Bacteria 3485
214 Ga0114129_10306441 3300009147 Bacteria 2115
215 Ga0114129_10613821 3300009147 Bacteria 1408
216 Ga0105242_10004808 3300009176 Bacteria 10451
217 Ga0105242_10136137 3300009176 Bacteria 2126
218 Ga0105242_10238692 3300009176 Bacteria 1633
219 Ga0105248_10000986 3300009177 Bacteria 31580
220 Ga0105248_10214972 3300009177 Bacteria 2166
221 Ga0105248_10216482 3300009177 Unclassified 2157
222 Ga0105248_10545825 3300009177 Bacteria 1308
223 Ga0105237_10323838 3300009545 Bacteria 1545
224 Ga0105238_10000001 3300009551 Bacteria 2036163
225 Ga0105239_10057370 3300010375 Bacteria 4271
226 Ga0105246_10001872 3300011119 Bacteria 12679
227 Ga0157371_10015408 3300013102 Bacteria 5736
228 Ga0157370_10056802 3300013104 Bacteria 3724
229 Ga0157369_10000539 3300013105 Bacteria 50071
230 Ga0157369_10696640 3300013105 Bacteria 1046
231 Ga0157374_10000012 3300013296 Bacteria 462353
232 Ga0157374_10039617 3300013296 Bacteria 4336
233 Ga0157378_10000610 3300013297 Bacteria 33628
234 Ga0157378_10003527 3300013297 Bacteria 13871
235 Ga0157378_10005757 3300013297 Bacteria 10855
236 Ga0157378_10041805 3300013297 Bacteria 4067
237 Ga0157378_10061302 3300013297 Unclassified 3356
238 Ga0157378_10080404 3300013297 Bacteria 2944
239 Ga0157378_10105579 3300013297 Bacteria 2576
240 Ga0163162_10025250 3300013306 Bacteria 5871
241 Ga0163162_10169426 3300013306 Bacteria 2308
242 Ga0157372_10301702 3300013307 Bacteria 1863
243 Ga0157375_10000008 3300013308 Bacteria 373560
244 Ga0157375_10000146 3300013308 Bacteria 69095
245 Ga0157375_10005069 3300013308 Bacteria 11430
246 Ga0157375_10056602 3300013308 Unclassified 3873
247 Ga0163163_10316225 3300014325 Unclassified 1615
248 Ga0163163_10457989 3300014325 Bacteria 1336
249 Ga0157380_10000693 3300014326 Bacteria 20963
250 Ga0157380_10006017 3300014326 Bacteria 8495
251 Ga0157380_10018575 3300014326 Bacteria 5162
252 Ga0157380_10034037 3300014326 Bacteria 3928
253 Ga0157377_10000002 3300014745 Bacteria 473827
254 Ga0157377_10000024 3300014745 Bacteria 142391
255 Ga0157379_10141149 3300014968 Bacteria 2172
256 Ga0157376_10000025 3300014969 Bacteria 214212
257 Ga0157376_10005233 3300014969 Bacteria 9059
258 Ga0213873_10000002 3300021358 Bacteria 1164195
259 Ga0213873_10005074 3300021358 Bacteria 2501
260 Ga0213876_10000001 3300021384 Bacteria 1186326
261 Ga0213876_10000080 3300021384 Bacteria 109125
262 Ga0213876_10033554 3300021384 Bacteria 2706
263 Ga0209566_105848 3300025225 Bacteria 1500
264 Ga0209437_100489 3300025233 Bacteria 29197
265 Ga0207697_10062047 3300025315 Unclassified 1556
266 Ga0207655_1033348 3300025728 Bacteria 2335
267 Ga0207653_10073523 3300025885 Unclassified 1172
268 Ga0207692_10179711 3300025898 Bacteria 1232
269 Ga0207680_10164300 3300025903 Bacteria 1491
270 Ga0207685_10098803 3300025905 Bacteria 1244
271 Ga0207645_10011166 3300025907 Bacteria 6144
272 Ga0207705_10023924 3300025909 Bacteria 4359
273 Ga0207684_10037756 3300025910 Bacteria 4099
274 Ga0207684_10047017 3300025910 Bacteria 3661
275 Ga0207684_10258846 3300025910 Unclassified 1501
276 Ga0207707_10033042 3300025912 Bacteria 4528
277 Ga0207663_10016813 3300025916 Bacteria 4067
278 Ga0207660_10042127 3300025917 Bacteria 3203
279 Ga0207660_10050073 3300025917 Bacteria 2965
280 Ga0207660_10054213 3300025917 Bacteria 2861
281 Ga0207662_10001748 3300025918 Bacteria 10664
282 Ga0207662_10007817 3300025918 Bacteria 5826
283 Ga0207662_10092831 3300025918 Bacteria 1859
284 Ga0207657_10245055 3300025919 Bacteria 1430
285 Ga0207652_10027811 3300025921 Bacteria 4715
286 Ga0207652_10220854 3300025921 Bacteria 1707
287 Ga0207646_10000163 3300025922 Bacteria 90731
288 Ga0207646_10014015 3300025922 Bacteria 7630
289 Ga0207646_10032240 3300025922 Bacteria 4742
290 Ga0207646_10053889 3300025922 Bacteria 3598
291 Ga0207646_10091400 3300025922 Unclassified 2724
292 Ga0207646_10115271 3300025922 Bacteria 2413
293 Ga0207681_10058275 3300025923 Bacteria 2644
294 Ga0207694_10000001 3300025924 Bacteria 4078485
295 Ga0207650_10000262 3300025925 Bacteria 56131
296 Ga0207650_10040481 3300025925 Bacteria 3410
297 Ga0207659_10000007 3300025926 Bacteria 322984
298 Ga0207659_10043589 3300025926 Bacteria 3152
299 Ga0207659_10299634 3300025926 Bacteria 1320
300 Ga0207687_10000003 3300025927 Bacteria 875159
301 Ga0207687_10000589 3300025927 Bacteria 24566
302 Ga0207687_10002009 3300025927 Bacteria 13968
303 Ga0207687_10205637 3300025927 Bacteria 1541
304 Ga0207700_10025113 3300025928 Bacteria 4133
305 Ga0207644_10053118 3300025931 Bacteria 2915
306 Ga0207690_10096302 3300025932 Bacteria 2104
307 Ga0207706_10003099 3300025933 Bacteria 15977
308 Ga0207686_10006165 3300025934 Bacteria 6445
309 Ga0207686_10149949 3300025934 Bacteria 1622
310 Ga0207670_10000755 3300025936 Bacteria 17002
311 Ga0207670_10001520 3300025936 Bacteria 12195
312 Ga0207669_10020258 3300025937 Bacteria 3483
313 Ga0207665_10011128 3300025939 Bacteria 5903
314 Ga0207691_10000080 3300025940 Bacteria 82234
315 Ga0207691_10000269 3300025940 Bacteria 51350
316 Ga0207691_10082615 3300025940 Bacteria 2885
317 Ga0207691_10409083 3300025940 Bacteria 1157
318 Ga0207711_10085133 3300025941 Bacteria 2769
319 Ga0207711_10138751 3300025941 Bacteria 2186
320 Ga0207711_10344327 3300025941 Bacteria 1380
321 Ga0207711_10382035 3300025941 Unclassified 1307
322 Ga0207689_10013865 3300025942 Bacteria 6866
323 Ga0207689_10053262 3300025942 Bacteria 3334
324 Ga0207689_10156275 3300025942 Bacteria 1880
325 Ga0207661_10000001 3300025944 Bacteria 937688
326 Ga0207679_10001532 3300025945 Bacteria 14444
327 Ga0207651_10000078 3300025960 Bacteria 44168
328 Ga0207651_10014030 3300025960 Bacteria 4612
329 Ga0207651_10284059 3300025960 Unclassified 1369
330 Ga0207640_10006617 3300025981 Bacteria 6367
331 Ga0207640_10022528 3300025981 Bacteria 3772
332 Ga0207640_10044675 3300025981 Bacteria 2840
333 Ga0207677_10000045 3300026023 Bacteria 106591
334 Ga0207677_10000633 3300026023 Bacteria 21255
335 Ga0207677_10097106 3300026023 Bacteria 2157
336 Ga0207703_10000104 3300026035 Bacteria 99914
337 Ga0207639_10000051 3300026041 Bacteria 113927
338 Ga0207639_10182832 3300026041 Bacteria 1785
339 Ga0207708_10000052 3300026075 Bacteria 105169
340 Ga0207708_10000207 3300026075 Bacteria 46522
341 Ga0207708_10254334 3300026075 Bacteria 1416
342 Ga0207648_10006188 3300026089 Bacteria 11923
343 Ga0207648_10044257 3300026089 Bacteria 3906
344 Ga0207648_10328143 3300026089 Bacteria 1376
345 Ga0207676_10000013 3300026095 Bacteria 343067
346 Ga0207674_10051491 3300026116 Bacteria 4202
347 Ga0207675_100021034 3300026118 Bacteria 6082
348 Ga0207683_10005661 3300026121 Bacteria 10712
349 Ga0207683_10036611 3300026121 Bacteria 4274
350 Ga0207683_10614336 3300026121 Unclassified 1006
351 Ga0209968_1001627 3300027526 Bacteria 3384
352 Ga0209966_1017447 3300027695 Bacteria 1368
353 Ga0209974_10000783 3300027876 Bacteria 10842
354 Ga0207428_10000003 3300027907 Bacteria 799783
355 Ga0207428_10004729 3300027907 Bacteria 12882
356 Ga0268264_10079364 3300028381 Bacteria 2800
357 Ga0307511_10009303 3300030521 Bacteria 9790
358 Ga0307408_100069928 3300031548 Bacteria 2590
359 Ga0307408_100173646 3300031548 Bacteria 1722
360 Ga0307408_100262310 3300031548 Bacteria 1430
361 Ga0307405_10038380 3300031731 Bacteria 2887
362 Ga0307410_10195303 3300031852 Bacteria 1541
363 Ga0307407_10065108 3300031903 Bacteria 2145
364 Ga0307412_10010073 3300031911 Bacteria 5436
