F471320
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 636 | 346 | 603 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100369102|Ga0070684_1003691021 |
| Length | 340 |
| Sequence | VGHRRPRRCGADCYSPARPPAPHWSRLSPAGLPDVVNPGGALAPPRDKLDGVMPRPEYLVIITGLSGSGKSYVQSTLEDVGFYCCDNLPIELIEPFLEEVGAHENADRVGIVVDVRTHDFANVFPTFYRERIQKLVPHVVLIFLDASDEVLARRYSETRRPHPLAQNQPLLDAIVSERAALTEVKSLANMVLDTSQFSVHELKSEVMRRFELKDEKVTMLVTIVTFGFKYAMPYNVDLLFDVRFLPNPHFVESLRPKTGLDPEIVAYLKAQPGYDIFYDKLFDFVSYLLPQYQKEMKSYLTIGIGCTGGKHRSVAIGQRLADDLAGRGYAVEIVHRDCKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 2 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 3 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 4 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 5 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 6 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 7 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 8 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 9 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 10 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 11 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 12 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 13 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 14 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 15 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 16 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 17 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 18 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 19 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 20 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 21 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 22 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 23 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 24 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 25 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 26 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 27 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 28 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 31 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 212 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 213 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 214 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 215 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 216 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 217 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 218 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 219 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 243 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 244 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 245 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 246 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 247 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 248 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 249 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 254 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 256 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 258 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 259 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 261 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 262 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 263 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 264 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 265 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 292 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 293 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 295 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 297 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 298 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 301 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 302 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 306 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 318 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 319 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 320 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 321 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 341 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 343 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 344 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 345 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 346 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.81 |
| Metatranscriptomes | 0 |
| Isolates | 5.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 1.42 |
| Rhizosphere | 90.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10045331 | 3300001990 | Bacteria | 1343 |
| 2 | JGI25162J39368_1007939 | 3300002737 | Bacteria | 1579 |
| 3 | JGI25407J50210_10003315 | 3300003373 | Bacteria | 3838 |
| 4 | Ga0055538_1000126 | 3300003751 | Bacteria | 58193 |
| 5 | Ga0065707_10082720 | 3300005295 | Bacteria | 12520 |
| 6 | Ga0065707_10116780 | 3300005295 | Bacteria | 2193 |
| 7 | Ga0065707_10123525 | 3300005295 | Bacteria | 2063 |
| 8 | Ga0070676_10006744 | 3300005328 | Bacteria | 6149 |
| 9 | Ga0070683_100000068 | 3300005329 | Bacteria | 72997 |
| 10 | Ga0070690_100001073 | 3300005330 | Bacteria | 14017 |
| 11 | Ga0070690_100135706 | 3300005330 | Unclassified | 1666 |
| 12 | Ga0070690_100210215 | 3300005330 | Bacteria | 1358 |
| 13 | Ga0070670_100000307 | 3300005331 | Bacteria | 42018 |
| 14 | Ga0070670_100031503 | 3300005331 | Bacteria | 4567 |
| 15 | Ga0068869_100003954 | 3300005334 | Bacteria | 9154 |
| 16 | Ga0068869_100136693 | 3300005334 | Bacteria | 1889 |
| 17 | Ga0068869_100202865 | 3300005334 | Bacteria | 1564 |
| 18 | Ga0070666_10000124 | 3300005335 | Bacteria | 53897 |
| 19 | Ga0070666_10052647 | 3300005335 | Unclassified | 2743 |
| 20 | Ga0070680_100010960 | 3300005336 | Bacteria | 7008 |
| 21 | Ga0070680_100048137 | 3300005336 | Bacteria | 3474 |
| 22 | Ga0070682_100000001 | 3300005337 | Bacteria | 569837 |
| 23 | Ga0070682_100204792 | 3300005337 | Unclassified | 1394 |
| 24 | Ga0068868_100003075 | 3300005338 | Bacteria | 11612 |
| 25 | Ga0068868_100054885 | 3300005338 | Bacteria | 3142 |
| 26 | Ga0070660_100031892 | 3300005339 | Bacteria | 3962 |
| 27 | Ga0070689_100000158 | 3300005340 | Bacteria | 39830 |
| 28 | Ga0070689_100000313 | 3300005340 | Bacteria | 28319 |
| 29 | Ga0070689_100302634 | 3300005340 | Bacteria | 1331 |
| 30 | Ga0070687_100002787 | 3300005343 | Bacteria | 6647 |
| 31 | Ga0070687_100019380 | 3300005343 | Bacteria | 3164 |
| 32 | Ga0070661_100091668 | 3300005344 | Bacteria | 2251 |
| 33 | Ga0070668_100301993 | 3300005347 | Unclassified | 1343 |
| 34 | Ga0070669_100058795 | 3300005353 | Bacteria | 2822 |
| 35 | Ga0070675_100000048 | 3300005354 | Bacteria | 73894 |
| 36 | Ga0070675_100000972 | 3300005354 | Bacteria | 20492 |
| 37 | Ga0070675_100351520 | 3300005354 | Bacteria | 1307 |
| 38 | Ga0070671_100029539 | 3300005355 | Bacteria | 4519 |
| 39 | Ga0070674_100000802 | 3300005356 | Bacteria | 16179 |
| 40 | Ga0070673_100000143 | 3300005364 | Bacteria | 33944 |
| 41 | Ga0070688_100000873 | 3300005365 | Bacteria | 14990 |
| 42 | Ga0070688_100032751 | 3300005365 | Bacteria | 3137 |
| 43 | Ga0070659_100055925 | 3300005366 | Bacteria | 3111 |
| 44 | Ga0070667_100283096 | 3300005367 | Bacteria | 1489 |
| 45 | Ga0070714_100150207 | 3300005435 | Bacteria | 2099 |
| 46 | Ga0070714_100340749 | 3300005435 | Bacteria | 1406 |
| 47 | Ga0070713_100037861 | 3300005436 | Bacteria | 3903 |
| 48 | Ga0070710_10097847 | 3300005437 | Bacteria | 1742 |
| 49 | Ga0070701_10000590 | 3300005438 | Bacteria | 12673 |
| 50 | Ga0070700_100000025 | 3300005441 | Bacteria | 126198 |
| 51 | Ga0070700_100008756 | 3300005441 | Bacteria | 5524 |
| 52 | Ga0070694_100017884 | 3300005444 | Bacteria | 4486 |
| 53 | Ga0070694_100023393 | 3300005444 | Bacteria | 3973 |
| 54 | Ga0070708_100015454 | 3300005445 | Bacteria | 6307 |
| 55 | Ga0070708_100028093 | 3300005445 | Bacteria | 4837 |
| 56 | Ga0070708_100050180 | 3300005445 | Bacteria | 3694 |
| 57 | Ga0070708_100188626 | 3300005445 | Bacteria | 1928 |
| 58 | Ga0070708_100303585 | 3300005445 | Bacteria | 1503 |
| 59 | Ga0070708_100347490 | 3300005445 | Unclassified | 1398 |
| 60 | Ga0070678_100000378 | 3300005456 | Bacteria | 20834 |
| 61 | Ga0070678_100059795 | 3300005456 | Bacteria | 2802 |
| 62 | Ga0070662_100014731 | 3300005457 | Bacteria | 5226 |
| 63 | Ga0070681_10023873 | 3300005458 | Bacteria | 6156 |
| 64 | Ga0070681_10222263 | 3300005458 | Bacteria | 1804 |
| 65 | Ga0068867_100017876 | 3300005459 | Bacteria | 5036 |
| 66 | Ga0068867_100066323 | 3300005459 | Bacteria | 2688 |