365 Ga0307409_100119546 3300031995 Bacteria 2228
366 Ga0307409_100252355 3300031995 Unclassified 1614
367 Ga0307416_100042987 3300032002 Bacteria 3534
368 Ga0307416_100276082 3300032002 Bacteria 1654
369 Ga0307411_10010860 3300032005 Bacteria 4880
370 Ga0307411_10158785 3300032005 Bacteria 1690
371 Ga0307411_10450908 3300032005 Unclassified 1076
372 Ga0307415_100389003 3300032126 Bacteria 1187
373 Ga0373926_0015991 3300035083 Bacteria 2563
374 Ga0373932_0002001 3300035112 Bacteria 5369
375 Ga0373945_0045156 3300035116 Bacteria 1604
376 Ga0373931_0382352 3300035691 Unclassified 888
377 Ga0373935_0184308 3300035692 Bacteria 1435
378 Ga0373933_0042796 3300035724 Bacteria 2677
379 Ga0373947_0058119 3300035725 Bacteria 2343
380 Ga0373937_0268739 3300036401 Bacteria 1609
381 Ga0373925_0070409 3300037068 Bacteria 2644
382 Ga0436365_0404975 3300039437 Bacteria 180420
383 Ga0436365_1042710 3300039437 Bacteria 18422
384 Ga0436365_1645708 3300039437 Bacteria 58473
385 Ga0436362_0551129 3300039453 Bacteria 8157
386 Ga0436362_0660519 3300039453 Bacteria 832172
387 Ga0439466_0057542 3300041411 Bacteria 1259
388 Ga0451839_0558968 3300041496 Bacteria 3184
389 Ga0439433_0037166 3300041999 Bacteria 1126
390 Ga0439432_029127 3300042006 Bacteria 1796
391 Ga0439452_002900 3300042010 Bacteria 6147
392 Ga0439456_024964 3300042013 Bacteria 1269
393 Ga0439462_0021271 3300042015 Bacteria 1694
394 Ga0439446_0008143 3300042156 Unclassified 2775
395 Ga0439434_0005421 3300042435 Unclassified 3735
396 Ga0439444_0013099 3300042437 Bacteria 1370
397 Ga0439460_0008942 3300042461 Bacteria 2534
398 Ga0451577_0027632 3300042876 Bacteria 5136
399 Ga0453683_0010212 3300044673 Bacteria 6231
400 Ga0453684_0039042 3300044712 Bacteria 6475
401 Ga0466968_0034413 3300044735 Bacteria 2114
402 Ga0451576_0004157 3300045051 Bacteria 19055
403 Ga0451576_0237364 3300045051 Bacteria 1904
404 Ga0451576_0432850 3300045051 Bacteria 1380
405 Ga0466967_0064347 3300045976 Bacteria 3261
406 Ga0495594_0019012 3300046499 Bacteria 3647
407 Ga0495594_0078748 3300046499 Bacteria 1839
408 Ga0495620_0000908 3300046515 Bacteria 18186
409 Ga0495637_0005060 3300046520 Bacteria 6771
410 Ga0495658_0124447 3300046683 Unclassified 1563
411 Ga0495676_0341787 3300047321 Unclassified 1002
412 Ga0495680_0019066 3300047322 Bacteria 5806
413 Ga0495680_0023451 3300047322 Bacteria 5131
414 Ga0495681_0014794 3300047470 Bacteria 4452
415 Ga0496101_0201695 3300048904 Bacteria 1538
416 Ga0496104_0081394 3300048907 Bacteria 3088
417 Ga0496106_0341583 3300048909 Bacteria 1202
418 Ga0496108_0036239 3300048911 Bacteria 4104
419 Ga0496109_0012412 3300048912 Bacteria 7356
420 Ga0496110_0271418 3300048913 Bacteria 1544
421 Ga0496114_0004335 3300048917 Bacteria 10987
422 Ga0496115_0629583 3300048918 Bacteria 850
423 Ga0496116_0005542 3300048919 Bacteria 11645
424 Ga0496116_0015980 3300048919 Bacteria 5903
425 Ga0496116_0081218 3300048919 Bacteria 2010
426 Ga0496116_0148207 3300048919 Bacteria 1308
427 Ga0496117_0003330 3300048920 Bacteria 18770
428 Ga0496117_0049711 3300048920 Bacteria 2979
429 Ga0496118_0041810 3300048921 Bacteria 3623
430 Ga0496118_0160797 3300048921 Bacteria 1389
431 Ga0496119_0000331 3300048922 Bacteria 66145
432 Ga0496119_0007134 3300048922 Bacteria 10141
433 Ga0496120_0000298 3300048923 Bacteria 83191
434 Ga0496120_0053503 3300048923 Bacteria 2293
435 Ga0496121_0029992 3300048924 Bacteria 5007
436 Ga0496121_0038361 3300048924 Bacteria 4246
437 Ga0496121_0038631 3300048924 Bacteria 4220
438 Ga0496122_0013991 3300048925 Bacteria 7796
439 Ga0496122_0032403 3300048925 Bacteria 4322
440 Ga0496122_0093181 3300048925 Bacteria 2044
441 Ga0496122_0109044 3300048925 Bacteria 1823
442 Ga0496123_0020096 3300048926 Bacteria 5239
443 Ga0496123_0045676 3300048926 Bacteria 2981
444 Ga0496124_0000824 3300048927 Bacteria 50533
445 Ga0496124_0045247 3300048927 Bacteria 3774
446 Ga0496124_0067962 3300048927 Bacteria 2963
447 Ga0496125_0002758 3300048928 Bacteria 22227
448 Ga0496125_0033730 3300048928 Bacteria 4524
449 Ga0496126_0001009 3300048929 Bacteria 47959
450 Ga0496126_0003928 3300048929 Bacteria 18207
451 Ga0496126_0005903 3300048929 Bacteria 13809
452 Ga0501290_000006 3300049513 Bacteria 41465
453 Ga0501291_000100 3300049514 Bacteria 10312
454 Ga0501292_000119 3300049515 Bacteria 13728
455 Ga0501293_000069 3300049516 Bacteria 6524
456 Ga0501294_000531 3300049517 Bacteria 4429
457 Ga0501295_000505 3300049518 Unclassified 3664
458 Ga0501296_000055 3300049519 Bacteria 12939
459 Ga0501297_000036 3300049520 Bacteria 13632
460 Ga0501298_000067 3300049521 Bacteria 11235
461 Ga0501299_000019 3300049522 Bacteria 20397
462 Ga0501299_022016 3300049522 Bacteria 1173
463 Ga0501300_000028 3300049523 Bacteria 22326
464 Ga0501301_000101 3300049524 Bacteria 4297
465 Ga0501302_000132 3300049525 Bacteria 3703
466 Ga0501031_0002722 3300049568 Bacteria 11249
467 Ga0501031_0013748 3300049568 Bacteria 5276
468 Ga0501031_0028809 3300049568 Bacteria 3619
469 Ga0501031_0037335 3300049568 Bacteria 3170
470 Ga0501032_0012130 3300049569 Bacteria 6170
471 Ga0501032_0019570 3300049569 Bacteria 4735
472 Ga0501033_0127486 3300049570 Unclassified 1845
473 Ga0501036_0015358 3300049572 Bacteria 6394
474 Ga0501037_0005036 3300049573 Bacteria 9613
475 Ga0501037_0028005 3300049573 Bacteria 4163
476 Ga0501037_0056965 3300049573 Unclassified 2854
477 Ga0501037_0092472 3300049573 Unclassified 2188
478 Ga0501038_0002519 3300049574 Bacteria 17073
479 Ga0501038_0023120 3300049574 Bacteria 5562
480 Ga0501038_0029364 3300049574 Bacteria 4874
481 Ga0501038_0181506 3300049574 Bacteria 1698
482 Ga0501039_0001919 3300049575 Bacteria 15401
483 Ga0501039_0005939 3300049575 Bacteria 9250
484 Ga0501039_0021109 3300049575 Bacteria 4995
485 Ga0501039_0032056 3300049575 Bacteria 4051
486 Ga0501039_0039904 3300049575 Bacteria 3625
487 Ga0501040_0021975 3300049576 Bacteria 4266
488 Ga0501040_0056996 3300049576 Bacteria 2682
489 Ga0501040_0315729 3300049576 Unclassified 1117
490 Ga0501041_0003539 3300049577 Bacteria 8984
491 Ga0501042_0001433 3300049578 Bacteria 14045
492 Ga0501042_0013466 3300049578 Bacteria 5566
493 Ga0501042_0092930 3300049578 Bacteria 2166
494 Ga0501042_0174000 3300049578 Bacteria 1553
495 Ga0501043_0176580 3300049579 Bacteria 1665
496 Ga0501046_0004340 3300049580 Bacteria 12913
497 Ga0501046_0011649 3300049580 Bacteria 7517
498 Ga0501046_0091337 3300049580 Bacteria 2342
499 Ga0501046_0247533 3300049580 Unclassified 1313
500 Ga0501048_0003804 3300049582 Bacteria 11515
501 Ga0501048_0064663 3300049582 Bacteria 2587
502 Ga0501048_0074444 3300049582 Bacteria 2396
503 Ga0501068_0034500 3300049584 Unclassified 3017
504 Ga0501068_0221610 3300049584 Bacteria 1202
505 Ga0501068_0235044 3300049584 Bacteria 1166
506 Ga0501071_0027727 3300049587 Bacteria 3987
507 Ga0501071_0197984 3300049587 Bacteria 1508
508 Ga0501072_0002709 3300049588 Bacteria 13295
509 Ga0501072_0068011 3300049588 Bacteria 2812
510 Ga0501073_0000867 3300049589 Bacteria 21612
511 Ga0501074_0059188 3300049590 Bacteria 2761
512 Ga0501075_0008450 3300049591 Bacteria 7183
513 Ga0501075_0053736 3300049591 Bacteria 3029
514 Ga0501075_0076413 3300049591 Bacteria 2533
515 Ga0501076_0013762 3300049592 Bacteria 6071
516 Ga0501076_0101555 3300049592 Bacteria 2318
517 Ga0501076_0123706 3300049592 Bacteria 2095
518 Ga0501077_0021039 3300049593 Bacteria 4127
519 Ga0501077_0038008 3300049593 Bacteria 3064
520 Ga0501077_0040188 3300049593 Bacteria 2980
521 Ga0501198_000924 3300049649 Bacteria 3702
522 Ga0501199_000140 3300049650 Bacteria 5665
523 Ga0501201_000548 3300049651 Bacteria 3497
524 Ga0501202_002648 3300049652 Bacteria 3021
525 Ga0501206_000044 3300049653 Bacteria 11231
526 Ga0501207_001130 3300049654 Bacteria 3274
527 Ga0501208_000495 3300049655 Unclassified 3158
528 Ga0501216_003634 3300049660 Bacteria 2259
529 Ga0501223_000510 3300049663 Bacteria 9399
530 Ga0501228_000261 3300049666 Bacteria 3204
531 Ga0501230_000608 3300049667 Bacteria 3755
532 Ga0501235_000120 3300049669 Bacteria 12942
533 Ga0501239_000073 3300049672 Bacteria 6326
534 Ga0501243_000672 3300049675 Bacteria 4693
535 Ga0501246_000145 3300049676 Unclassified 4392
536 Ga0501249_000424 3300049679 Bacteria 10734
537 Ga0501250_000241 3300049680 Bacteria 3300
538 Ga0501253_000048 3300049683 Bacteria 8209
539 Ga0501259_001393 3300049688 Bacteria 4041
540 Ga0501260_000199 3300049689 Unclassified 4584
541 Ga0501225_0000414 3300049705 Bacteria 13436
542 Ga0501229_000122 3300049706 Bacteria 8154
543 Ga0501079_0009853 3300049741 Bacteria 7249
544 Ga0501080_0034665 3300049742 Bacteria 4713
545 Ga0501081_0046335 3300049743 Unclassified 2988
546 Ga0501081_0222191 3300049743 Unclassified 1374
547 Ga0501081_0579213 3300049743 Bacteria 839
548 Ga0501083_0272188 3300049744 Bacteria 1102
549 Ga0501264_001111 3300049761 Unclassified 3152
550 Ga0501265_000946 3300049762 Bacteria 3257
551 Ga0501266_004292 3300049763 Bacteria 1766
552 Ga0501270_000296 3300049767 Bacteria 4273
553 Ga0501274_000292 3300049771 Bacteria 3389
554 Ga0501275_000725 3300049772 Unclassified 3599
555 Ga0501278_000609 3300049774 Unclassified 2731
556 Ga0501279_000476 3300049775 Bacteria 5291
557 Ga0501280_003633 3300049776 Unclassified 2344
558 Ga0501283_000006 3300049779 Bacteria 26660
559 Ga0501035_0008334 3300049822 Bacteria 9650
560 Ga0501035_0012688 3300049822 Bacteria 7785
561 Ga0501035_0133891 3300049822 Unclassified 2159
562 Ga0501044_0460107 3300049823 Bacteria 1178
563 Ga0501045_0047578 3300049824 Bacteria 3125
564 Ga0501045_0103171 3300049824 Bacteria 2112
565 Ga0501212_005330 3300049851 Bacteria 1694
566 Ga0501226_002060 3300049853 Bacteria 2495
567 nmdc:mga05p37_158979_c1 3300050507 Bacteria 2760
568 nmdc:mga05p37_37981_c1 3300050507 Bacteria 5906
569 nmdc:mga05p37_49626_c1 3300050507 Bacteria 5162
570 nmdc:mga05p37_73036_c1 3300050507 Bacteria 4221
571 nmdc:mga09592_13200_c1 3300050508 Bacteria 6744
572 nmdc:mga09592_38682_c1 3300050508 Bacteria 4005
573 nmdc:mga09592_88210_c1 3300050508 Bacteria 2649
574 nmdc:mga0qj67_161965_c1 3300050509 Bacteria 1816
575 nmdc:mga0qj67_332798_c1 3300050509 Bacteria 1229
576 nmdc:mga0qj67_33280_c1 3300050509 Bacteria 4022
577 nmdc:mga0qj67_40926_c1 3300050509 Bacteria 3643
578 nmdc:mga06r32_124908_c1 3300050510 Bacteria 2540
579 nmdc:mga06r32_136762_c1 3300050510 Bacteria 2425
580 nmdc:mga06r32_2480_c1 3300050510 Bacteria 16511
581 nmdc:mga06r32_54184_c1 3300050510 Bacteria 3845
582 nmdc:mga06r32_54931_c1 3300050510 Bacteria 3819
583 nmdc:mga08y16_196_c1 3300050511 Bacteria 54632
584 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
585 nmdc:mga08y16_92554_c1 3300050511 Bacteria 3150
586 nmdc:mga0n895_194417_c1 3300050512 Bacteria 2060
587 nmdc:mga0n895_2535_c1 3300050512 Bacteria 14305
588 nmdc:mga0rr50_146437_c1 3300050513 Unclassified 1905
589 nmdc:mga0rr50_37_c1 3300050513 Bacteria 87211
590 nmdc:mga0rr50_41691_c1 3300050513 Bacteria 3347
591 nmdc:mga0rr50_53617_c1 3300050513 Bacteria 3000
592 nmdc:mga08x19_2083_c1 3300050514 Bacteria 12224
593 nmdc:mga08x19_97979_c1 3300050514 Bacteria 1942
594 Ga0495601_0081697 3300053077 Bacteria 2074
595 Ga0495612_0053083 3300053078 Bacteria 1669
596 Ga0495655_0000153 3300053083 Bacteria 12928
597 Ga0501084_0084443 3300054114 Unclassified 2665
598 Ga0501084_0087948 3300054114 Bacteria 2609
599 Ga0501084_0111016 3300054114 Bacteria 2304
600 Ga0590074_032420 3300059423 Unclassified 925
601 Ga0501082_0044269 3300060353 Unclassified 3839
602 Ga0501082_0227956 3300060353 Bacteria 1622
603 Ga0501082_0375206 3300060353 Unclassified 1241

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0579213 Ga0501081_0579213_121_819 231
2 3300035691 Ga0373931_0382352 Ga0373931_0382352_12_719 234
3 3300048909 Ga0496106_0341583 Ga0496106_0341583_175_912 244
4 3300049763 Ga0501266_004292 Ga0501266_004292_956_1708 249
5 3300049823 Ga0501044_0460107 Ga0501044_0460107_47_820 256
6 3300048918 Ga0496115_0629583 Ga0496115_0629583_30_818 261
7 3300044735 Ga0466968_0034413 Ga0466968_0034413_1291_2097 262
8 3300009545 Ga0105237_10323838 Ga0105237_103238382 267
9 3300046520 Ga0495637_0005060 Ga0495637_0005060_5904_6746 274
10 3300048924 Ga0496121_0038361 Ga0496121_0038361_3381_4223 274
11 3300049654 Ga0501207_001130 Ga0501207_001130_1704_2534 275
12 3300005335 Ga0070666_10000124 Ga0070666_1000012422 279
13 3300049579 Ga0501043_0176580 Ga0501043_0176580_644_1486 279
14 3300060353 Ga0501082_0227956 Ga0501082_0227956_501_1343 279
15 3300035725 Ga0373947_0058119 Ga0373947_0058119_1488_2333 280
16 3300006844 Ga0075428_100080946 Ga0075428_1000809463 281
17 3300006846 Ga0075430_100001931 Ga0075430_10000193122 281
18 3300006880 Ga0075429_100001796 Ga0075429_10000179619 281
19 3300027526 Ga0209968_1001627 Ga0209968_10016273 281
20 3300027876 Ga0209974_10000783 Ga0209974_100007834 281
21 3300031548 Ga0307408_100173646 Ga0307408_1001736461 281
22 3300031731 Ga0307405_10038380 Ga0307405_100383802 281
23 3300031911 Ga0307412_10010073 Ga0307412_100100735 281
24 3300045051 Ga0451576_0237364 Ga0451576_0237364_945_1805 281
25 3300006847 Ga0075431_100058652 Ga0075431_1000586523 282
26 3300006852 Ga0075433_10143132 Ga0075433_101431322 282
27 3300006914 Ga0075436_100010008 Ga0075436_1000100083 282
28 3300009094 Ga0111539_10111448 Ga0111539_101114483 282
29 3300009147 Ga0114129_10063361 Ga0114129_100633616 282
30 3300009176 Ga0105242_10238692 Ga0105242_102386922 282
31 3300013297 Ga0157378_10105579 Ga0157378_101055792 282
32 3300049592 Ga0501076_0123706 Ga0501076_0123706_235_1089 282
33 3300050507 nmdc:mga05p37_49626_c1 nmdc:mga05p37_49626_c1_860_1711 282
34 3300050510 nmdc:mga06r32_124908_c1 nmdc:mga06r32_124908_c1_169_1023 282
35 3300050511 nmdc:mga08y16_92554_c1 nmdc:mga08y16_92554_c1_124_990 282
36 3300050512 nmdc:mga0n895_2535_c1 nmdc:mga0n895_2535_c1_11812_12678 282
37 3300050514 nmdc:mga08x19_2083_c1 nmdc:mga08x19_2083_c1_3346_4212 282
38 3300060353 Ga0501082_0375206 Ga0501082_0375206_322_1176 282
39 3300003751 Ga0055538_1000126 Ga0055538_100012643 283
40 3300006846 Ga0075430_100001814 Ga0075430_1000018145 283
41 3300006846 Ga0075430_100037853 Ga0075430_1000378532 283
42 3300006847 Ga0075431_100002763 Ga0075431_1000027636 283
43 3300006847 Ga0075431_100012438 Ga0075431_1000124382 283
44 3300006880 Ga0075429_100032924 Ga0075429_1000329242 283
45 3300006880 Ga0075429_100050232 Ga0075429_1000502322 283
46 3300006914 Ga0075436_100029754 Ga0075436_1000297542 283
47 3300009147 Ga0114129_10128329 Ga0114129_101283292 283
48 3300031548 Ga0307408_100069928 Ga0307408_1000699282 283
49 3300031548 Ga0307408_100262310 Ga0307408_1002623102 283
50 3300031903 Ga0307407_10065108 Ga0307407_100651082 283
51 3300031995 Ga0307409_100119546 Ga0307409_1001195462 283
52 3300032005 Ga0307411_10158785 Ga0307411_101587852 283
53 3300032126 Ga0307415_100389003 Ga0307415_1003890032 283