| 67 | Ga0068867_100122130 | 3300005459 | Unclassified | 2015 |
| 68 | Ga0070685_10001043 | 3300005466 | Bacteria | 14871 |
| 69 | Ga0070685_10088965 | 3300005466 | Bacteria | 1866 |
| 70 | Ga0070706_100043744 | 3300005467 | Bacteria | 4137 |
| 71 | Ga0070706_100063371 | 3300005467 | Bacteria | 3416 |
| 72 | Ga0070706_100251593 | 3300005467 | Bacteria | 1649 |
| 73 | Ga0070706_100333815 | 3300005467 | Bacteria | 1414 |
| 74 | Ga0070706_100372606 | 3300005467 | Bacteria | 1330 |
| 75 | Ga0070707_100000111 | 3300005468 | Bacteria | 75249 |
| 76 | Ga0070707_100004121 | 3300005468 | Bacteria | 13642 |
| 77 | Ga0070707_100011738 | 3300005468 | Bacteria | 8177 |
| 78 | Ga0070707_100023978 | 3300005468 | Bacteria | 5773 |
| 79 | Ga0070707_100053740 | 3300005468 | Bacteria | 3862 |
| 80 | Ga0070707_100054608 | 3300005468 | Bacteria | 3830 |
| 81 | Ga0070707_100332233 | 3300005468 | Bacteria | 1477 |
| 82 | Ga0070707_100357795 | 3300005468 | Bacteria | 1418 |
| 83 | Ga0070698_100039345 | 3300005471 | Bacteria | 4868 |
| 84 | Ga0070698_100078905 | 3300005471 | Unclassified | 3290 |
| 85 | Ga0070698_100129104 | 3300005471 | Bacteria | 2484 |
| 86 | Ga0070698_100145050 | 3300005471 | Bacteria | 2324 |
| 87 | Ga0070698_100207217 | 3300005471 | Bacteria | 1896 |
| 88 | Ga0070698_100226469 | 3300005471 | Bacteria | 1803 |
| 89 | Ga0070699_100013096 | 3300005518 | Bacteria | 7148 |
| 90 | Ga0070699_100017241 | 3300005518 | Bacteria | 6202 |
| 91 | Ga0070699_100037743 | 3300005518 | Bacteria | 4183 |
| 92 | Ga0070699_100067647 | 3300005518 | Unclassified | 3102 |
| 93 | Ga0070699_100107172 | 3300005518 | Bacteria | 2451 |
| 94 | Ga0070699_100173255 | 3300005518 | Bacteria | 1912 |
| 95 | Ga0070699_100196556 | 3300005518 | Bacteria | 1793 |
| 96 | Ga0070699_100340823 | 3300005518 | Bacteria | 1349 |
| 97 | Ga0070699_100531375 | 3300005518 | Bacteria | 1070 |
| 98 | Ga0070679_100194369 | 3300005530 | Bacteria | 1997 |
| 99 | Ga0070684_100000096 | 3300005535 | Bacteria | 56546 |
| 100 | Ga0070684_100369102 | 3300005535 | Bacteria | 1321 |
| 101 | Ga0070697_100016123 | 3300005536 | Bacteria | 5875 |
| 102 | Ga0070697_100054865 | 3300005536 | Bacteria | 3239 |
| 103 | Ga0070697_100065749 | 3300005536 | Bacteria | 2964 |
| 104 | Ga0070697_100129779 | 3300005536 | Bacteria | 2113 |
| 105 | Ga0070697_100385692 | 3300005536 | Unclassified | 1214 |
| 106 | Ga0068853_100217588 | 3300005539 | Bacteria | 1743 |
| 107 | Ga0070672_100000197 | 3300005543 | Bacteria | 33442 |
| 108 | Ga0070672_100000816 | 3300005543 | Bacteria | 18609 |
| 109 | Ga0070672_100089388 | 3300005543 | Bacteria | 2482 |
| 110 | Ga0070686_100000174 | 3300005544 | Bacteria | 45207 |
| 111 | Ga0070686_100001516 | 3300005544 | Bacteria | 13050 |
| 112 | Ga0070686_100087711 | 3300005544 | Bacteria | 2075 |
| 113 | Ga0070686_100119575 | 3300005544 | Bacteria | 1807 |
| 114 | Ga0070695_100010445 | 3300005545 | Bacteria | 5543 |
| 115 | Ga0070695_100053395 | 3300005545 | Bacteria | 2599 |
| 116 | Ga0070695_100163353 | 3300005545 | Bacteria | 1565 |
| 117 | Ga0070696_100018688 | 3300005546 | Bacteria | 4688 |
| 118 | Ga0070696_100071775 | 3300005546 | Bacteria | 2437 |
| 119 | Ga0070696_100140375 | 3300005546 | Unclassified | 1766 |
| 120 | Ga0070696_100142984 | 3300005546 | Bacteria | 1750 |
| 121 | Ga0070696_100254960 | 3300005546 | Bacteria | 1328 |
| 122 | Ga0070693_100033852 | 3300005547 | Bacteria | 2823 |
| 123 | Ga0070665_100492611 | 3300005548 | Bacteria | 1237 |
| 124 | Ga0070704_100053926 | 3300005549 | Bacteria | 2843 |
| 125 | Ga0070704_100107701 | 3300005549 | Unclassified | 2114 |
| 126 | Ga0070704_100112327 | 3300005549 | Bacteria | 2076 |
| 127 | Ga0070664_100001536 | 3300005564 | Bacteria | 18433 |
| 128 | Ga0070664_100017169 | 3300005564 | Bacteria | 5941 |
| 129 | Ga0068857_100017024 | 3300005577 | Bacteria | 6367 |
| 130 | Ga0068854_100013751 | 3300005578 | Bacteria | 5320 |
| 131 | Ga0068854_100048947 | 3300005578 | Unclassified | 3018 |
| 132 | Ga0068854_100119965 | 3300005578 | Bacteria | 1995 |
| 133 | Ga0070702_100008166 | 3300005615 | Bacteria | 5057 |
| 134 | Ga0070702_100174268 | 3300005615 | Bacteria | 1402 |
| 135 | Ga0068859_100003507 | 3300005617 | Bacteria | 15972 |
| 136 | Ga0068864_100000997 | 3300005618 | Bacteria | 23676 |
| 137 | Ga0068861_100325594 | 3300005719 | Bacteria | 1340 |
| 138 | Ga0068858_100002023 | 3300005842 | Bacteria | 20688 |
| 139 | Ga0068860_100103379 | 3300005843 | Bacteria | 2719 |
| 140 | Ga0081455_10002418 | 3300005937 | Bacteria | 22266 |
| 141 | Ga0081455_10031389 | 3300005937 | Bacteria | 4808 |
| 142 | Ga0081538_10002079 | 3300005981 | Bacteria | 19940 |
| 143 | Ga0081538_10002290 | 3300005981 | Bacteria | 18910 |
| 144 | Ga0081538_10018162 | 3300005981 | Bacteria | 5299 |
| 145 | Ga0070717_10000082 | 3300006028 | Bacteria | 77627 |
| 146 | Ga0070717_10115019 | 3300006028 | Bacteria | 2299 |
| 147 | Ga0070717_10264531 | 3300006028 | Unclassified | 1522 |
| 148 | Ga0070715_10064716 | 3300006163 | Bacteria | 1616 |
| 149 | Ga0070715_10111335 | 3300006163 | Bacteria | 1292 |
| 150 | Ga0070716_100049868 | 3300006173 | Bacteria | 2374 |
| 151 | Ga0070716_100107551 | 3300006173 | Bacteria | 1722 |
| 152 | Ga0097621_100007547 | 3300006237 | Bacteria | 7788 |
| 153 | Ga0097621_100015212 | 3300006237 | Bacteria | 5783 |
| 154 | Ga0097621_100196611 | 3300006237 | Bacteria | 1749 |
| 155 | Ga0097621_100211511 | 3300006237 | Bacteria | 1687 |
| 156 | Ga0068871_100018386 | 3300006358 | Bacteria | 5311 |
| 157 | Ga0068871_100023078 | 3300006358 | Bacteria | 4806 |
| 158 | Ga0075428_100003895 | 3300006844 | Bacteria | 16401 |
| 159 | Ga0075428_100044459 | 3300006844 | Bacteria | 4881 |
| 160 | Ga0075428_100080946 | 3300006844 | Bacteria | 3545 |
| 161 | Ga0075428_100476298 | 3300006844 | Bacteria | 1336 |
| 162 | Ga0075428_100893862 | 3300006844 | Bacteria | 942 |
| 163 | Ga0075430_100001814 | 3300006846 | Bacteria | 17479 |
| 164 | Ga0075430_100001931 | 3300006846 | Bacteria | 17021 |
| 165 | Ga0075430_100002247 | 3300006846 | Bacteria | 16012 |
| 166 | Ga0075430_100037853 | 3300006846 | Bacteria | 4089 |
| 167 | Ga0075430_100173673 | 3300006846 | Bacteria | 1793 |
| 168 | Ga0075431_100002763 | 3300006847 | Bacteria | 17017 |
| 169 | Ga0075431_100010356 | 3300006847 | Bacteria | 9369 |
| 170 | Ga0075431_100012438 | 3300006847 | Bacteria | 8590 |
| 171 | Ga0075431_100058652 | 3300006847 | Bacteria | 3973 |
| 172 | Ga0075431_100082208 | 3300006847 | Bacteria | 3325 |
| 173 | Ga0075431_100355227 | 3300006847 | Bacteria | 1473 |
| 174 | Ga0075433_10078793 | 3300006852 | Bacteria | 2903 |
| 175 | Ga0075433_10143132 | 3300006852 | Bacteria | 2125 |
| 176 | Ga0075433_10182979 | 3300006852 | Bacteria | 1864 |
| 177 | Ga0075433_10316434 | 3300006852 | Bacteria | 1381 |
| 178 | Ga0075434_100218520 | 3300006871 | Unclassified | 1926 |
| 179 | Ga0075434_100271478 | 3300006871 | Bacteria | 1715 |
| 180 | Ga0075434_100275753 | 3300006871 | Bacteria | 1701 |
| 181 | Ga0075434_100370437 | 3300006871 | Bacteria | 1453 |
| 182 | Ga0075429_100001796 | 3300006880 | Bacteria | 17765 |
| 183 | Ga0075429_100032924 | 3300006880 | Bacteria | 4505 |
| 184 | Ga0075429_100050232 | 3300006880 | Bacteria | 3628 |
| 185 | Ga0075429_100439037 | 3300006880 | Bacteria | 1144 |
| 186 | Ga0068865_100033932 | 3300006881 | Bacteria | 3420 |
| 187 | Ga0075436_100010008 | 3300006914 | Bacteria | 6486 |
| 188 | Ga0075436_100029754 | 3300006914 | Bacteria | 3756 |
| 189 | Ga0075436_100033049 | 3300006914 | Bacteria | 3564 |
| 190 | Ga0075436_100041870 | 3300006914 | Bacteria | 3159 |
| 191 | Ga0075436_100154885 | 3300006914 | Bacteria | 1614 |
| 192 | Ga0097620_100003507 | 3300006931 | Bacteria | 15972 |
| 193 | Ga0075435_100020219 | 3300007076 | Bacteria | 5097 |
| 194 | Ga0075435_100044239 | 3300007076 | Bacteria | 3566 |
| 195 | Ga0075435_100054757 | 3300007076 | Bacteria | 3220 |
| 196 | Ga0075435_100138974 | 3300007076 | Bacteria | 2037 |
| 197 | Ga0099794_10053906 | 3300007265 | Unclassified | 1940 |
| 198 | Ga0105251_10023712 | 3300009011 | Bacteria | 3162 |
| 199 | Ga0105244_10017743 | 3300009036 | Bacteria | 4015 |
| 200 | Ga0105244_10020062 | 3300009036 | Bacteria | 3716 |
| 201 | Ga0105244_10024614 | 3300009036 | Bacteria | 3283 |
| 202 | Ga0105240_10634056 | 3300009093 | Bacteria | 1173 |
| 203 | Ga0111539_10000052 | 3300009094 | Bacteria | 116307 |
| 204 | Ga0111539_10000081 | 3300009094 | Bacteria | 97006 |
| 205 | Ga0111539_10111448 | 3300009094 | Bacteria | 3211 |
| 206 | Ga0111539_10233267 | 3300009094 | Bacteria | 2142 |
| 207 | Ga0105245_10000226 | 3300009098 | Bacteria | 53639 |
| 208 | Ga0105245_10001090 | 3300009098 | Bacteria | 24615 |