54 3300047470 Ga0495681_0014794 Ga0495681_0014794_3344_4243 283
55 3300048919 Ga0496116_0005542 Ga0496116_0005542_593_1504 283
56 3300048919 Ga0496116_0081218 Ga0496116_0081218_650_1549 283
57 3300048919 Ga0496116_0148207 Ga0496116_0148207_364_1263 283
58 3300048920 Ga0496117_0003330 Ga0496117_0003330_5787_6698 283
59 3300048920 Ga0496117_0049711 Ga0496117_0049711_366_1265 283
60 3300048921 Ga0496118_0041810 Ga0496118_0041810_529_1428 283
61 3300048921 Ga0496118_0160797 Ga0496118_0160797_56_955 283
62 3300048922 Ga0496119_0000331 Ga0496119_0000331_19315_20226 283
63 3300048922 Ga0496119_0007134 Ga0496119_0007134_7895_8794 283
64 3300048923 Ga0496120_0000298 Ga0496120_0000298_45947_46858 283
65 3300048923 Ga0496120_0053503 Ga0496120_0053503_603_1502 283
66 3300048924 Ga0496121_0029992 Ga0496121_0029992_3048_3947 283
67 3300048924 Ga0496121_0038631 Ga0496121_0038631_1607_2506 283
68 3300048925 Ga0496122_0032403 Ga0496122_0032403_1036_1947 283
69 3300048925 Ga0496122_0093181 Ga0496122_0093181_30_941 283
70 3300048925 Ga0496122_0109044 Ga0496122_0109044_387_1286 283
71 3300048926 Ga0496123_0020096 Ga0496123_0020096_3791_4690 283
72 3300048926 Ga0496123_0045676 Ga0496123_0045676_1410_2321 283
73 3300048927 Ga0496124_0000824 Ga0496124_0000824_45933_46844 283
74 3300048927 Ga0496124_0045247 Ga0496124_0045247_2702_3601 283
75 3300048928 Ga0496125_0002758 Ga0496125_0002758_539_1438 283
76 3300048929 Ga0496126_0001009 Ga0496126_0001009_1062_1973 283
77 3300048929 Ga0496126_0003928 Ga0496126_0003928_1035_1946 283
78 3300048929 Ga0496126_0005903 Ga0496126_0005903_7366_8265 283
79 3300049574 Ga0501038_0181506 Ga0501038_0181506_127_996 283
80 3300049576 Ga0501040_0056996 Ga0501040_0056996_1707_2576 283
81 3300049578 Ga0501042_0092930 Ga0501042_0092930_160_1029 283
82 3300049580 Ga0501046_0091337 Ga0501046_0091337_830_1699 283
83 3300049584 Ga0501068_0221610 Ga0501068_0221610_42_908 283
84 3300049584 Ga0501068_0235044 Ga0501068_0235044_185_1054 283
85 3300049587 Ga0501071_0197984 Ga0501071_0197984_20_889 283
86 3300049588 Ga0501072_0002709 Ga0501072_0002709_11779_12648 283
87 3300049590 Ga0501074_0059188 Ga0501074_0059188_547_1416 283
88 3300049591 Ga0501075_0076413 Ga0501075_0076413_785_1654 283
89 3300049592 Ga0501076_0101555 Ga0501076_0101555_268_1137 283
90 3300049593 Ga0501077_0021039 Ga0501077_0021039_1403_2272 283
91 3300049741 Ga0501079_0009853 Ga0501079_0009853_2674_3543 283
92 3300049744 Ga0501083_0272188 Ga0501083_0272188_72_941 283
93 3300049824 Ga0501045_0047578 Ga0501045_0047578_151_1020 283
94 3300050507 nmdc:mga05p37_37981_c1 nmdc:mga05p37_37981_c1_4454_5320 283
95 3300050508 nmdc:mga09592_13200_c1 nmdc:mga09592_13200_c1_4537_5406 283
96 3300050508 nmdc:mga09592_88210_c1 nmdc:mga09592_88210_c1_1438_2307 283
97 3300050509 nmdc:mga0qj67_40926_c1 nmdc:mga0qj67_40926_c1_255_1124 283
98 3300050510 nmdc:mga06r32_136762_c1 nmdc:mga06r32_136762_c1_1482_2351 283
99 3300054114 Ga0501084_0111016 Ga0501084_0111016_365_1234 283
100 iso_pu_bacteria 2548877040 2550903681 283
101 iso_pu_bacteria 2563366752 2563929097 283
102 iso_pu_bacteria 2571042143 2571528397 283
103 iso_pu_bacteria 2600255286 2601640964 283
104 iso_pu_bacteria 2721755693 2723601534 283
105 iso_pu_bacteria 2728368933 2728532010 283
106 iso_pu_bacteria 2728369359 2730137657 283
107 iso_pu_bacteria 2751185905 2753811256 283
108 iso_pu_bacteria 2802428803 2802440475 283
109 iso_pu_bacteria 2889276214 2889277627 283
110 iso_pu_bacteria 2904595352 2904599908 283
111 iso_pu_bacteria 2939702853 2939706219 283
112 iso_pu_bacteria 2971403814 2971410128 283
113 iso_pu_bacteria 2984527788 2984532101 283
114 iso_pu_bacteria 2984532647 2984533356 283
115 iso_pu_bacteria 2996706504 2996710475 283
116 iso_pu_bacteria 648028048 648168117 283
117 iso_pu_bacteria 8054465665 8054472023 283
118 iso_pu_bacteria 8055632911 8055636761 283
119 iso_pu_bacteria 8057473075 8057477674 283
120 iso_pu_bacteria 8057977335 8057980085 283
121 3300002737 JGI25162J39368_1007939 JGI25162J39368_10079392 284
122 3300009011 Ga0105251_10023712 Ga0105251_100237122 284
123 3300009036 Ga0105244_10017743 Ga0105244_100177433 284
124 3300009036 Ga0105244_10020062 Ga0105244_100200624 284
125 3300011119 Ga0105246_10001872 Ga0105246_100018724 284
126 3300025225 Ga0209566_105848 Ga0209566_1058482 284
127 3300025233 Ga0209437_100489 Ga0209437_1004894 284
128 3300046515 Ga0495620_0000908 Ga0495620_0000908_6669_7538 284
129 3300048919 Ga0496116_0015980 Ga0496116_0015980_1141_2040 284
130 3300048925 Ga0496122_0013991 Ga0496122_0013991_454_1353 284
131 3300048927 Ga0496124_0067962 Ga0496124_0067962_962_1861 284
132 3300048928 Ga0496125_0033730 Ga0496125_0033730_3030_3929 284
133 3300049680 Ga0501250_000241 Ga0501250_000241_1273_2139 284
134 iso_pu_bacteria 2643221543 2643737599 284
135 iso_pu_bacteria 2821111986 2821118009 284
136 iso_pu_bacteria 2864733723 2864739504 284
137 iso_pu_bacteria 2885526491 2885529985 284
138 iso_pu_bacteria 2889042446 2889042625 284
139 iso_pu_bacteria 2904162308 2904167169 284
140 iso_pu_bacteria 2904490793 2904496564 284
141 iso_pu_bacteria 2919160200 2919165722 284
142 iso_pu_bacteria 2931384279 2931386050 284
143 iso_pu_bacteria 2939679117 2939684259 284
144 iso_pu_bacteria 2945991243 2945995341 284
145 iso_pu_bacteria 2946053406 2946058045 284
146 3300005329 Ga0070683_100000068 Ga0070683_10000006839 285
147 3300005331 Ga0070670_100000307 Ga0070670_10000030713 285
148 3300005331 Ga0070670_100031503 Ga0070670_1000315032 285
149 3300005334 Ga0068869_100003954 Ga0068869_1000039548 285
150 3300005334 Ga0068869_100136693 Ga0068869_1001366931 285
151 3300005334 Ga0068869_100202865 Ga0068869_1002028652 285
152 3300005336 Ga0070680_100048137 Ga0070680_1000481376 285
153 3300005337 Ga0070682_100000001 Ga0070682_100000001507 285
154 3300005337 Ga0070682_100204792 Ga0070682_1002047922 285
155 3300005338 Ga0068868_100054885 Ga0068868_1000548853 285
156 3300005340 Ga0070689_100000313 Ga0070689_10000031321 285
157 3300005343 Ga0070687_100002787 Ga0070687_1000027875 285
158 3300005354 Ga0070675_100000048 Ga0070675_10000004862 285
159 3300005367 Ga0070667_100283096 Ga0070667_1002830962 285
160 3300005435 Ga0070714_100340749 Ga0070714_1003407492 285
161 3300005436 Ga0070713_100037861 Ga0070713_1000378612 285
162 3300005441 Ga0070700_100000025 Ga0070700_10000002563 285
163 3300005445 Ga0070708_100015454 Ga0070708_1000154546 285
164 3300005445 Ga0070708_100050180 Ga0070708_1000501804 285
165 3300005445 Ga0070708_100303585 Ga0070708_1003035851 285
166 3300005456 Ga0070678_100059795 Ga0070678_1000597954 285
167 3300005467 Ga0070706_100043744 Ga0070706_1000437442 285
168 3300005467 Ga0070706_100063371 Ga0070706_1000633713 285
169 3300005467 Ga0070706_100251593 Ga0070706_1002515932 285
170 3300005467 Ga0070706_100333815 Ga0070706_1003338152 285
171 3300005467 Ga0070706_100372606 Ga0070706_1003726062 285
172 3300005468 Ga0070707_100004121 Ga0070707_1000041216 285
173 3300005468 Ga0070707_100011738 Ga0070707_1000117388 285
174 3300005468 Ga0070707_100054608 Ga0070707_1000546082 285
175 3300005468 Ga0070707_100332233 Ga0070707_1003322331 285
176 3300005468 Ga0070707_100357795 Ga0070707_1003577952 285
177 3300005471 Ga0070698_100039345 Ga0070698_1000393455 285
178 3300005471 Ga0070698_100078905 Ga0070698_1000789054 285
179 3300005471 Ga0070698_100129104 Ga0070698_1001291043 285
180 3300005471 Ga0070698_100207217 Ga0070698_1002072172 285
181 3300005518 Ga0070699_100017241 Ga0070699_1000172415 285
182 3300005518 Ga0070699_100037743 Ga0070699_1000377432 285
183 3300005518 Ga0070699_100173255 Ga0070699_1001732552 285
184 3300005518 Ga0070699_100196556 Ga0070699_1001965562 285
185 3300005518 Ga0070699_100340823 Ga0070699_1003408232 285
186 3300005535 Ga0070684_100000096 Ga0070684_10000009622 285
187 3300005535 Ga0070684_100369102 Ga0070684_1003691021 285
188 3300005536 Ga0070697_100065749 Ga0070697_1000657494 285
189 3300005536 Ga0070697_100129779 Ga0070697_1001297792 285
190 3300005536 Ga0070697_100385692 Ga0070697_1003856921 285
191 3300005539 Ga0068853_100217588 Ga0068853_1002175882 285
192 3300005543 Ga0070672_100000816 Ga0070672_10000081621 285
193 3300005546 Ga0070696_100254960 Ga0070696_1002549602 285
194 3300005547 Ga0070693_100033852 Ga0070693_1000338523 285
195 3300005577 Ga0068857_100017024 Ga0068857_1000170244 285
196 3300005578 Ga0068854_100013751 Ga0068854_1000137517 285
197 3300005578 Ga0068854_100119965 Ga0068854_1001199651 285
198 3300005615 Ga0070702_100174268 Ga0070702_1001742682 285
199 3300005618 Ga0068864_100000997 Ga0068864_10000099712 285
200 3300005719 Ga0068861_100325594 Ga0068861_1003255941 285
201 3300005842 Ga0068858_100002023 Ga0068858_1000020232 285
202 3300006028 Ga0070717_10000082 Ga0070717_1000008267 285
203 3300006028 Ga0070717_10115019 Ga0070717_101150193 285
204 3300006028 Ga0070717_10264531 Ga0070717_102645312 285
205 3300006844 Ga0075428_100003895 Ga0075428_10000389510 285
206 3300006844 Ga0075428_100476298 Ga0075428_1004762982 285
207 3300006847 Ga0075431_100010356 Ga0075431_1000103568 285
208 3300006881 Ga0068865_100033932 Ga0068865_1000339324 285
209 3300006914 Ga0075436_100154885 Ga0075436_1001548852 285
210 3300007076 Ga0075435_100044239 Ga0075435_1000442392 285
211 3300007076 Ga0075435_100054757 Ga0075435_1000547572 285
212 3300007076 Ga0075435_100138974 Ga0075435_1001389742 285
213 3300009036 Ga0105244_10024614 Ga0105244_100246142 285
214 3300009094 Ga0111539_10000052 Ga0111539_1000005247 285
215 3300009098 Ga0105245_10000226 Ga0105245_1000022648 285
216 3300009098 Ga0105245_10001090 Ga0105245_1000109011 285
217 3300009098 Ga0105245_10003826 Ga0105245_100038265 285
218 3300009147 Ga0114129_10306441 Ga0114129_103064412 285
219 3300009147 Ga0114129_10613821 Ga0114129_106138212 285
220 3300009176 Ga0105242_10004808 Ga0105242_100048086 285
221 3300009177 Ga0105248_10216482 Ga0105248_102164822 285
222 3300009177 Ga0105248_10545825 Ga0105248_105458251 285
223 3300009551 Ga0105238_10000001 Ga0105238_10000001586 285
224 3300010375 Ga0105239_10057370 Ga0105239_100573705 285
225 3300013105 Ga0157369_10000539 Ga0157369_1000053929 285
226 3300013296 Ga0157374_10000012 Ga0157374_10000012154 285
227 3300013297 Ga0157378_10003527 Ga0157378_100035278 285
228 3300013297 Ga0157378_10005757 Ga0157378_100057577 285
229 3300013297 Ga0157378_10041805 Ga0157378_100418054 285
230 3300013306 Ga0163162_10025250 Ga0163162_100252504 285
231 3300013308 Ga0157375_10000008 Ga0157375_10000008175 285
232 3300013308 Ga0157375_10000146 Ga0157375_1000014672 285
233 3300014325 Ga0163163_10457989 Ga0163163_104579892 285
234 3300014326 Ga0157380_10018575 Ga0157380_100185759 285
235 3300014745 Ga0157377_10000002 Ga0157377_10000002286 285
236 3300014745 Ga0157377_10000024 Ga0157377_10000024105 285
237 3300014969 Ga0157376_10000025 Ga0157376_1000002557 285
238 3300021358 Ga0213873_10000002 Ga0213873_10000002889 285
239 3300021358 Ga0213873_10005074 Ga0213873_100050742 285
240 3300021384 Ga0213876_10000001 Ga0213876_10000001972 285
241 3300021384 Ga0213876_10000080 Ga0213876_1000008051 285
242 3300021384 Ga0213876_10033554 Ga0213876_100335542 285
243 3300025728 Ga0207655_1033348 Ga0207655_10333482 285
244 3300025909 Ga0207705_10023924 Ga0207705_100239241 285
245 3300025910 Ga0207684_10037756 Ga0207684_100377565 285
246 3300025917 Ga0207660_10054213 Ga0207660_100542134 285
247 3300025918 Ga0207662_10001748 Ga0207662_100017485 285
248 3300025922 Ga0207646_10053889 Ga0207646_100538894 285
249 3300025922 Ga0207646_10091400 Ga0207646_100914002 285
250 3300025922 Ga0207646_10115271 Ga0207646_101152712 285
251 3300025924 Ga0207694_10000001 Ga0207694_100000011627 285
252 3300025925 Ga0207650_10000262 Ga0207650_1000026240 285
253 3300025925 Ga0207650_10040481 Ga0207650_100404814 285
254 3300025926 Ga0207659_10000007 Ga0207659_10000007291 285
255 3300025927 Ga0207687_10000003 Ga0207687_10000003214 285
256 3300025927 Ga0207687_10000589 Ga0207687_1000058911 285
257 3300025927 Ga0207687_10002009 Ga0207687_100020096 285
258 3300025928 Ga0207700_10025113 Ga0207700_100251132 285
259 3300025934 Ga0207686_10006165 Ga0207686_100061655 285
260 3300025936 Ga0207670_10000755 Ga0207670_1000075512 285
261 3300025940 Ga0207691_10000269 Ga0207691_1000026940 285
262 3300025940 Ga0207691_10409083 Ga0207691_104090832 285
263 3300025941 Ga0207711_10138751 Ga0207711_101387512 285
264 3300025941 Ga0207711_10344327 Ga0207711_103443272 285
265 3300025941 Ga0207711_10382035 Ga0207711_103820351 285
266 3300025942 Ga0207689_10013865 Ga0207689_100138654 285
267 3300025942 Ga0207689_10053262 Ga0207689_100532624 285
268 3300025944 Ga0207661_10000001 Ga0207661_10000001182 285
269 3300025960 Ga0207651_10014030 Ga0207651_100140305 285
270 3300025981 Ga0207640_10006617 Ga0207640_100066173 285
271 3300025981 Ga0207640_10044675 Ga0207640_100446753 285
272 3300026023 Ga0207677_10000045 Ga0207677_10000045100 285
273 3300026023 Ga0207677_10000633 Ga0207677_1000063315 285
274 3300026035 Ga0207703_10000104 Ga0207703_100001042 285
275 3300026041 Ga0207639_10000051 Ga0207639_1000005183 285
276 3300026041 Ga0207639_10182832 Ga0207639_101828321 285
277 3300026075 Ga0207708_10000052 Ga0207708_1000005241 285
278 3300026095 Ga0207676_10000013 Ga0207676_10000013211 285
279 3300026116 Ga0207674_10051491 Ga0207674_100514912 285
280 3300026118 Ga0207675_100021034 Ga0207675_1000210341 285
281 3300026121 Ga0207683_10036611 Ga0207683_100366113 285
282 3300027907 Ga0207428_10000003 Ga0207428_1000000347 285
283 3300030521 Ga0307511_10009303 Ga0307511_1000930310 285
284 3300032002 Ga0307416_100276082 Ga0307416_1002760822 285
285 3300035112 Ga0373932_0002001 Ga0373932_0002001_1501_2367 285
286 3300039437 Ga0436365_0404975 Ga0436365_0404975_123016_123882 285
287 3300039437 Ga0436365_1042710 Ga0436365_1042710_14433_15299 285
288 3300039437 Ga0436365_1645708 Ga0436365_1645708_34464_35330 285
289 3300039453 Ga0436362_0551129 Ga0436362_0551129_5346_6212 285
290 3300039453 Ga0436362_0660519 Ga0436362_0660519_36353_37219 285
291 3300041496 Ga0451839_0558968 Ga0451839_0558968_2054_2920 285
292 3300042876 Ga0451577_0027632 Ga0451577_0027632_1256_2128 285
293 3300044673 Ga0453683_0010212 Ga0453683_0010212_4585_5451 285
294 3300044712 Ga0453684_0039042 Ga0453684_0039042_3020_3892 285
295 3300049589 Ga0501073_0000867 Ga0501073_0000867_19549_20436 285
296 3300050507 nmdc:mga05p37_158979_c1 nmdc:mga05p37_158979_c1_1684_2553 285
297 3300050510 nmdc:mga06r32_2480_c1 nmdc:mga06r32_2480_c1_1117_2043 285
298 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_870948_871814 285
299 3300050513 nmdc:mga0rr50_37_c1 nmdc:mga0rr50_37_c1_1135_2001 285
300 3300050513 nmdc:mga0rr50_41691_c1 nmdc:mga0rr50_41691_c1_724_1599 285
301 3300050513 nmdc:mga0rr50_53617_c1 nmdc:mga0rr50_53617_c1_498_1364 285