| 209 | Ga0105245_10003826 | 3300009098 | Bacteria | 13380 |
| 210 | Ga0105245_10093804 | 3300009098 | Bacteria | 2766 |
| 211 | Ga0114129_10063361 | 3300009147 | Bacteria | 5162 |
| 212 | Ga0114129_10091236 | 3300009147 | Bacteria | 4221 |
| 213 | Ga0114129_10128329 | 3300009147 | Bacteria | 3485 |
| 214 | Ga0114129_10306441 | 3300009147 | Bacteria | 2115 |
| 215 | Ga0114129_10613821 | 3300009147 | Bacteria | 1408 |
| 216 | Ga0105242_10004808 | 3300009176 | Bacteria | 10451 |
| 217 | Ga0105242_10136137 | 3300009176 | Bacteria | 2126 |
| 218 | Ga0105242_10238692 | 3300009176 | Bacteria | 1633 |
| 219 | Ga0105248_10000986 | 3300009177 | Bacteria | 31580 |
| 220 | Ga0105248_10214972 | 3300009177 | Bacteria | 2166 |
| 221 | Ga0105248_10216482 | 3300009177 | Unclassified | 2157 |
| 222 | Ga0105248_10545825 | 3300009177 | Bacteria | 1308 |
| 223 | Ga0105237_10323838 | 3300009545 | Bacteria | 1545 |
| 224 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 225 | Ga0105239_10057370 | 3300010375 | Bacteria | 4271 |
| 226 | Ga0105246_10001872 | 3300011119 | Bacteria | 12679 |
| 227 | Ga0157371_10015408 | 3300013102 | Bacteria | 5736 |
| 228 | Ga0157370_10056802 | 3300013104 | Bacteria | 3724 |
| 229 | Ga0157369_10000539 | 3300013105 | Bacteria | 50071 |
| 230 | Ga0157369_10696640 | 3300013105 | Bacteria | 1046 |
| 231 | Ga0157374_10000012 | 3300013296 | Bacteria | 462353 |
| 232 | Ga0157374_10039617 | 3300013296 | Bacteria | 4336 |
| 233 | Ga0157378_10000610 | 3300013297 | Bacteria | 33628 |
| 234 | Ga0157378_10003527 | 3300013297 | Bacteria | 13871 |
| 235 | Ga0157378_10005757 | 3300013297 | Bacteria | 10855 |
| 236 | Ga0157378_10041805 | 3300013297 | Bacteria | 4067 |
| 237 | Ga0157378_10061302 | 3300013297 | Unclassified | 3356 |
| 238 | Ga0157378_10080404 | 3300013297 | Bacteria | 2944 |
| 239 | Ga0157378_10105579 | 3300013297 | Bacteria | 2576 |
| 240 | Ga0163162_10025250 | 3300013306 | Bacteria | 5871 |
| 241 | Ga0163162_10169426 | 3300013306 | Bacteria | 2308 |
| 242 | Ga0157372_10301702 | 3300013307 | Bacteria | 1863 |
| 243 | Ga0157375_10000008 | 3300013308 | Bacteria | 373560 |
| 244 | Ga0157375_10000146 | 3300013308 | Bacteria | 69095 |
| 245 | Ga0157375_10005069 | 3300013308 | Bacteria | 11430 |
| 246 | Ga0157375_10056602 | 3300013308 | Unclassified | 3873 |
| 247 | Ga0163163_10316225 | 3300014325 | Unclassified | 1615 |
| 248 | Ga0163163_10457989 | 3300014325 | Bacteria | 1336 |
| 249 | Ga0157380_10000693 | 3300014326 | Bacteria | 20963 |
| 250 | Ga0157380_10006017 | 3300014326 | Bacteria | 8495 |
| 251 | Ga0157380_10018575 | 3300014326 | Bacteria | 5162 |
| 252 | Ga0157380_10034037 | 3300014326 | Bacteria | 3928 |
| 253 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 254 | Ga0157377_10000024 | 3300014745 | Bacteria | 142391 |
| 255 | Ga0157379_10141149 | 3300014968 | Bacteria | 2172 |
| 256 | Ga0157376_10000025 | 3300014969 | Bacteria | 214212 |
| 257 | Ga0157376_10005233 | 3300014969 | Bacteria | 9059 |
| 258 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 259 | Ga0213873_10005074 | 3300021358 | Bacteria | 2501 |
| 260 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 261 | Ga0213876_10000080 | 3300021384 | Bacteria | 109125 |
| 262 | Ga0213876_10033554 | 3300021384 | Bacteria | 2706 |
| 263 | Ga0209566_105848 | 3300025225 | Bacteria | 1500 |
| 264 | Ga0209437_100489 | 3300025233 | Bacteria | 29197 |
| 265 | Ga0207697_10062047 | 3300025315 | Unclassified | 1556 |
| 266 | Ga0207655_1033348 | 3300025728 | Bacteria | 2335 |
| 267 | Ga0207653_10073523 | 3300025885 | Unclassified | 1172 |
| 268 | Ga0207692_10179711 | 3300025898 | Bacteria | 1232 |
| 269 | Ga0207680_10164300 | 3300025903 | Bacteria | 1491 |
| 270 | Ga0207685_10098803 | 3300025905 | Bacteria | 1244 |
| 271 | Ga0207645_10011166 | 3300025907 | Bacteria | 6144 |
| 272 | Ga0207705_10023924 | 3300025909 | Bacteria | 4359 |
| 273 | Ga0207684_10037756 | 3300025910 | Bacteria | 4099 |
| 274 | Ga0207684_10047017 | 3300025910 | Bacteria | 3661 |
| 275 | Ga0207684_10258846 | 3300025910 | Unclassified | 1501 |
| 276 | Ga0207707_10033042 | 3300025912 | Bacteria | 4528 |
| 277 | Ga0207663_10016813 | 3300025916 | Bacteria | 4067 |
| 278 | Ga0207660_10042127 | 3300025917 | Bacteria | 3203 |
| 279 | Ga0207660_10050073 | 3300025917 | Bacteria | 2965 |
| 280 | Ga0207660_10054213 | 3300025917 | Bacteria | 2861 |
| 281 | Ga0207662_10001748 | 3300025918 | Bacteria | 10664 |
| 282 | Ga0207662_10007817 | 3300025918 | Bacteria | 5826 |
| 283 | Ga0207662_10092831 | 3300025918 | Bacteria | 1859 |
| 284 | Ga0207657_10245055 | 3300025919 | Bacteria | 1430 |
| 285 | Ga0207652_10027811 | 3300025921 | Bacteria | 4715 |
| 286 | Ga0207652_10220854 | 3300025921 | Bacteria | 1707 |
| 287 | Ga0207646_10000163 | 3300025922 | Bacteria | 90731 |
| 288 | Ga0207646_10014015 | 3300025922 | Bacteria | 7630 |
| 289 | Ga0207646_10032240 | 3300025922 | Bacteria | 4742 |
| 290 | Ga0207646_10053889 | 3300025922 | Bacteria | 3598 |
| 291 | Ga0207646_10091400 | 3300025922 | Unclassified | 2724 |
| 292 | Ga0207646_10115271 | 3300025922 | Bacteria | 2413 |
| 293 | Ga0207681_10058275 | 3300025923 | Bacteria | 2644 |
| 294 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 295 | Ga0207650_10000262 | 3300025925 | Bacteria | 56131 |
| 296 | Ga0207650_10040481 | 3300025925 | Bacteria | 3410 |
| 297 | Ga0207659_10000007 | 3300025926 | Bacteria | 322984 |
| 298 | Ga0207659_10043589 | 3300025926 | Bacteria | 3152 |
| 299 | Ga0207659_10299634 | 3300025926 | Bacteria | 1320 |
| 300 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 301 | Ga0207687_10000589 | 3300025927 | Bacteria | 24566 |
| 302 | Ga0207687_10002009 | 3300025927 | Bacteria | 13968 |
| 303 | Ga0207687_10205637 | 3300025927 | Bacteria | 1541 |
| 304 | Ga0207700_10025113 | 3300025928 | Bacteria | 4133 |
| 305 | Ga0207644_10053118 | 3300025931 | Bacteria | 2915 |
| 306 | Ga0207690_10096302 | 3300025932 | Bacteria | 2104 |
| 307 | Ga0207706_10003099 | 3300025933 | Bacteria | 15977 |
| 308 | Ga0207686_10006165 | 3300025934 | Bacteria | 6445 |
| 309 | Ga0207686_10149949 | 3300025934 | Bacteria | 1622 |
| 310 | Ga0207670_10000755 | 3300025936 | Bacteria | 17002 |
| 311 | Ga0207670_10001520 | 3300025936 | Bacteria | 12195 |
| 312 | Ga0207669_10020258 | 3300025937 | Bacteria | 3483 |
| 313 | Ga0207665_10011128 | 3300025939 | Bacteria | 5903 |
| 314 | Ga0207691_10000080 | 3300025940 | Bacteria | 82234 |
| 315 | Ga0207691_10000269 | 3300025940 | Bacteria | 51350 |
| 316 | Ga0207691_10082615 | 3300025940 | Bacteria | 2885 |
| 317 | Ga0207691_10409083 | 3300025940 | Bacteria | 1157 |
| 318 | Ga0207711_10085133 | 3300025941 | Bacteria | 2769 |
| 319 | Ga0207711_10138751 | 3300025941 | Bacteria | 2186 |
| 320 | Ga0207711_10344327 | 3300025941 | Bacteria | 1380 |
| 321 | Ga0207711_10382035 | 3300025941 | Unclassified | 1307 |
| 322 | Ga0207689_10013865 | 3300025942 | Bacteria | 6866 |
| 323 | Ga0207689_10053262 | 3300025942 | Bacteria | 3334 |
| 324 | Ga0207689_10156275 | 3300025942 | Bacteria | 1880 |
| 325 | Ga0207661_10000001 | 3300025944 | Bacteria | 937688 |
| 326 | Ga0207679_10001532 | 3300025945 | Bacteria | 14444 |
| 327 | Ga0207651_10000078 | 3300025960 | Bacteria | 44168 |
| 328 | Ga0207651_10014030 | 3300025960 | Bacteria | 4612 |
| 329 | Ga0207651_10284059 | 3300025960 | Unclassified | 1369 |
| 330 | Ga0207640_10006617 | 3300025981 | Bacteria | 6367 |
| 331 | Ga0207640_10022528 | 3300025981 | Bacteria | 3772 |
| 332 | Ga0207640_10044675 | 3300025981 | Bacteria | 2840 |
| 333 | Ga0207677_10000045 | 3300026023 | Bacteria | 106591 |
| 334 | Ga0207677_10000633 | 3300026023 | Bacteria | 21255 |
| 335 | Ga0207677_10097106 | 3300026023 | Bacteria | 2157 |
| 336 | Ga0207703_10000104 | 3300026035 | Bacteria | 99914 |
| 337 | Ga0207639_10000051 | 3300026041 | Bacteria | 113927 |
| 338 | Ga0207639_10182832 | 3300026041 | Bacteria | 1785 |
| 339 | Ga0207708_10000052 | 3300026075 | Bacteria | 105169 |
| 340 | Ga0207708_10000207 | 3300026075 | Bacteria | 46522 |
| 341 | Ga0207708_10254334 | 3300026075 | Bacteria | 1416 |
| 342 | Ga0207648_10006188 | 3300026089 | Bacteria | 11923 |
| 343 | Ga0207648_10044257 | 3300026089 | Bacteria | 3906 |
| 344 | Ga0207648_10328143 | 3300026089 | Bacteria | 1376 |
| 345 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 346 | Ga0207674_10051491 | 3300026116 | Bacteria | 4202 |
| 347 | Ga0207675_100021034 | 3300026118 | Bacteria | 6082 |
| 348 | Ga0207683_10005661 | 3300026121 | Bacteria | 10712 |
| 349 | Ga0207683_10036611 | 3300026121 | Bacteria | 4274 |
| 350 | Ga0207683_10614336 | 3300026121 | Unclassified | 1006 |
| 351 | Ga0209968_1001627 | 3300027526 | Bacteria | 3384 |
| 352 | Ga0209966_1017447 | 3300027695 | Bacteria | 1368 |
| 353 | Ga0209974_10000783 | 3300027876 | Bacteria | 10842 |
| 354 | Ga0207428_10000003 | 3300027907 | Bacteria | 799783 |
| 355 | Ga0207428_10004729 | 3300027907 | Bacteria | 12882 |
| 356 | Ga0268264_10079364 | 3300028381 | Bacteria | 2800 |
| 357 | Ga0307511_10009303 | 3300030521 | Bacteria | 9790 |
| 358 | Ga0307408_100069928 | 3300031548 | Bacteria | 2590 |
| 359 | Ga0307408_100173646 | 3300031548 | Bacteria | 1722 |
| 360 | Ga0307408_100262310 | 3300031548 | Bacteria | 1430 |
| 361 | Ga0307405_10038380 | 3300031731 | Bacteria | 2887 |
| 362 | Ga0307410_10195303 | 3300031852 | Bacteria | 1541 |
| 363 | Ga0307407_10065108 | 3300031903 | Bacteria | 2145 |
| 364 | Ga0307412_10010073 | 3300031911 | Bacteria | 5436 |
| 365 | Ga0307409_100119546 | 3300031995 | Bacteria | 2228 |
| 366 | Ga0307409_100252355 | 3300031995 | Unclassified | 1614 |
| 367 | Ga0307416_100042987 | 3300032002 | Bacteria | 3534 |
| 368 | Ga0307416_100276082 | 3300032002 | Bacteria | 1654 |
| 369 | Ga0307411_10010860 | 3300032005 | Bacteria | 4880 |
| 370 | Ga0307411_10158785 | 3300032005 | Bacteria | 1690 |
| 371 | Ga0307411_10450908 | 3300032005 | Unclassified | 1076 |
| 372 | Ga0307415_100389003 | 3300032126 | Bacteria | 1187 |
| 373 | Ga0373926_0015991 | 3300035083 | Bacteria | 2563 |
| 374 | Ga0373932_0002001 | 3300035112 | Bacteria | 5369 |
| 375 | Ga0373945_0045156 | 3300035116 | Bacteria | 1604 |
| 376 | Ga0373931_0382352 | 3300035691 | Unclassified | 888 |
| 377 | Ga0373935_0184308 | 3300035692 | Bacteria | 1435 |
| 378 | Ga0373933_0042796 | 3300035724 | Bacteria | 2677 |
| 379 | Ga0373947_0058119 | 3300035725 | Bacteria | 2343 |
| 380 | Ga0373937_0268739 | 3300036401 | Bacteria | 1609 |
| 381 | Ga0373925_0070409 | 3300037068 | Bacteria | 2644 |
| 382 | Ga0436365_0404975 | 3300039437 | Bacteria | 180420 |
| 383 | Ga0436365_1042710 | 3300039437 | Bacteria | 18422 |
| 384 | Ga0436365_1645708 | 3300039437 | Bacteria | 58473 |
| 385 | Ga0436362_0551129 | 3300039453 | Bacteria | 8157 |
| 386 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 387 | Ga0439466_0057542 | 3300041411 | Bacteria | 1259 |
| 388 | Ga0451839_0558968 | 3300041496 | Bacteria | 3184 |
| 389 | Ga0439433_0037166 | 3300041999 | Bacteria | 1126 |
| 390 | Ga0439432_029127 | 3300042006 | Bacteria | 1796 |
| 391 | Ga0439452_002900 | 3300042010 | Bacteria | 6147 |
| 392 | Ga0439456_024964 | 3300042013 | Bacteria | 1269 |
| 393 | Ga0439462_0021271 | 3300042015 | Bacteria | 1694 |
| 394 | Ga0439446_0008143 | 3300042156 | Unclassified | 2775 |
| 395 | Ga0439434_0005421 | 3300042435 | Unclassified | 3735 |
| 396 | Ga0439444_0013099 | 3300042437 | Bacteria | 1370 |
| 397 | Ga0439460_0008942 | 3300042461 | Bacteria | 2534 |
| 398 | Ga0451577_0027632 | 3300042876 | Bacteria | 5136 |
| 399 | Ga0453683_0010212 | 3300044673 | Bacteria | 6231 |
| 400 | Ga0453684_0039042 | 3300044712 | Bacteria | 6475 |
| 401 | Ga0466968_0034413 | 3300044735 | Bacteria | 2114 |
| 402 | Ga0451576_0004157 | 3300045051 | Bacteria | 19055 |
| 403 | Ga0451576_0237364 | 3300045051 | Bacteria | 1904 |
| 404 | Ga0451576_0432850 | 3300045051 | Bacteria | 1380 |
| 405 | Ga0466967_0064347 | 3300045976 | Bacteria | 3261 |
| 406 | Ga0495594_0019012 | 3300046499 | Bacteria | 3647 |
| 407 | Ga0495594_0078748 | 3300046499 | Bacteria | 1839 |
| 408 | Ga0495620_0000908 | 3300046515 | Bacteria | 18186 |
| 409 | Ga0495637_0005060 | 3300046520 | Bacteria | 6771 |
| 410 | Ga0495658_0124447 | 3300046683 | Unclassified | 1563 |
| 411 | Ga0495676_0341787 | 3300047321 | Unclassified | 1002 |
| 412 | Ga0495680_0019066 | 3300047322 | Bacteria | 5806 |
| 413 | Ga0495680_0023451 | 3300047322 | Bacteria | 5131 |
| 414 | Ga0495681_0014794 | 3300047470 | Bacteria | 4452 |
| 415 | Ga0496101_0201695 | 3300048904 | Bacteria | 1538 |
| 416 | Ga0496104_0081394 | 3300048907 | Bacteria | 3088 |
| 417 | Ga0496106_0341583 | 3300048909 | Bacteria | 1202 |
| 418 | Ga0496108_0036239 | 3300048911 | Bacteria | 4104 |
| 419 | Ga0496109_0012412 | 3300048912 | Bacteria | 7356 |
| 420 | Ga0496110_0271418 | 3300048913 | Bacteria | 1544 |
| 421 | Ga0496114_0004335 | 3300048917 | Bacteria | 10987 |
| 422 | Ga0496115_0629583 | 3300048918 | Bacteria | 850 |
| 423 | Ga0496116_0005542 | 3300048919 | Bacteria | 11645 |
| 424 | Ga0496116_0015980 | 3300048919 | Bacteria | 5903 |
| 425 | Ga0496116_0081218 | 3300048919 | Bacteria | 2010 |
| 426 | Ga0496116_0148207 | 3300048919 | Bacteria | 1308 |
| 427 | Ga0496117_0003330 | 3300048920 | Bacteria | 18770 |
| 428 | Ga0496117_0049711 | 3300048920 | Bacteria | 2979 |
| 429 | Ga0496118_0041810 | 3300048921 | Bacteria | 3623 |
| 430 | Ga0496118_0160797 | 3300048921 | Bacteria | 1389 |
| 431 | Ga0496119_0000331 | 3300048922 | Bacteria | 66145 |
| 432 | Ga0496119_0007134 | 3300048922 | Bacteria | 10141 |
| 433 | Ga0496120_0000298 | 3300048923 | Bacteria | 83191 |
| 434 | Ga0496120_0053503 | 3300048923 | Bacteria | 2293 |
| 435 | Ga0496121_0029992 | 3300048924 | Bacteria | 5007 |
| 436 | Ga0496121_0038361 | 3300048924 | Bacteria | 4246 |
| 437 | Ga0496121_0038631 | 3300048924 | Bacteria | 4220 |
| 438 | Ga0496122_0013991 | 3300048925 | Bacteria | 7796 |
| 439 | Ga0496122_0032403 | 3300048925 | Bacteria | 4322 |
| 440 | Ga0496122_0093181 | 3300048925 | Bacteria | 2044 |
| 441 | Ga0496122_0109044 | 3300048925 | Bacteria | 1823 |
| 442 | Ga0496123_0020096 | 3300048926 | Bacteria | 5239 |
| 443 | Ga0496123_0045676 | 3300048926 | Bacteria | 2981 |
| 444 | Ga0496124_0000824 | 3300048927 | Bacteria | 50533 |
| 445 | Ga0496124_0045247 | 3300048927 | Bacteria | 3774 |
| 446 | Ga0496124_0067962 | 3300048927 | Bacteria | 2963 |
| 447 | Ga0496125_0002758 | 3300048928 | Bacteria | 22227 |
| 448 | Ga0496125_0033730 | 3300048928 | Bacteria | 4524 |
| 449 | Ga0496126_0001009 | 3300048929 | Bacteria | 47959 |
| 450 | Ga0496126_0003928 | 3300048929 | Bacteria | 18207 |
| 451 | Ga0496126_0005903 | 3300048929 | Bacteria | 13809 |
| 452 | Ga0501290_000006 | 3300049513 | Bacteria | 41465 |
| 453 | Ga0501291_000100 | 3300049514 | Bacteria | 10312 |
| 454 | Ga0501292_000119 | 3300049515 | Bacteria | 13728 |
| 455 | Ga0501293_000069 | 3300049516 | Bacteria | 6524 |
| 456 | Ga0501294_000531 | 3300049517 | Bacteria | 4429 |
| 457 | Ga0501295_000505 | 3300049518 | Unclassified | 3664 |
| 458 | Ga0501296_000055 | 3300049519 | Bacteria | 12939 |
| 459 | Ga0501297_000036 | 3300049520 | Bacteria | 13632 |
| 460 | Ga0501298_000067 | 3300049521 | Bacteria | 11235 |
| 461 | Ga0501299_000019 | 3300049522 | Bacteria | 20397 |
| 462 | Ga0501299_022016 | 3300049522 | Bacteria | 1173 |
| 463 | Ga0501300_000028 | 3300049523 | Bacteria | 22326 |
| 464 | Ga0501301_000101 | 3300049524 | Bacteria | 4297 |
| 465 | Ga0501302_000132 | 3300049525 | Bacteria | 3703 |
| 466 | Ga0501031_0002722 | 3300049568 | Bacteria | 11249 |
| 467 | Ga0501031_0013748 | 3300049568 | Bacteria | 5276 |
| 468 | Ga0501031_0028809 | 3300049568 | Bacteria | 3619 |
| 469 | Ga0501031_0037335 | 3300049568 | Bacteria | 3170 |
| 470 | Ga0501032_0012130 | 3300049569 | Bacteria | 6170 |
| 471 | Ga0501032_0019570 | 3300049569 | Bacteria | 4735 |
| 472 | Ga0501033_0127486 | 3300049570 | Unclassified | 1845 |
| 473 | Ga0501036_0015358 | 3300049572 | Bacteria | 6394 |
| 474 | Ga0501037_0005036 | 3300049573 | Bacteria | 9613 |
| 475 | Ga0501037_0028005 | 3300049573 | Bacteria | 4163 |
| 476 | Ga0501037_0056965 | 3300049573 | Unclassified | 2854 |
| 477 | Ga0501037_0092472 | 3300049573 | Unclassified | 2188 |
| 478 | Ga0501038_0002519 | 3300049574 | Bacteria | 17073 |
| 479 | Ga0501038_0023120 | 3300049574 | Bacteria | 5562 |
| 480 | Ga0501038_0029364 | 3300049574 | Bacteria | 4874 |
| 481 | Ga0501038_0181506 | 3300049574 | Bacteria | 1698 |
| 482 | Ga0501039_0001919 | 3300049575 | Bacteria | 15401 |
| 483 | Ga0501039_0005939 | 3300049575 | Bacteria | 9250 |
| 484 | Ga0501039_0021109 | 3300049575 | Bacteria | 4995 |
| 485 | Ga0501039_0032056 | 3300049575 | Bacteria | 4051 |
| 486 | Ga0501039_0039904 | 3300049575 | Bacteria | 3625 |
| 487 | Ga0501040_0021975 | 3300049576 | Bacteria | 4266 |
| 488 | Ga0501040_0056996 | 3300049576 | Bacteria | 2682 |
| 489 | Ga0501040_0315729 | 3300049576 | Unclassified | 1117 |
| 490 | Ga0501041_0003539 | 3300049577 | Bacteria | 8984 |
| 491 | Ga0501042_0001433 | 3300049578 | Bacteria | 14045 |
| 492 | Ga0501042_0013466 | 3300049578 | Bacteria | 5566 |
| 493 | Ga0501042_0092930 | 3300049578 | Bacteria | 2166 |
| 494 | Ga0501042_0174000 | 3300049578 | Bacteria | 1553 |
| 495 | Ga0501043_0176580 | 3300049579 | Bacteria | 1665 |
| 496 | Ga0501046_0004340 | 3300049580 | Bacteria | 12913 |
| 497 | Ga0501046_0011649 | 3300049580 | Bacteria | 7517 |
| 498 | Ga0501046_0091337 | 3300049580 | Bacteria | 2342 |