302 3300050514 nmdc:mga08x19_97979_c1 nmdc:mga08x19_97979_c1_456_1322 285
303 3300053083 Ga0495655_0000153 Ga0495655_0000153_3931_4797 285
304 3300003373 JGI25407J50210_10003315 JGI25407J50210_100033151 286
305 3300005445 Ga0070708_100188626 Ga0070708_1001886262 286
306 3300005468 Ga0070707_100023978 Ga0070707_1000239783 286
307 3300005937 Ga0081455_10031389 Ga0081455_100313893 286
308 3300005981 Ga0081538_10002079 Ga0081538_100020799 286
309 3300005981 Ga0081538_10002290 Ga0081538_1000229018 286
310 3300005981 Ga0081538_10018162 Ga0081538_100181622 286
311 3300006237 Ga0097621_100211511 Ga0097621_1002115112 286
312 3300006844 Ga0075428_100893862 Ga0075428_1008938621 286
313 3300006847 Ga0075431_100082208 Ga0075431_1000822083 286
314 3300006847 Ga0075431_100355227 Ga0075431_1003552271 286
315 3300006871 Ga0075434_100275753 Ga0075434_1002757532 286
316 3300009094 Ga0111539_10233267 Ga0111539_102332672 286
317 3300009147 Ga0114129_10091236 Ga0114129_100912361 286
318 3300013306 Ga0163162_10169426 Ga0163162_101694262 286
319 3300025919 Ga0207657_10245055 Ga0207657_102450552 286
320 3300025922 Ga0207646_10032240 Ga0207646_100322403 286
321 3300050507 nmdc:mga05p37_73036_c1 nmdc:mga05p37_73036_c1_3220_4083 286
322 3300050510 nmdc:mga06r32_54931_c1 nmdc:mga06r32_54931_c1_2070_2933 286
323 3300001990 JGI24737J22298_10045331 JGI24737J22298_100453312 287
324 3300005295 Ga0065707_10082720 Ga0065707_100827208 287
325 3300005295 Ga0065707_10116780 Ga0065707_101167803 287
326 3300005295 Ga0065707_10123525 Ga0065707_101235252 287
327 3300005328 Ga0070676_10006744 Ga0070676_100067446 287
328 3300005330 Ga0070690_100001073 Ga0070690_10000107314 287
329 3300005330 Ga0070690_100135706 Ga0070690_1001357062 287
330 3300005330 Ga0070690_100210215 Ga0070690_1002102152 287
331 3300005335 Ga0070666_10052647 Ga0070666_100526472 287
332 3300005336 Ga0070680_100010960 Ga0070680_1000109602 287
333 3300005338 Ga0068868_100003075 Ga0068868_1000030757 287
334 3300005339 Ga0070660_100031892 Ga0070660_1000318922 287
335 3300005340 Ga0070689_100000158 Ga0070689_10000015829 287
336 3300005340 Ga0070689_100302634 Ga0070689_1003026342 287
337 3300005343 Ga0070687_100019380 Ga0070687_1000193803 287
338 3300005344 Ga0070661_100091668 Ga0070661_1000916681 287
339 3300005347 Ga0070668_100301993 Ga0070668_1003019931 287
340 3300005353 Ga0070669_100058795 Ga0070669_1000587953 287
341 3300005354 Ga0070675_100000972 Ga0070675_1000009727 287
342 3300005354 Ga0070675_100351520 Ga0070675_1003515202 287
343 3300005355 Ga0070671_100029539 Ga0070671_1000295391 287
344 3300005356 Ga0070674_100000802 Ga0070674_10000080215 287
345 3300005364 Ga0070673_100000143 Ga0070673_1000001436 287
346 3300005365 Ga0070688_100000873 Ga0070688_1000008738 287
347 3300005365 Ga0070688_100032751 Ga0070688_1000327513 287
348 3300005366 Ga0070659_100055925 Ga0070659_1000559252 287
349 3300005435 Ga0070714_100150207 Ga0070714_1001502072 287
350 3300005437 Ga0070710_10097847 Ga0070710_100978472 287
351 3300005438 Ga0070701_10000590 Ga0070701_100005907 287
352 3300005441 Ga0070700_100008756 Ga0070700_1000087564 287
353 3300005444 Ga0070694_100017884 Ga0070694_1000178844 287
354 3300005444 Ga0070694_100023393 Ga0070694_1000233931 287
355 3300005445 Ga0070708_100028093 Ga0070708_1000280936 287
356 3300005445 Ga0070708_100347490 Ga0070708_1003474901 287
357 3300005456 Ga0070678_100000378 Ga0070678_1000003785 287
358 3300005457 Ga0070662_100014731 Ga0070662_1000147313 287
359 3300005458 Ga0070681_10023873 Ga0070681_100238736 287
360 3300005458 Ga0070681_10222263 Ga0070681_102222631 287
361 3300005459 Ga0068867_100017876 Ga0068867_1000178764 287
362 3300005459 Ga0068867_100066323 Ga0068867_1000663233 287
363 3300005459 Ga0068867_100122130 Ga0068867_1001221302 287
364 3300005466 Ga0070685_10001043 Ga0070685_100010439 287
365 3300005466 Ga0070685_10088965 Ga0070685_100889653 287
366 3300005468 Ga0070707_100000111 Ga0070707_10000011147 287
367 3300005468 Ga0070707_100053740 Ga0070707_1000537404 287
368 3300005471 Ga0070698_100145050 Ga0070698_1001450503 287
369 3300005471 Ga0070698_100226469 Ga0070698_1002264692 287
370 3300005518 Ga0070699_100013096 Ga0070699_1000130964 287
371 3300005518 Ga0070699_100067647 Ga0070699_1000676473 287
372 3300005518 Ga0070699_100107172 Ga0070699_1001071723 287
373 3300005518 Ga0070699_100531375 Ga0070699_1005313751 287
374 3300005530 Ga0070679_100194369 Ga0070679_1001943693 287
375 3300005536 Ga0070697_100016123 Ga0070697_1000161232 287
376 3300005536 Ga0070697_100054865 Ga0070697_1000548652 287
377 3300005543 Ga0070672_100000197 Ga0070672_10000019733 287
378 3300005543 Ga0070672_100089388 Ga0070672_1000893883 287
379 3300005544 Ga0070686_100000174 Ga0070686_10000017436 287
380 3300005544 Ga0070686_100001516 Ga0070686_10000151611 287
381 3300005544 Ga0070686_100087711 Ga0070686_1000877112 287
382 3300005544 Ga0070686_100119575 Ga0070686_1001195752 287
383 3300005545 Ga0070695_100010445 Ga0070695_1000104453 287
384 3300005545 Ga0070695_100053395 Ga0070695_1000533952 287
385 3300005545 Ga0070695_100163353 Ga0070695_1001633532 287
386 3300005546 Ga0070696_100018688 Ga0070696_1000186882 287
387 3300005546 Ga0070696_100071775 Ga0070696_1000717752 287
388 3300005546 Ga0070696_100140375 Ga0070696_1001403751 287
389 3300005546 Ga0070696_100142984 Ga0070696_1001429841 287
390 3300005548 Ga0070665_100492611 Ga0070665_1004926112 287
391 3300005549 Ga0070704_100053926 Ga0070704_1000539262 287
392 3300005549 Ga0070704_100107701 Ga0070704_1001077012 287
393 3300005549 Ga0070704_100112327 Ga0070704_1001123273 287
394 3300005564 Ga0070664_100001536 Ga0070664_1000015362 287
395 3300005564 Ga0070664_100017169 Ga0070664_1000171693 287
396 3300005578 Ga0068854_100048947 Ga0068854_1000489472 287
397 3300005615 Ga0070702_100008166 Ga0070702_1000081661 287
398 3300005617 Ga0068859_100003507 Ga0068859_10000350710 287
399 3300005843 Ga0068860_100103379 Ga0068860_1001033792 287
400 3300005937 Ga0081455_10002418 Ga0081455_100024184 287
401 3300006163 Ga0070715_10064716 Ga0070715_100647162 287
402 3300006163 Ga0070715_10111335 Ga0070715_101113352 287
403 3300006173 Ga0070716_100049868 Ga0070716_1000498683 287
404 3300006173 Ga0070716_100107551 Ga0070716_1001075512 287
405 3300006237 Ga0097621_100007547 Ga0097621_1000075474 287
406 3300006237 Ga0097621_100015212 Ga0097621_1000152124 287
407 3300006237 Ga0097621_100196611 Ga0097621_1001966112 287
408 3300006358 Ga0068871_100018386 Ga0068871_1000183862 287
409 3300006358 Ga0068871_100023078 Ga0068871_1000230786 287
410 3300006844 Ga0075428_100044459 Ga0075428_1000444596 287
411 3300006846 Ga0075430_100002247 Ga0075430_1000022476 287
412 3300006846 Ga0075430_100173673 Ga0075430_1001736732 287
413 3300006852 Ga0075433_10078793 Ga0075433_100787933 287
414 3300006852 Ga0075433_10182979 Ga0075433_101829792 287
415 3300006852 Ga0075433_10316434 Ga0075433_103164342 287
416 3300006871 Ga0075434_100218520 Ga0075434_1002185201 287
417 3300006871 Ga0075434_100271478 Ga0075434_1002714783 287
418 3300006871 Ga0075434_100370437 Ga0075434_1003704372 287
419 3300006880 Ga0075429_100439037 Ga0075429_1004390372 287
420 3300006914 Ga0075436_100033049 Ga0075436_1000330493 287
421 3300006914 Ga0075436_100041870 Ga0075436_1000418703 287
422 3300006931 Ga0097620_100003507 Ga0097620_10000350710 287
423 3300007076 Ga0075435_100020219 Ga0075435_1000202196 287
424 3300007265 Ga0099794_10053906 Ga0099794_100539062 287