| 499 | Ga0501046_0247533 | 3300049580 | Unclassified | 1313 |
| 500 | Ga0501048_0003804 | 3300049582 | Bacteria | 11515 |
| 501 | Ga0501048_0064663 | 3300049582 | Bacteria | 2587 |
| 502 | Ga0501048_0074444 | 3300049582 | Bacteria | 2396 |
| 503 | Ga0501068_0034500 | 3300049584 | Unclassified | 3017 |
| 504 | Ga0501068_0221610 | 3300049584 | Bacteria | 1202 |
| 505 | Ga0501068_0235044 | 3300049584 | Bacteria | 1166 |
| 506 | Ga0501071_0027727 | 3300049587 | Bacteria | 3987 |
| 507 | Ga0501071_0197984 | 3300049587 | Bacteria | 1508 |
| 508 | Ga0501072_0002709 | 3300049588 | Bacteria | 13295 |
| 509 | Ga0501072_0068011 | 3300049588 | Bacteria | 2812 |
| 510 | Ga0501073_0000867 | 3300049589 | Bacteria | 21612 |
| 511 | Ga0501074_0059188 | 3300049590 | Bacteria | 2761 |
| 512 | Ga0501075_0008450 | 3300049591 | Bacteria | 7183 |
| 513 | Ga0501075_0053736 | 3300049591 | Bacteria | 3029 |
| 514 | Ga0501075_0076413 | 3300049591 | Bacteria | 2533 |
| 515 | Ga0501076_0013762 | 3300049592 | Bacteria | 6071 |
| 516 | Ga0501076_0101555 | 3300049592 | Bacteria | 2318 |
| 517 | Ga0501076_0123706 | 3300049592 | Bacteria | 2095 |
| 518 | Ga0501077_0021039 | 3300049593 | Bacteria | 4127 |
| 519 | Ga0501077_0038008 | 3300049593 | Bacteria | 3064 |
| 520 | Ga0501077_0040188 | 3300049593 | Bacteria | 2980 |
| 521 | Ga0501198_000924 | 3300049649 | Bacteria | 3702 |
| 522 | Ga0501199_000140 | 3300049650 | Bacteria | 5665 |
| 523 | Ga0501201_000548 | 3300049651 | Bacteria | 3497 |
| 524 | Ga0501202_002648 | 3300049652 | Bacteria | 3021 |
| 525 | Ga0501206_000044 | 3300049653 | Bacteria | 11231 |
| 526 | Ga0501207_001130 | 3300049654 | Bacteria | 3274 |
| 527 | Ga0501208_000495 | 3300049655 | Unclassified | 3158 |
| 528 | Ga0501216_003634 | 3300049660 | Bacteria | 2259 |
| 529 | Ga0501223_000510 | 3300049663 | Bacteria | 9399 |
| 530 | Ga0501228_000261 | 3300049666 | Bacteria | 3204 |
| 531 | Ga0501230_000608 | 3300049667 | Bacteria | 3755 |
| 532 | Ga0501235_000120 | 3300049669 | Bacteria | 12942 |
| 533 | Ga0501239_000073 | 3300049672 | Bacteria | 6326 |
| 534 | Ga0501243_000672 | 3300049675 | Bacteria | 4693 |
| 535 | Ga0501246_000145 | 3300049676 | Unclassified | 4392 |
| 536 | Ga0501249_000424 | 3300049679 | Bacteria | 10734 |
| 537 | Ga0501250_000241 | 3300049680 | Bacteria | 3300 |
| 538 | Ga0501253_000048 | 3300049683 | Bacteria | 8209 |
| 539 | Ga0501259_001393 | 3300049688 | Bacteria | 4041 |
| 540 | Ga0501260_000199 | 3300049689 | Unclassified | 4584 |
| 541 | Ga0501225_0000414 | 3300049705 | Bacteria | 13436 |
| 542 | Ga0501229_000122 | 3300049706 | Bacteria | 8154 |
| 543 | Ga0501079_0009853 | 3300049741 | Bacteria | 7249 |
| 544 | Ga0501080_0034665 | 3300049742 | Bacteria | 4713 |
| 545 | Ga0501081_0046335 | 3300049743 | Unclassified | 2988 |
| 546 | Ga0501081_0222191 | 3300049743 | Unclassified | 1374 |
| 547 | Ga0501081_0579213 | 3300049743 | Bacteria | 839 |
| 548 | Ga0501083_0272188 | 3300049744 | Bacteria | 1102 |
| 549 | Ga0501264_001111 | 3300049761 | Unclassified | 3152 |
| 550 | Ga0501265_000946 | 3300049762 | Bacteria | 3257 |
| 551 | Ga0501266_004292 | 3300049763 | Bacteria | 1766 |
| 552 | Ga0501270_000296 | 3300049767 | Bacteria | 4273 |
| 553 | Ga0501274_000292 | 3300049771 | Bacteria | 3389 |
| 554 | Ga0501275_000725 | 3300049772 | Unclassified | 3599 |
| 555 | Ga0501278_000609 | 3300049774 | Unclassified | 2731 |
| 556 | Ga0501279_000476 | 3300049775 | Bacteria | 5291 |
| 557 | Ga0501280_003633 | 3300049776 | Unclassified | 2344 |
| 558 | Ga0501283_000006 | 3300049779 | Bacteria | 26660 |
| 559 | Ga0501035_0008334 | 3300049822 | Bacteria | 9650 |
| 560 | Ga0501035_0012688 | 3300049822 | Bacteria | 7785 |
| 561 | Ga0501035_0133891 | 3300049822 | Unclassified | 2159 |
| 562 | Ga0501044_0460107 | 3300049823 | Bacteria | 1178 |
| 563 | Ga0501045_0047578 | 3300049824 | Bacteria | 3125 |
| 564 | Ga0501045_0103171 | 3300049824 | Bacteria | 2112 |
| 565 | Ga0501212_005330 | 3300049851 | Bacteria | 1694 |
| 566 | Ga0501226_002060 | 3300049853 | Bacteria | 2495 |
| 567 | nmdc:mga05p37_158979_c1 | 3300050507 | Bacteria | 2760 |
| 568 | nmdc:mga05p37_37981_c1 | 3300050507 | Bacteria | 5906 |
| 569 | nmdc:mga05p37_49626_c1 | 3300050507 | Bacteria | 5162 |
| 570 | nmdc:mga05p37_73036_c1 | 3300050507 | Bacteria | 4221 |
| 571 | nmdc:mga09592_13200_c1 | 3300050508 | Bacteria | 6744 |
| 572 | nmdc:mga09592_38682_c1 | 3300050508 | Bacteria | 4005 |
| 573 | nmdc:mga09592_88210_c1 | 3300050508 | Bacteria | 2649 |
| 574 | nmdc:mga0qj67_161965_c1 | 3300050509 | Bacteria | 1816 |
| 575 | nmdc:mga0qj67_332798_c1 | 3300050509 | Bacteria | 1229 |
| 576 | nmdc:mga0qj67_33280_c1 | 3300050509 | Bacteria | 4022 |
| 577 | nmdc:mga0qj67_40926_c1 | 3300050509 | Bacteria | 3643 |
| 578 | nmdc:mga06r32_124908_c1 | 3300050510 | Bacteria | 2540 |
| 579 | nmdc:mga06r32_136762_c1 | 3300050510 | Bacteria | 2425 |
| 580 | nmdc:mga06r32_2480_c1 | 3300050510 | Bacteria | 16511 |
| 581 | nmdc:mga06r32_54184_c1 | 3300050510 | Bacteria | 3845 |
| 582 | nmdc:mga06r32_54931_c1 | 3300050510 | Bacteria | 3819 |
| 583 | nmdc:mga08y16_196_c1 | 3300050511 | Bacteria | 54632 |
| 584 | nmdc:mga08y16_4_c1 | 3300050511 | Bacteria | 916963 |
| 585 | nmdc:mga08y16_92554_c1 | 3300050511 | Bacteria | 3150 |
| 586 | nmdc:mga0n895_194417_c1 | 3300050512 | Bacteria | 2060 |
| 587 | nmdc:mga0n895_2535_c1 | 3300050512 | Bacteria | 14305 |
| 588 | nmdc:mga0rr50_146437_c1 | 3300050513 | Unclassified | 1905 |
| 589 | nmdc:mga0rr50_37_c1 | 3300050513 | Bacteria | 87211 |
| 590 | nmdc:mga0rr50_41691_c1 | 3300050513 | Bacteria | 3347 |
| 591 | nmdc:mga0rr50_53617_c1 | 3300050513 | Bacteria | 3000 |
| 592 | nmdc:mga08x19_2083_c1 | 3300050514 | Bacteria | 12224 |
| 593 | nmdc:mga08x19_97979_c1 | 3300050514 | Bacteria | 1942 |
| 594 | Ga0495601_0081697 | 3300053077 | Bacteria | 2074 |
| 595 | Ga0495612_0053083 | 3300053078 | Bacteria | 1669 |
| 596 | Ga0495655_0000153 | 3300053083 | Bacteria | 12928 |
| 597 | Ga0501084_0084443 | 3300054114 | Unclassified | 2665 |
| 598 | Ga0501084_0087948 | 3300054114 | Bacteria | 2609 |
| 599 | Ga0501084_0111016 | 3300054114 | Bacteria | 2304 |
| 600 | Ga0590074_032420 | 3300059423 | Unclassified | 925 |
| 601 | Ga0501082_0044269 | 3300060353 | Unclassified | 3839 |
| 602 | Ga0501082_0227956 | 3300060353 | Bacteria | 1622 |
| 603 | Ga0501082_0375206 | 3300060353 | Unclassified | 1241 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0579213 | Ga0501081_0579213_121_819 | 231 |
| 2 | 3300035691 | Ga0373931_0382352 | Ga0373931_0382352_12_719 | 234 |
| 3 | 3300048909 | Ga0496106_0341583 | Ga0496106_0341583_175_912 | 244 |
| 4 | 3300049763 | Ga0501266_004292 | Ga0501266_004292_956_1708 | 249 |
| 5 | 3300049823 | Ga0501044_0460107 | Ga0501044_0460107_47_820 | 256 |
| 6 | 3300048918 | Ga0496115_0629583 | Ga0496115_0629583_30_818 | 261 |
| 7 | 3300044735 | Ga0466968_0034413 | Ga0466968_0034413_1291_2097 | 262 |
| 8 | 3300009545 | Ga0105237_10323838 | Ga0105237_103238382 | 267 |
| 9 | 3300046520 | Ga0495637_0005060 | Ga0495637_0005060_5904_6746 | 274 |
| 10 | 3300048924 | Ga0496121_0038361 | Ga0496121_0038361_3381_4223 | 274 |
| 11 | 3300049654 | Ga0501207_001130 | Ga0501207_001130_1704_2534 | 275 |
| 12 | 3300005335 | Ga0070666_10000124 | Ga0070666_1000012422 | 279 |
| 13 | 3300049579 | Ga0501043_0176580 | Ga0501043_0176580_644_1486 | 279 |
| 14 | 3300060353 | Ga0501082_0227956 | Ga0501082_0227956_501_1343 | 279 |
| 15 | 3300035725 | Ga0373947_0058119 | Ga0373947_0058119_1488_2333 | 280 |
| 16 | 3300006844 | Ga0075428_100080946 | Ga0075428_1000809463 | 281 |
| 17 | 3300006846 | Ga0075430_100001931 | Ga0075430_10000193122 | 281 |
| 18 | 3300006880 | Ga0075429_100001796 | Ga0075429_10000179619 | 281 |
| 19 | 3300027526 | Ga0209968_1001627 | Ga0209968_10016273 | 281 |
| 20 | 3300027876 | Ga0209974_10000783 | Ga0209974_100007834 | 281 |
| 21 | 3300031548 | Ga0307408_100173646 | Ga0307408_1001736461 | 281 |
| 22 | 3300031731 | Ga0307405_10038380 | Ga0307405_100383802 | 281 |
| 23 | 3300031911 | Ga0307412_10010073 | Ga0307412_100100735 | 281 |
| 24 | 3300045051 | Ga0451576_0237364 | Ga0451576_0237364_945_1805 | 281 |
| 25 | 3300006847 | Ga0075431_100058652 | Ga0075431_1000586523 | 282 |
| 26 | 3300006852 | Ga0075433_10143132 | Ga0075433_101431322 | 282 |
| 27 | 3300006914 | Ga0075436_100010008 | Ga0075436_1000100083 | 282 |
| 28 | 3300009094 | Ga0111539_10111448 | Ga0111539_101114483 | 282 |
| 29 | 3300009147 | Ga0114129_10063361 | Ga0114129_100633616 | 282 |
| 30 | 3300009176 | Ga0105242_10238692 | Ga0105242_102386922 | 282 |
| 31 | 3300013297 | Ga0157378_10105579 | Ga0157378_101055792 | 282 |
| 32 | 3300049592 | Ga0501076_0123706 | Ga0501076_0123706_235_1089 | 282 |
| 33 | 3300050507 | nmdc:mga05p37_49626_c1 | nmdc:mga05p37_49626_c1_860_1711 | 282 |
| 34 | 3300050510 | nmdc:mga06r32_124908_c1 | nmdc:mga06r32_124908_c1_169_1023 | 282 |
| 35 | 3300050511 | nmdc:mga08y16_92554_c1 | nmdc:mga08y16_92554_c1_124_990 | 282 |
| 36 | 3300050512 | nmdc:mga0n895_2535_c1 | nmdc:mga0n895_2535_c1_11812_12678 | 282 |
| 37 | 3300050514 | nmdc:mga08x19_2083_c1 | nmdc:mga08x19_2083_c1_3346_4212 | 282 |
| 38 | 3300060353 | Ga0501082_0375206 | Ga0501082_0375206_322_1176 | 282 |
| 39 | 3300003751 | Ga0055538_1000126 | Ga0055538_100012643 | 283 |
| 40 | 3300006846 | Ga0075430_100001814 | Ga0075430_1000018145 | 283 |
| 41 | 3300006846 | Ga0075430_100037853 | Ga0075430_1000378532 | 283 |
| 42 | 3300006847 | Ga0075431_100002763 | Ga0075431_1000027636 | 283 |
| 43 | 3300006847 | Ga0075431_100012438 | Ga0075431_1000124382 | 283 |
| 44 | 3300006880 | Ga0075429_100032924 | Ga0075429_1000329242 | 283 |
| 45 | 3300006880 | Ga0075429_100050232 | Ga0075429_1000502322 | 283 |
| 46 | 3300006914 | Ga0075436_100029754 | Ga0075436_1000297542 | 283 |
| 47 | 3300009147 | Ga0114129_10128329 | Ga0114129_101283292 | 283 |
| 48 | 3300031548 | Ga0307408_100069928 | Ga0307408_1000699282 | 283 |
| 49 | 3300031548 | Ga0307408_100262310 | Ga0307408_1002623102 | 283 |
| 50 | 3300031903 | Ga0307407_10065108 | Ga0307407_100651082 | 283 |
| 51 | 3300031995 | Ga0307409_100119546 | Ga0307409_1001195462 | 283 |
| 52 | 3300032005 | Ga0307411_10158785 | Ga0307411_101587852 | 283 |
| 53 | 3300032126 | Ga0307415_100389003 | Ga0307415_1003890032 | 283 |
| 54 | 3300047470 | Ga0495681_0014794 | Ga0495681_0014794_3344_4243 | 283 |
| 55 | 3300048919 | Ga0496116_0005542 | Ga0496116_0005542_593_1504 | 283 |
| 56 | 3300048919 | Ga0496116_0081218 | Ga0496116_0081218_650_1549 | 283 |
| 57 | 3300048919 | Ga0496116_0148207 | Ga0496116_0148207_364_1263 | 283 |
| 58 | 3300048920 | Ga0496117_0003330 | Ga0496117_0003330_5787_6698 | 283 |
| 59 | 3300048920 | Ga0496117_0049711 | Ga0496117_0049711_366_1265 | 283 |
| 60 | 3300048921 | Ga0496118_0041810 | Ga0496118_0041810_529_1428 | 283 |
| 61 | 3300048921 | Ga0496118_0160797 | Ga0496118_0160797_56_955 | 283 |
| 62 | 3300048922 | Ga0496119_0000331 | Ga0496119_0000331_19315_20226 | 283 |
| 63 | 3300048922 | Ga0496119_0007134 | Ga0496119_0007134_7895_8794 | 283 |
| 64 | 3300048923 | Ga0496120_0000298 | Ga0496120_0000298_45947_46858 | 283 |
| 65 | 3300048923 | Ga0496120_0053503 | Ga0496120_0053503_603_1502 | 283 |
| 66 | 3300048924 | Ga0496121_0029992 | Ga0496121_0029992_3048_3947 | 283 |
| 67 | 3300048924 | Ga0496121_0038631 | Ga0496121_0038631_1607_2506 | 283 |
| 68 | 3300048925 | Ga0496122_0032403 | Ga0496122_0032403_1036_1947 | 283 |
| 69 | 3300048925 | Ga0496122_0093181 | Ga0496122_0093181_30_941 | 283 |
| 70 | 3300048925 | Ga0496122_0109044 | Ga0496122_0109044_387_1286 | 283 |
| 71 | 3300048926 | Ga0496123_0020096 | Ga0496123_0020096_3791_4690 | 283 |
| 72 | 3300048926 | Ga0496123_0045676 | Ga0496123_0045676_1410_2321 | 283 |
| 73 | 3300048927 | Ga0496124_0000824 | Ga0496124_0000824_45933_46844 | 283 |
| 74 | 3300048927 | Ga0496124_0045247 | Ga0496124_0045247_2702_3601 | 283 |
| 75 | 3300048928 | Ga0496125_0002758 | Ga0496125_0002758_539_1438 | 283 |
| 76 | 3300048929 | Ga0496126_0001009 | Ga0496126_0001009_1062_1973 | 283 |
| 77 | 3300048929 | Ga0496126_0003928 | Ga0496126_0003928_1035_1946 | 283 |
| 78 | 3300048929 | Ga0496126_0005903 | Ga0496126_0005903_7366_8265 | 283 |
| 79 | 3300049574 | Ga0501038_0181506 | Ga0501038_0181506_127_996 | 283 |
| 80 | 3300049576 | Ga0501040_0056996 | Ga0501040_0056996_1707_2576 | 283 |
| 81 | 3300049578 | Ga0501042_0092930 | Ga0501042_0092930_160_1029 | 283 |
| 82 | 3300049580 | Ga0501046_0091337 | Ga0501046_0091337_830_1699 | 283 |
| 83 | 3300049584 | Ga0501068_0221610 | Ga0501068_0221610_42_908 | 283 |
| 84 | 3300049584 | Ga0501068_0235044 | Ga0501068_0235044_185_1054 | 283 |
| 85 | 3300049587 | Ga0501071_0197984 | Ga0501071_0197984_20_889 | 283 |
| 86 | 3300049588 | Ga0501072_0002709 | Ga0501072_0002709_11779_12648 | 283 |
| 87 | 3300049590 | Ga0501074_0059188 | Ga0501074_0059188_547_1416 | 283 |
| 88 | 3300049591 | Ga0501075_0076413 | Ga0501075_0076413_785_1654 | 283 |
| 89 | 3300049592 | Ga0501076_0101555 | Ga0501076_0101555_268_1137 | 283 |
| 90 | 3300049593 | Ga0501077_0021039 | Ga0501077_0021039_1403_2272 | 283 |
| 91 | 3300049741 | Ga0501079_0009853 | Ga0501079_0009853_2674_3543 | 283 |
| 92 | 3300049744 | Ga0501083_0272188 | Ga0501083_0272188_72_941 | 283 |
| 93 | 3300049824 | Ga0501045_0047578 | Ga0501045_0047578_151_1020 | 283 |
| 94 | 3300050507 | nmdc:mga05p37_37981_c1 | nmdc:mga05p37_37981_c1_4454_5320 | 283 |
| 95 | 3300050508 | nmdc:mga09592_13200_c1 | nmdc:mga09592_13200_c1_4537_5406 | 283 |
| 96 | 3300050508 | nmdc:mga09592_88210_c1 | nmdc:mga09592_88210_c1_1438_2307 | 283 |
| 97 | 3300050509 | nmdc:mga0qj67_40926_c1 | nmdc:mga0qj67_40926_c1_255_1124 | 283 |
| 98 | 3300050510 | nmdc:mga06r32_136762_c1 | nmdc:mga06r32_136762_c1_1482_2351 | 283 |
| 99 | 3300054114 | Ga0501084_0111016 | Ga0501084_0111016_365_1234 | 283 |
| 100 | iso_pu_bacteria | 2548877040 | 2550903681 | 283 |
| 101 | iso_pu_bacteria | 2563366752 | 2563929097 | 283 |
| 102 | iso_pu_bacteria | 2571042143 | 2571528397 | 283 |
| 103 | iso_pu_bacteria | 2600255286 | 2601640964 | 283 |
| 104 | iso_pu_bacteria | 2721755693 | 2723601534 | 283 |
| 105 | iso_pu_bacteria | 2728368933 | 2728532010 | 283 |
| 106 | iso_pu_bacteria | 2728369359 | 2730137657 | 283 |
| 107 | iso_pu_bacteria | 2751185905 | 2753811256 | 283 |
| 108 | iso_pu_bacteria | 2802428803 | 2802440475 | 283 |
| 109 | iso_pu_bacteria | 2889276214 | 2889277627 | 283 |
| 110 | iso_pu_bacteria | 2904595352 | 2904599908 | 283 |
| 111 | iso_pu_bacteria | 2939702853 | 2939706219 | 283 |
| 112 | iso_pu_bacteria | 2971403814 | 2971410128 | 283 |
| 113 | iso_pu_bacteria | 2984527788 | 2984532101 | 283 |
| 114 | iso_pu_bacteria | 2984532647 | 2984533356 | 283 |
| 115 | iso_pu_bacteria | 2996706504 | 2996710475 | 283 |
| 116 | iso_pu_bacteria | 648028048 | 648168117 | 283 |
| 117 | iso_pu_bacteria | 8054465665 | 8054472023 | 283 |
| 118 | iso_pu_bacteria | 8055632911 | 8055636761 | 283 |
| 119 | iso_pu_bacteria | 8057473075 | 8057477674 | 283 |
| 120 | iso_pu_bacteria | 8057977335 | 8057980085 | 283 |
| 121 | 3300002737 | JGI25162J39368_1007939 | JGI25162J39368_10079392 | 284 |
| 122 | 3300009011 | Ga0105251_10023712 | Ga0105251_100237122 | 284 |
| 123 | 3300009036 | Ga0105244_10017743 | Ga0105244_100177433 | 284 |
| 124 | 3300009036 | Ga0105244_10020062 | Ga0105244_100200624 | 284 |
| 125 | 3300011119 | Ga0105246_10001872 | Ga0105246_100018724 | 284 |
| 126 | 3300025225 | Ga0209566_105848 | Ga0209566_1058482 | 284 |
| 127 | 3300025233 | Ga0209437_100489 | Ga0209437_1004894 | 284 |
| 128 | 3300046515 | Ga0495620_0000908 | Ga0495620_0000908_6669_7538 | 284 |
| 129 | 3300048919 | Ga0496116_0015980 | Ga0496116_0015980_1141_2040 | 284 |
| 130 | 3300048925 | Ga0496122_0013991 | Ga0496122_0013991_454_1353 | 284 |
| 131 | 3300048927 | Ga0496124_0067962 | Ga0496124_0067962_962_1861 | 284 |
| 132 | 3300048928 | Ga0496125_0033730 | Ga0496125_0033730_3030_3929 | 284 |
| 133 | 3300049680 | Ga0501250_000241 | Ga0501250_000241_1273_2139 | 284 |
| 134 | iso_pu_bacteria | 2643221543 | 2643737599 | 284 |
| 135 | iso_pu_bacteria | 2821111986 | 2821118009 | 284 |
| 136 | iso_pu_bacteria | 2864733723 | 2864739504 | 284 |
| 137 | iso_pu_bacteria | 2885526491 | 2885529985 | 284 |
| 138 | iso_pu_bacteria | 2889042446 | 2889042625 | 284 |
| 139 | iso_pu_bacteria | 2904162308 | 2904167169 | 284 |
| 140 | iso_pu_bacteria | 2904490793 | 2904496564 | 284 |
| 141 | iso_pu_bacteria | 2919160200 | 2919165722 | 284 |
| 142 | iso_pu_bacteria | 2931384279 | 2931386050 | 284 |
| 143 | iso_pu_bacteria | 2939679117 | 2939684259 | 284 |
| 144 | iso_pu_bacteria | 2945991243 | 2945995341 | 284 |
| 145 | iso_pu_bacteria | 2946053406 | 2946058045 | 284 |
| 146 | 3300005329 | Ga0070683_100000068 | Ga0070683_10000006839 | 285 |
| 147 | 3300005331 | Ga0070670_100000307 | Ga0070670_10000030713 | 285 |
| 148 | 3300005331 | Ga0070670_100031503 | Ga0070670_1000315032 | 285 |
| 149 | 3300005334 | Ga0068869_100003954 | Ga0068869_1000039548 | 285 |
| 150 | 3300005334 | Ga0068869_100136693 | Ga0068869_1001366931 | 285 |
| 151 | 3300005334 | Ga0068869_100202865 | Ga0068869_1002028652 | 285 |
| 152 | 3300005336 | Ga0070680_100048137 | Ga0070680_1000481376 | 285 |
| 153 | 3300005337 | Ga0070682_100000001 | Ga0070682_100000001507 | 285 |
| 154 | 3300005337 | Ga0070682_100204792 | Ga0070682_1002047922 | 285 |
| 155 | 3300005338 | Ga0068868_100054885 | Ga0068868_1000548853 | 285 |
| 156 | 3300005340 | Ga0070689_100000313 | Ga0070689_10000031321 | 285 |