425 3300009093 Ga0105240_10634056 Ga0105240_106340561 287
426 3300009094 Ga0111539_10000081 Ga0111539_1000008181 287
427 3300009098 Ga0105245_10093804 Ga0105245_100938042 287
428 3300009176 Ga0105242_10136137 Ga0105242_101361372 287
429 3300009177 Ga0105248_10000986 Ga0105248_1000098636 287
430 3300009177 Ga0105248_10214972 Ga0105248_102149722 287
431 3300013102 Ga0157371_10015408 Ga0157371_100154082 287
432 3300013104 Ga0157370_10056802 Ga0157370_100568024 287
433 3300013105 Ga0157369_10696640 Ga0157369_106966401 287
434 3300013296 Ga0157374_10039617 Ga0157374_100396175 287
435 3300013297 Ga0157378_10000610 Ga0157378_1000061029 287
436 3300013297 Ga0157378_10061302 Ga0157378_100613024 287
437 3300013297 Ga0157378_10080404 Ga0157378_100804043 287
438 3300013307 Ga0157372_10301702 Ga0157372_103017022 287
439 3300013308 Ga0157375_10005069 Ga0157375_100050698 287
440 3300013308 Ga0157375_10056602 Ga0157375_100566025 287
441 3300014325 Ga0163163_10316225 Ga0163163_103162252 287
442 3300014326 Ga0157380_10000693 Ga0157380_100006936 287
443 3300014326 Ga0157380_10006017 Ga0157380_100060176 287
444 3300014326 Ga0157380_10034037 Ga0157380_100340376 287
445 3300014968 Ga0157379_10141149 Ga0157379_101411492 287
446 3300014969 Ga0157376_10005233 Ga0157376_100052335 287
447 3300025315 Ga0207697_10062047 Ga0207697_100620472 287
448 3300025885 Ga0207653_10073523 Ga0207653_100735232 287
449 3300025898 Ga0207692_10179711 Ga0207692_101797112 287
450 3300025903 Ga0207680_10164300 Ga0207680_101643002 287
451 3300025905 Ga0207685_10098803 Ga0207685_100988031 287
452 3300025907 Ga0207645_10011166 Ga0207645_100111662 287
453 3300025910 Ga0207684_10047017 Ga0207684_100470174 287
454 3300025910 Ga0207684_10258846 Ga0207684_102588462 287
455 3300025912 Ga0207707_10033042 Ga0207707_100330425 287
456 3300025916 Ga0207663_10016813 Ga0207663_100168133 287
457 3300025917 Ga0207660_10042127 Ga0207660_100421272 287
458 3300025917 Ga0207660_10050073 Ga0207660_100500731 287
459 3300025918 Ga0207662_10007817 Ga0207662_100078177 287
460 3300025918 Ga0207662_10092831 Ga0207662_100928313 287
461 3300025921 Ga0207652_10027811 Ga0207652_100278112 287
462 3300025921 Ga0207652_10220854 Ga0207652_102208542 287
463 3300025922 Ga0207646_10000163 Ga0207646_1000016350 287
464 3300025922 Ga0207646_10014015 Ga0207646_100140156 287
465 3300025923 Ga0207681_10058275 Ga0207681_100582751 287
466 3300025926 Ga0207659_10043589 Ga0207659_100435892 287
467 3300025926 Ga0207659_10299634 Ga0207659_102996341 287
468 3300025927 Ga0207687_10205637 Ga0207687_102056372 287
469 3300025931 Ga0207644_10053118 Ga0207644_100531183 287
470 3300025932 Ga0207690_10096302 Ga0207690_100963022 287
471 3300025933 Ga0207706_10003099 Ga0207706_1000309916 287
472 3300025934 Ga0207686_10149949 Ga0207686_101499491 287
473 3300025936 Ga0207670_10001520 Ga0207670_100015202 287
474 3300025937 Ga0207669_10020258 Ga0207669_100202584 287
475 3300025939 Ga0207665_10011128 Ga0207665_100111283 287
476 3300025940 Ga0207691_10000080 Ga0207691_1000008043 287
477 3300025940 Ga0207691_10082615 Ga0207691_100826153 287
478 3300025941 Ga0207711_10085133 Ga0207711_100851333 287
479 3300025942 Ga0207689_10156275 Ga0207689_101562751 287
480 3300025945 Ga0207679_10001532 Ga0207679_100015329 287
481 3300025960 Ga0207651_10000078 Ga0207651_1000007832 287
482 3300025960 Ga0207651_10284059 Ga0207651_102840592 287
483 3300025981 Ga0207640_10022528 Ga0207640_100225282 287
484 3300026023 Ga0207677_10097106 Ga0207677_100971062 287
485 3300026075 Ga0207708_10000207 Ga0207708_1000020735 287
486 3300026075 Ga0207708_10254334 Ga0207708_102543341 287
487 3300026089 Ga0207648_10006188 Ga0207648_100061886 287
488 3300026089 Ga0207648_10044257 Ga0207648_100442573 287
489 3300026089 Ga0207648_10328143 Ga0207648_103281432 287
490 3300026121 Ga0207683_10005661 Ga0207683_100056619 287
491 3300026121 Ga0207683_10614336 Ga0207683_106143361 287
492 3300027695 Ga0209966_1017447 Ga0209966_10174471 287
493 3300027907 Ga0207428_10004729 Ga0207428_100047299 287
494 3300028381 Ga0268264_10079364 Ga0268264_100793642 287
495 3300031852 Ga0307410_10195303 Ga0307410_101953031 287
496 3300031995 Ga0307409_100252355 Ga0307409_1002523552 287
497 3300032002 Ga0307416_100042987 Ga0307416_1000429873 287
498 3300032005 Ga0307411_10010860 Ga0307411_100108603 287
499 3300032005 Ga0307411_10450908 Ga0307411_104509081 287
500 3300035083 Ga0373926_0015991 Ga0373926_0015991_731_1597 287
501 3300035116 Ga0373945_0045156 Ga0373945_0045156_452_1318 287
502 3300035692 Ga0373935_0184308 Ga0373935_0184308_200_1066 287
503 3300035724 Ga0373933_0042796 Ga0373933_0042796_140_1006 287
504 3300036401 Ga0373937_0268739 Ga0373937_0268739_604_1470 287
505 3300037068 Ga0373925_0070409 Ga0373925_0070409_1575_2441 287
506 3300041411 Ga0439466_0057542 Ga0439466_0057542_380_1246 287
507 3300041999 Ga0439433_0037166 Ga0439433_0037166_187_1053 287
508 3300042006 Ga0439432_029127 Ga0439432_029127_241_1107 287
509 3300042010 Ga0439452_002900 Ga0439452_002900_3519_4385 287
510 3300042013 Ga0439456_024964 Ga0439456_024964_126_992 287
511 3300042015 Ga0439462_0021271 Ga0439462_0021271_380_1246 287
512 3300042156 Ga0439446_0008143 Ga0439446_0008143_1861_2727 287
513 3300042435 Ga0439434_0005421 Ga0439434_0005421_1218_2084 287
514 3300042437 Ga0439444_0013099 Ga0439444_0013099_373_1239 287
515 3300042461 Ga0439460_0008942 Ga0439460_0008942_889_1764 287
516 3300045051 Ga0451576_0004157 Ga0451576_0004157_4821_5687 287
517 3300045051 Ga0451576_0432850 Ga0451576_0432850_274_1140 287
518 3300045976 Ga0466967_0064347 Ga0466967_0064347_445_1311 287
519 3300046499 Ga0495594_0019012 Ga0495594_0019012_616_1482 287
520 3300046499 Ga0495594_0078748 Ga0495594_0078748_581_1447 287
521 3300046683 Ga0495658_0124447 Ga0495658_0124447_441_1307 287
522 3300047321 Ga0495676_0341787 Ga0495676_0341787_43_909 287
523 3300047322 Ga0495680_0019066 Ga0495680_0019066_2339_3205 287
524 3300047322 Ga0495680_0023451 Ga0495680_0023451_984_1850 287
525 3300048904 Ga0496101_0201695 Ga0496101_0201695_643_1509 287
526 3300048907 Ga0496104_0081394 Ga0496104_0081394_1666_2532 287
527 3300048911 Ga0496108_0036239 Ga0496108_0036239_1354_2220 287
528 3300048912 Ga0496109_0012412 Ga0496109_0012412_4876_5742 287
529 3300048913 Ga0496110_0271418 Ga0496110_0271418_534_1400 287
530 3300048917 Ga0496114_0004335 Ga0496114_0004335_5309_6175 287
531 3300049513 Ga0501290_000006 Ga0501290_000006_11781_12647 287
532 3300049514 Ga0501291_000100 Ga0501291_000100_1447_2313 287
533 3300049515 Ga0501292_000119 Ga0501292_000119_5905_6771 287
534 3300049516 Ga0501293_000069 Ga0501293_000069_5526_6392 287
535 3300049517 Ga0501294_000531 Ga0501294_000531_688_1554 287
536 3300049518 Ga0501295_000505 Ga0501295_000505_817_1683 287
537 3300049519 Ga0501296_000055 Ga0501296_000055_1622_2488 287
538 3300049520 Ga0501297_000036 Ga0501297_000036_2077_2943 287
539 3300049521 Ga0501298_000067 Ga0501298_000067_7856_8722 287
540 3300049522 Ga0501299_000019 Ga0501299_000019_7856_8722 287
541 3300049522 Ga0501299_022016 Ga0501299_022016_30_896 287
542 3300049523 Ga0501300_000028 Ga0501300_000028_20142_21008 287
543 3300049524 Ga0501301_000101 Ga0501301_000101_1380_2246 287
544 3300049525 Ga0501302_000132 Ga0501302_000132_1026_1892 287
545 3300049568 Ga0501031_0002722 Ga0501031_0002722_9048_9920 287
546 3300049568 Ga0501031_0013748 Ga0501031_0013748_3399_4265 287