| 157 | 3300005343 | Ga0070687_100002787 | Ga0070687_1000027875 | 285 |
| 158 | 3300005354 | Ga0070675_100000048 | Ga0070675_10000004862 | 285 |
| 159 | 3300005367 | Ga0070667_100283096 | Ga0070667_1002830962 | 285 |
| 160 | 3300005435 | Ga0070714_100340749 | Ga0070714_1003407492 | 285 |
| 161 | 3300005436 | Ga0070713_100037861 | Ga0070713_1000378612 | 285 |
| 162 | 3300005441 | Ga0070700_100000025 | Ga0070700_10000002563 | 285 |
| 163 | 3300005445 | Ga0070708_100015454 | Ga0070708_1000154546 | 285 |
| 164 | 3300005445 | Ga0070708_100050180 | Ga0070708_1000501804 | 285 |
| 165 | 3300005445 | Ga0070708_100303585 | Ga0070708_1003035851 | 285 |
| 166 | 3300005456 | Ga0070678_100059795 | Ga0070678_1000597954 | 285 |
| 167 | 3300005467 | Ga0070706_100043744 | Ga0070706_1000437442 | 285 |
| 168 | 3300005467 | Ga0070706_100063371 | Ga0070706_1000633713 | 285 |
| 169 | 3300005467 | Ga0070706_100251593 | Ga0070706_1002515932 | 285 |
| 170 | 3300005467 | Ga0070706_100333815 | Ga0070706_1003338152 | 285 |
| 171 | 3300005467 | Ga0070706_100372606 | Ga0070706_1003726062 | 285 |
| 172 | 3300005468 | Ga0070707_100004121 | Ga0070707_1000041216 | 285 |
| 173 | 3300005468 | Ga0070707_100011738 | Ga0070707_1000117388 | 285 |
| 174 | 3300005468 | Ga0070707_100054608 | Ga0070707_1000546082 | 285 |
| 175 | 3300005468 | Ga0070707_100332233 | Ga0070707_1003322331 | 285 |
| 176 | 3300005468 | Ga0070707_100357795 | Ga0070707_1003577952 | 285 |
| 177 | 3300005471 | Ga0070698_100039345 | Ga0070698_1000393455 | 285 |
| 178 | 3300005471 | Ga0070698_100078905 | Ga0070698_1000789054 | 285 |
| 179 | 3300005471 | Ga0070698_100129104 | Ga0070698_1001291043 | 285 |
| 180 | 3300005471 | Ga0070698_100207217 | Ga0070698_1002072172 | 285 |
| 181 | 3300005518 | Ga0070699_100017241 | Ga0070699_1000172415 | 285 |
| 182 | 3300005518 | Ga0070699_100037743 | Ga0070699_1000377432 | 285 |
| 183 | 3300005518 | Ga0070699_100173255 | Ga0070699_1001732552 | 285 |
| 184 | 3300005518 | Ga0070699_100196556 | Ga0070699_1001965562 | 285 |
| 185 | 3300005518 | Ga0070699_100340823 | Ga0070699_1003408232 | 285 |
| 186 | 3300005535 | Ga0070684_100000096 | Ga0070684_10000009622 | 285 |
| 187 | 3300005535 | Ga0070684_100369102 | Ga0070684_1003691021 | 285 |
| 188 | 3300005536 | Ga0070697_100065749 | Ga0070697_1000657494 | 285 |
| 189 | 3300005536 | Ga0070697_100129779 | Ga0070697_1001297792 | 285 |
| 190 | 3300005536 | Ga0070697_100385692 | Ga0070697_1003856921 | 285 |
| 191 | 3300005539 | Ga0068853_100217588 | Ga0068853_1002175882 | 285 |
| 192 | 3300005543 | Ga0070672_100000816 | Ga0070672_10000081621 | 285 |
| 193 | 3300005546 | Ga0070696_100254960 | Ga0070696_1002549602 | 285 |
| 194 | 3300005547 | Ga0070693_100033852 | Ga0070693_1000338523 | 285 |
| 195 | 3300005577 | Ga0068857_100017024 | Ga0068857_1000170244 | 285 |
| 196 | 3300005578 | Ga0068854_100013751 | Ga0068854_1000137517 | 285 |
| 197 | 3300005578 | Ga0068854_100119965 | Ga0068854_1001199651 | 285 |
| 198 | 3300005615 | Ga0070702_100174268 | Ga0070702_1001742682 | 285 |
| 199 | 3300005618 | Ga0068864_100000997 | Ga0068864_10000099712 | 285 |
| 200 | 3300005719 | Ga0068861_100325594 | Ga0068861_1003255941 | 285 |
| 201 | 3300005842 | Ga0068858_100002023 | Ga0068858_1000020232 | 285 |
| 202 | 3300006028 | Ga0070717_10000082 | Ga0070717_1000008267 | 285 |
| 203 | 3300006028 | Ga0070717_10115019 | Ga0070717_101150193 | 285 |
| 204 | 3300006028 | Ga0070717_10264531 | Ga0070717_102645312 | 285 |
| 205 | 3300006844 | Ga0075428_100003895 | Ga0075428_10000389510 | 285 |
| 206 | 3300006844 | Ga0075428_100476298 | Ga0075428_1004762982 | 285 |
| 207 | 3300006847 | Ga0075431_100010356 | Ga0075431_1000103568 | 285 |
| 208 | 3300006881 | Ga0068865_100033932 | Ga0068865_1000339324 | 285 |
| 209 | 3300006914 | Ga0075436_100154885 | Ga0075436_1001548852 | 285 |
| 210 | 3300007076 | Ga0075435_100044239 | Ga0075435_1000442392 | 285 |
| 211 | 3300007076 | Ga0075435_100054757 | Ga0075435_1000547572 | 285 |
| 212 | 3300007076 | Ga0075435_100138974 | Ga0075435_1001389742 | 285 |
| 213 | 3300009036 | Ga0105244_10024614 | Ga0105244_100246142 | 285 |
| 214 | 3300009094 | Ga0111539_10000052 | Ga0111539_1000005247 | 285 |
| 215 | 3300009098 | Ga0105245_10000226 | Ga0105245_1000022648 | 285 |
| 216 | 3300009098 | Ga0105245_10001090 | Ga0105245_1000109011 | 285 |
| 217 | 3300009098 | Ga0105245_10003826 | Ga0105245_100038265 | 285 |
| 218 | 3300009147 | Ga0114129_10306441 | Ga0114129_103064412 | 285 |
| 219 | 3300009147 | Ga0114129_10613821 | Ga0114129_106138212 | 285 |
| 220 | 3300009176 | Ga0105242_10004808 | Ga0105242_100048086 | 285 |
| 221 | 3300009177 | Ga0105248_10216482 | Ga0105248_102164822 | 285 |
| 222 | 3300009177 | Ga0105248_10545825 | Ga0105248_105458251 | 285 |
| 223 | 3300009551 | Ga0105238_10000001 | Ga0105238_10000001586 | 285 |
| 224 | 3300010375 | Ga0105239_10057370 | Ga0105239_100573705 | 285 |
| 225 | 3300013105 | Ga0157369_10000539 | Ga0157369_1000053929 | 285 |
| 226 | 3300013296 | Ga0157374_10000012 | Ga0157374_10000012154 | 285 |
| 227 | 3300013297 | Ga0157378_10003527 | Ga0157378_100035278 | 285 |
| 228 | 3300013297 | Ga0157378_10005757 | Ga0157378_100057577 | 285 |
| 229 | 3300013297 | Ga0157378_10041805 | Ga0157378_100418054 | 285 |
| 230 | 3300013306 | Ga0163162_10025250 | Ga0163162_100252504 | 285 |
| 231 | 3300013308 | Ga0157375_10000008 | Ga0157375_10000008175 | 285 |
| 232 | 3300013308 | Ga0157375_10000146 | Ga0157375_1000014672 | 285 |
| 233 | 3300014325 | Ga0163163_10457989 | Ga0163163_104579892 | 285 |
| 234 | 3300014326 | Ga0157380_10018575 | Ga0157380_100185759 | 285 |
| 235 | 3300014745 | Ga0157377_10000002 | Ga0157377_10000002286 | 285 |
| 236 | 3300014745 | Ga0157377_10000024 | Ga0157377_10000024105 | 285 |
| 237 | 3300014969 | Ga0157376_10000025 | Ga0157376_1000002557 | 285 |
| 238 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002889 | 285 |
| 239 | 3300021358 | Ga0213873_10005074 | Ga0213873_100050742 | 285 |
| 240 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001972 | 285 |
| 241 | 3300021384 | Ga0213876_10000080 | Ga0213876_1000008051 | 285 |
| 242 | 3300021384 | Ga0213876_10033554 | Ga0213876_100335542 | 285 |
| 243 | 3300025728 | Ga0207655_1033348 | Ga0207655_10333482 | 285 |
| 244 | 3300025909 | Ga0207705_10023924 | Ga0207705_100239241 | 285 |
| 245 | 3300025910 | Ga0207684_10037756 | Ga0207684_100377565 | 285 |
| 246 | 3300025917 | Ga0207660_10054213 | Ga0207660_100542134 | 285 |
| 247 | 3300025918 | Ga0207662_10001748 | Ga0207662_100017485 | 285 |
| 248 | 3300025922 | Ga0207646_10053889 | Ga0207646_100538894 | 285 |
| 249 | 3300025922 | Ga0207646_10091400 | Ga0207646_100914002 | 285 |
| 250 | 3300025922 | Ga0207646_10115271 | Ga0207646_101152712 | 285 |
| 251 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011627 | 285 |
| 252 | 3300025925 | Ga0207650_10000262 | Ga0207650_1000026240 | 285 |
| 253 | 3300025925 | Ga0207650_10040481 | Ga0207650_100404814 | 285 |
| 254 | 3300025926 | Ga0207659_10000007 | Ga0207659_10000007291 | 285 |
| 255 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003214 | 285 |
| 256 | 3300025927 | Ga0207687_10000589 | Ga0207687_1000058911 | 285 |
| 257 | 3300025927 | Ga0207687_10002009 | Ga0207687_100020096 | 285 |
| 258 | 3300025928 | Ga0207700_10025113 | Ga0207700_100251132 | 285 |
| 259 | 3300025934 | Ga0207686_10006165 | Ga0207686_100061655 | 285 |
| 260 | 3300025936 | Ga0207670_10000755 | Ga0207670_1000075512 | 285 |
| 261 | 3300025940 | Ga0207691_10000269 | Ga0207691_1000026940 | 285 |
| 262 | 3300025940 | Ga0207691_10409083 | Ga0207691_104090832 | 285 |
| 263 | 3300025941 | Ga0207711_10138751 | Ga0207711_101387512 | 285 |
| 264 | 3300025941 | Ga0207711_10344327 | Ga0207711_103443272 | 285 |
| 265 | 3300025941 | Ga0207711_10382035 | Ga0207711_103820351 | 285 |
| 266 | 3300025942 | Ga0207689_10013865 | Ga0207689_100138654 | 285 |
| 267 | 3300025942 | Ga0207689_10053262 | Ga0207689_100532624 | 285 |
| 268 | 3300025944 | Ga0207661_10000001 | Ga0207661_10000001182 | 285 |
| 269 | 3300025960 | Ga0207651_10014030 | Ga0207651_100140305 | 285 |
| 270 | 3300025981 | Ga0207640_10006617 | Ga0207640_100066173 | 285 |
| 271 | 3300025981 | Ga0207640_10044675 | Ga0207640_100446753 | 285 |
| 272 | 3300026023 | Ga0207677_10000045 | Ga0207677_10000045100 | 285 |
| 273 | 3300026023 | Ga0207677_10000633 | Ga0207677_1000063315 | 285 |
| 274 | 3300026035 | Ga0207703_10000104 | Ga0207703_100001042 | 285 |
| 275 | 3300026041 | Ga0207639_10000051 | Ga0207639_1000005183 | 285 |
| 276 | 3300026041 | Ga0207639_10182832 | Ga0207639_101828321 | 285 |
| 277 | 3300026075 | Ga0207708_10000052 | Ga0207708_1000005241 | 285 |
| 278 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013211 | 285 |