547 3300049568 Ga0501031_0028809 Ga0501031_0028809_331_1197 287
548 3300049568 Ga0501031_0037335 Ga0501031_0037335_1318_2184 287
549 3300049569 Ga0501032_0012130 Ga0501032_0012130_3910_4776 287
550 3300049569 Ga0501032_0019570 Ga0501032_0019570_1485_2351 287
551 3300049570 Ga0501033_0127486 Ga0501033_0127486_900_1766 287
552 3300049572 Ga0501036_0015358 Ga0501036_0015358_3656_4522 287
553 3300049573 Ga0501037_0005036 Ga0501037_0005036_8192_9058 287
554 3300049573 Ga0501037_0028005 Ga0501037_0028005_1692_2564 287
555 3300049573 Ga0501037_0056965 Ga0501037_0056965_1173_2039 287
556 3300049573 Ga0501037_0092472 Ga0501037_0092472_862_1728 287
557 3300049574 Ga0501038_0002519 Ga0501038_0002519_13679_14545 287
558 3300049574 Ga0501038_0023120 Ga0501038_0023120_2636_3502 287
559 3300049574 Ga0501038_0029364 Ga0501038_0029364_337_1209 287
560 3300049575 Ga0501039_0001919 Ga0501039_0001919_7916_8788 287
561 3300049575 Ga0501039_0005939 Ga0501039_0005939_6087_6953 287
562 3300049575 Ga0501039_0021109 Ga0501039_0021109_556_1422 287
563 3300049575 Ga0501039_0032056 Ga0501039_0032056_389_1255 287
564 3300049575 Ga0501039_0039904 Ga0501039_0039904_2742_3608 287
565 3300049576 Ga0501040_0021975 Ga0501040_0021975_1108_1980 287
566 3300049576 Ga0501040_0315729 Ga0501040_0315729_132_998 287
567 3300049577 Ga0501041_0003539 Ga0501041_0003539_3225_4097 287
568 3300049578 Ga0501042_0001433 Ga0501042_0001433_1994_2866 287
569 3300049578 Ga0501042_0013466 Ga0501042_0013466_218_1084 287
570 3300049578 Ga0501042_0174000 Ga0501042_0174000_186_1052 287
571 3300049580 Ga0501046_0004340 Ga0501046_0004340_7085_7957 287
572 3300049580 Ga0501046_0011649 Ga0501046_0011649_6547_7413 287
573 3300049580 Ga0501046_0247533 Ga0501046_0247533_118_984 287
574 3300049582 Ga0501048_0003804 Ga0501048_0003804_3602_4474 287
575 3300049582 Ga0501048_0064663 Ga0501048_0064663_751_1617 287
576 3300049582 Ga0501048_0074444 Ga0501048_0074444_920_1786 287
577 3300049584 Ga0501068_0034500 Ga0501068_0034500_1310_2176 287
578 3300049587 Ga0501071_0027727 Ga0501071_0027727_2352_3224 287
579 3300049588 Ga0501072_0068011 Ga0501072_0068011_1207_2079 287
580 3300049591 Ga0501075_0008450 Ga0501075_0008450_3117_3983 287
581 3300049591 Ga0501075_0053736 Ga0501075_0053736_2067_2933 287
582 3300049592 Ga0501076_0013762 Ga0501076_0013762_4487_5359 287
583 3300049593 Ga0501077_0038008 Ga0501077_0038008_479_1345 287
584 3300049593 Ga0501077_0040188 Ga0501077_0040188_2042_2908 287
585 3300049649 Ga0501198_000924 Ga0501198_000924_1332_2198 287
586 3300049650 Ga0501199_000140 Ga0501199_000140_3207_4073 287
587 3300049651 Ga0501201_000548 Ga0501201_000548_1541_2407 287
588 3300049652 Ga0501202_002648 Ga0501202_002648_1924_2790 287
589 3300049653 Ga0501206_000044 Ga0501206_000044_4672_5538 287
590 3300049655 Ga0501208_000495 Ga0501208_000495_2024_2890 287
591 3300049660 Ga0501216_003634 Ga0501216_003634_234_1100 287
592 3300049663 Ga0501223_000510 Ga0501223_000510_4137_5003 287
593 3300049666 Ga0501228_000261 Ga0501228_000261_1757_2623 287
594 3300049667 Ga0501230_000608 Ga0501230_000608_1097_1963 287
595 3300049669 Ga0501235_000120 Ga0501235_000120_3637_4503 287
596 3300049672 Ga0501239_000073 Ga0501239_000073_1191_2057 287
597 3300049675 Ga0501243_000672 Ga0501243_000672_2639_3505 287
598 3300049676 Ga0501246_000145 Ga0501246_000145_659_1525 287
599 3300049679 Ga0501249_000424 Ga0501249_000424_8165_9031 287
600 3300049683 Ga0501253_000048 Ga0501253_000048_1832_2698 287
601 3300049688 Ga0501259_001393 Ga0501259_001393_1474_2340 287
602 3300049689 Ga0501260_000199 Ga0501260_000199_773_1639 287
603 3300049705 Ga0501225_0000414 Ga0501225_0000414_4934_5800 287
604 3300049706 Ga0501229_000122 Ga0501229_000122_88_954 287
605 3300049742 Ga0501080_0034665 Ga0501080_0034665_1355_2221 287
606 3300049743 Ga0501081_0046335 Ga0501081_0046335_1777_2643 287
607 3300049743 Ga0501081_0222191 Ga0501081_0222191_155_1021 287
608 3300049761 Ga0501264_001111 Ga0501264_001111_2170_3036 287
609 3300049762 Ga0501265_000946 Ga0501265_000946_689_1555 287
610 3300049767 Ga0501270_000296 Ga0501270_000296_2032_2898 287
611 3300049771 Ga0501274_000292 Ga0501274_000292_1845_2711 287
612 3300049772 Ga0501275_000725 Ga0501275_000725_528_1394 287
613 3300049774 Ga0501278_000609 Ga0501278_000609_544_1410 287
614 3300049775 Ga0501279_000476 Ga0501279_000476_3048_3914 287
615 3300049776 Ga0501280_003633 Ga0501280_003633_551_1417 287
616 3300049779 Ga0501283_000006 Ga0501283_000006_17525_18391 287
617 3300049822 Ga0501035_0008334 Ga0501035_0008334_8323_9195 287
618 3300049822 Ga0501035_0012688 Ga0501035_0012688_556_1422 287
619 3300049822 Ga0501035_0133891 Ga0501035_0133891_826_1692 287
620 3300049824 Ga0501045_0103171 Ga0501045_0103171_944_1810 287
621 3300049851 Ga0501212_005330 Ga0501212_005330_677_1543 287
622 3300049853 Ga0501226_002060 Ga0501226_002060_635_1501 287
623 3300050508 nmdc:mga09592_38682_c1 nmdc:mga09592_38682_c1_963_1829 287
624 3300050509 nmdc:mga0qj67_161965_c1 nmdc:mga0qj67_161965_c1_324_1190 287
625 3300050509 nmdc:mga0qj67_332798_c1 nmdc:mga0qj67_332798_c1_80_946 287
626 3300050509 nmdc:mga0qj67_33280_c1 nmdc:mga0qj67_33280_c1_913_1779 287
627 3300050510 nmdc:mga06r32_54184_c1 nmdc:mga06r32_54184_c1_2176_3042 287
628 3300050511 nmdc:mga08y16_196_c1 nmdc:mga08y16_196_c1_25904_26770 287
629 3300050512 nmdc:mga0n895_194417_c1 nmdc:mga0n895_194417_c1_1013_1879 287
630 3300050513 nmdc:mga0rr50_146437_c1 nmdc:mga0rr50_146437_c1_113_979 287
631 3300053077 Ga0495601_0081697 Ga0495601_0081697_440_1306 287
632 3300053078 Ga0495612_0053083 Ga0495612_0053083_739_1605 287
633 3300054114 Ga0501084_0084443 Ga0501084_0084443_1201_2067 287
634 3300054114 Ga0501084_0087948 Ga0501084_0087948_1471_2379 287
635 3300059423 Ga0590074_032420 Ga0590074_032420_38_904 287
636 3300060353 Ga0501082_0044269 Ga0501082_0044269_2144_3010 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

219

339

0.98

PF03668

RapZ-like_N

RapZ-like N-terminal domain

58

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9555 164 285
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9406 164 285
7e9v-assembly1.cif.gz_A the crystal structure of human ump-cmp kinase from biortus. 0.7054 4 159
1tev-assembly1.cif.gz_A crystal structure of the human ump/cmp kinase in open conformation 0.6955 6 159
3cm0-assembly1.cif.gz_A crystal structure of adenylate kinase from thermus thermophilus hb8 0.6617 4 154
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9818 171 283 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9031 171 283 3.40.50.720
1tevA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6955 6 159 3.40.50.300
af_O43012_3_162_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6943 7 154 3.40.50.300
af_Q55C94_4_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6883 5 155 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A661X7Z5-F1-model_v4 RapZ C-terminal domain-containing protein 0.9931 164 282 GO:0005524
AF-A0A174LCA3-F1-model_v4 GlmZ(SRNA)-inactivating NTPase 0.9921 164 286 GO:0005524
AF-A0A644XCL4-F1-model_v4 Nucleotide-binding protein 0.9912 166 285 GO:0005524
AF-X0TVE7-F1-model_v4 RapZ C-terminal domain-containing protein 0.9897 161 286 GO:0005524
AF-A0A3B0VBF3-F1-model_v4 RNase adapter protein RapZ 0.9891 164 286 GO:0005524

Feature Viewer

pLDDT pTM Quality
90.01 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map