| 279 | 3300026116 | Ga0207674_10051491 | Ga0207674_100514912 | 285 |
| 280 | 3300026118 | Ga0207675_100021034 | Ga0207675_1000210341 | 285 |
| 281 | 3300026121 | Ga0207683_10036611 | Ga0207683_100366113 | 285 |
| 282 | 3300027907 | Ga0207428_10000003 | Ga0207428_1000000347 | 285 |
| 283 | 3300030521 | Ga0307511_10009303 | Ga0307511_1000930310 | 285 |
| 284 | 3300032002 | Ga0307416_100276082 | Ga0307416_1002760822 | 285 |
| 285 | 3300035112 | Ga0373932_0002001 | Ga0373932_0002001_1501_2367 | 285 |
| 286 | 3300039437 | Ga0436365_0404975 | Ga0436365_0404975_123016_123882 | 285 |
| 287 | 3300039437 | Ga0436365_1042710 | Ga0436365_1042710_14433_15299 | 285 |
| 288 | 3300039437 | Ga0436365_1645708 | Ga0436365_1645708_34464_35330 | 285 |
| 289 | 3300039453 | Ga0436362_0551129 | Ga0436362_0551129_5346_6212 | 285 |
| 290 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_36353_37219 | 285 |
| 291 | 3300041496 | Ga0451839_0558968 | Ga0451839_0558968_2054_2920 | 285 |
| 292 | 3300042876 | Ga0451577_0027632 | Ga0451577_0027632_1256_2128 | 285 |
| 293 | 3300044673 | Ga0453683_0010212 | Ga0453683_0010212_4585_5451 | 285 |
| 294 | 3300044712 | Ga0453684_0039042 | Ga0453684_0039042_3020_3892 | 285 |
| 295 | 3300049589 | Ga0501073_0000867 | Ga0501073_0000867_19549_20436 | 285 |
| 296 | 3300050507 | nmdc:mga05p37_158979_c1 | nmdc:mga05p37_158979_c1_1684_2553 | 285 |
| 297 | 3300050510 | nmdc:mga06r32_2480_c1 | nmdc:mga06r32_2480_c1_1117_2043 | 285 |
| 298 | 3300050511 | nmdc:mga08y16_4_c1 | nmdc:mga08y16_4_c1_870948_871814 | 285 |
| 299 | 3300050513 | nmdc:mga0rr50_37_c1 | nmdc:mga0rr50_37_c1_1135_2001 | 285 |
| 300 | 3300050513 | nmdc:mga0rr50_41691_c1 | nmdc:mga0rr50_41691_c1_724_1599 | 285 |
| 301 | 3300050513 | nmdc:mga0rr50_53617_c1 | nmdc:mga0rr50_53617_c1_498_1364 | 285 |
| 302 | 3300050514 | nmdc:mga08x19_97979_c1 | nmdc:mga08x19_97979_c1_456_1322 | 285 |
| 303 | 3300053083 | Ga0495655_0000153 | Ga0495655_0000153_3931_4797 | 285 |
| 304 | 3300003373 | JGI25407J50210_10003315 | JGI25407J50210_100033151 | 286 |
| 305 | 3300005445 | Ga0070708_100188626 | Ga0070708_1001886262 | 286 |
| 306 | 3300005468 | Ga0070707_100023978 | Ga0070707_1000239783 | 286 |
| 307 | 3300005937 | Ga0081455_10031389 | Ga0081455_100313893 | 286 |
| 308 | 3300005981 | Ga0081538_10002079 | Ga0081538_100020799 | 286 |
| 309 | 3300005981 | Ga0081538_10002290 | Ga0081538_1000229018 | 286 |
| 310 | 3300005981 | Ga0081538_10018162 | Ga0081538_100181622 | 286 |
| 311 | 3300006237 | Ga0097621_100211511 | Ga0097621_1002115112 | 286 |
| 312 | 3300006844 | Ga0075428_100893862 | Ga0075428_1008938621 | 286 |
| 313 | 3300006847 | Ga0075431_100082208 | Ga0075431_1000822083 | 286 |
| 314 | 3300006847 | Ga0075431_100355227 | Ga0075431_1003552271 | 286 |
| 315 | 3300006871 | Ga0075434_100275753 | Ga0075434_1002757532 | 286 |
| 316 | 3300009094 | Ga0111539_10233267 | Ga0111539_102332672 | 286 |
| 317 | 3300009147 | Ga0114129_10091236 | Ga0114129_100912361 | 286 |
| 318 | 3300013306 | Ga0163162_10169426 | Ga0163162_101694262 | 286 |
| 319 | 3300025919 | Ga0207657_10245055 | Ga0207657_102450552 | 286 |
| 320 | 3300025922 | Ga0207646_10032240 | Ga0207646_100322403 | 286 |
| 321 | 3300050507 | nmdc:mga05p37_73036_c1 | nmdc:mga05p37_73036_c1_3220_4083 | 286 |
| 322 | 3300050510 | nmdc:mga06r32_54931_c1 | nmdc:mga06r32_54931_c1_2070_2933 | 286 |
| 323 | 3300001990 | JGI24737J22298_10045331 | JGI24737J22298_100453312 | 287 |
| 324 | 3300005295 | Ga0065707_10082720 | Ga0065707_100827208 | 287 |
| 325 | 3300005295 | Ga0065707_10116780 | Ga0065707_101167803 | 287 |
| 326 | 3300005295 | Ga0065707_10123525 | Ga0065707_101235252 | 287 |
| 327 | 3300005328 | Ga0070676_10006744 | Ga0070676_100067446 | 287 |
| 328 | 3300005330 | Ga0070690_100001073 | Ga0070690_10000107314 | 287 |
| 329 | 3300005330 | Ga0070690_100135706 | Ga0070690_1001357062 | 287 |
| 330 | 3300005330 | Ga0070690_100210215 | Ga0070690_1002102152 | 287 |
| 331 | 3300005335 | Ga0070666_10052647 | Ga0070666_100526472 | 287 |
| 332 | 3300005336 | Ga0070680_100010960 | Ga0070680_1000109602 | 287 |
| 333 | 3300005338 | Ga0068868_100003075 | Ga0068868_1000030757 | 287 |
| 334 | 3300005339 | Ga0070660_100031892 | Ga0070660_1000318922 | 287 |
| 335 | 3300005340 | Ga0070689_100000158 | Ga0070689_10000015829 | 287 |
| 336 | 3300005340 | Ga0070689_100302634 | Ga0070689_1003026342 | 287 |
| 337 | 3300005343 | Ga0070687_100019380 | Ga0070687_1000193803 | 287 |
| 338 | 3300005344 | Ga0070661_100091668 | Ga0070661_1000916681 | 287 |
| 339 | 3300005347 | Ga0070668_100301993 | Ga0070668_1003019931 | 287 |
| 340 | 3300005353 | Ga0070669_100058795 | Ga0070669_1000587953 | 287 |
| 341 | 3300005354 | Ga0070675_100000972 | Ga0070675_1000009727 | 287 |
| 342 | 3300005354 | Ga0070675_100351520 | Ga0070675_1003515202 | 287 |
| 343 | 3300005355 | Ga0070671_100029539 | Ga0070671_1000295391 | 287 |
| 344 | 3300005356 | Ga0070674_100000802 | Ga0070674_10000080215 | 287 |
| 345 | 3300005364 | Ga0070673_100000143 | Ga0070673_1000001436 | 287 |
| 346 | 3300005365 | Ga0070688_100000873 | Ga0070688_1000008738 | 287 |
| 347 | 3300005365 | Ga0070688_100032751 | Ga0070688_1000327513 | 287 |
| 348 | 3300005366 | Ga0070659_100055925 | Ga0070659_1000559252 | 287 |
| 349 | 3300005435 | Ga0070714_100150207 | Ga0070714_1001502072 | 287 |
| 350 | 3300005437 | Ga0070710_10097847 | Ga0070710_100978472 | 287 |
| 351 | 3300005438 | Ga0070701_10000590 | Ga0070701_100005907 | 287 |
| 352 | 3300005441 | Ga0070700_100008756 | Ga0070700_1000087564 | 287 |
| 353 | 3300005444 | Ga0070694_100017884 | Ga0070694_1000178844 | 287 |
| 354 | 3300005444 | Ga0070694_100023393 | Ga0070694_1000233931 | 287 |
| 355 | 3300005445 | Ga0070708_100028093 | Ga0070708_1000280936 | 287 |
| 356 | 3300005445 | Ga0070708_100347490 | Ga0070708_1003474901 | 287 |
| 357 | 3300005456 | Ga0070678_100000378 | Ga0070678_1000003785 | 287 |
| 358 | 3300005457 | Ga0070662_100014731 | Ga0070662_1000147313 | 287 |
| 359 | 3300005458 | Ga0070681_10023873 | Ga0070681_100238736 | 287 |
| 360 | 3300005458 | Ga0070681_10222263 | Ga0070681_102222631 | 287 |
| 361 | 3300005459 | Ga0068867_100017876 | Ga0068867_1000178764 | 287 |
| 362 | 3300005459 | Ga0068867_100066323 | Ga0068867_1000663233 | 287 |
| 363 | 3300005459 | Ga0068867_100122130 | Ga0068867_1001221302 | 287 |
| 364 | 3300005466 | Ga0070685_10001043 | Ga0070685_100010439 | 287 |
| 365 | 3300005466 | Ga0070685_10088965 | Ga0070685_100889653 | 287 |
| 366 | 3300005468 | Ga0070707_100000111 | Ga0070707_10000011147 | 287 |
| 367 | 3300005468 | Ga0070707_100053740 | Ga0070707_1000537404 | 287 |
| 368 | 3300005471 | Ga0070698_100145050 | Ga0070698_1001450503 | 287 |
| 369 | 3300005471 | Ga0070698_100226469 | Ga0070698_1002264692 | 287 |
| 370 | 3300005518 | Ga0070699_100013096 | Ga0070699_1000130964 | 287 |
| 371 | 3300005518 | Ga0070699_100067647 | Ga0070699_1000676473 | 287 |
| 372 | 3300005518 | Ga0070699_100107172 | Ga0070699_1001071723 | 287 |
| 373 | 3300005518 | Ga0070699_100531375 | Ga0070699_1005313751 | 287 |
| 374 | 3300005530 | Ga0070679_100194369 | Ga0070679_1001943693 | 287 |
| 375 | 3300005536 | Ga0070697_100016123 | Ga0070697_1000161232 | 287 |
| 376 | 3300005536 | Ga0070697_100054865 | Ga0070697_1000548652 | 287 |
| 377 | 3300005543 | Ga0070672_100000197 | Ga0070672_10000019733 | 287 |
| 378 | 3300005543 | Ga0070672_100089388 | Ga0070672_1000893883 | 287 |
| 379 | 3300005544 | Ga0070686_100000174 | Ga0070686_10000017436 | 287 |
| 380 | 3300005544 | Ga0070686_100001516 | Ga0070686_10000151611 | 287 |
| 381 | 3300005544 | Ga0070686_100087711 | Ga0070686_1000877112 | 287 |
| 382 | 3300005544 | Ga0070686_100119575 | Ga0070686_1001195752 | 287 |
| 383 | 3300005545 | Ga0070695_100010445 | Ga0070695_1000104453 | 287 |
| 384 | 3300005545 | Ga0070695_100053395 | Ga0070695_1000533952 | 287 |
| 385 | 3300005545 | Ga0070695_100163353 | Ga0070695_1001633532 | 287 |
| 386 | 3300005546 | Ga0070696_100018688 | Ga0070696_1000186882 | 287 |
| 387 | 3300005546 | Ga0070696_100071775 | Ga0070696_1000717752 | 287 |
| 388 | 3300005546 | Ga0070696_100140375 | Ga0070696_1001403751 | 287 |
| 389 | 3300005546 | Ga0070696_100142984 | Ga0070696_1001429841 | 287 |
| 390 | 3300005548 | Ga0070665_100492611 | Ga0070665_1004926112 | 287 |
| 391 | 3300005549 | Ga0070704_100053926 | Ga0070704_1000539262 | 287 |
| 392 | 3300005549 | Ga0070704_100107701 | Ga0070704_1001077012 | 287 |
| 393 | 3300005549 | Ga0070704_100112327 | Ga0070704_1001123273 | 287 |
| 394 | 3300005564 | Ga0070664_100001536 | Ga0070664_1000015362 | 287 |
| 395 | 3300005564 | Ga0070664_100017169 | Ga0070664_1000171693 | 287 |
| 396 | 3300005578 | Ga0068854_100048947 | Ga0068854_1000489472 | 287 |
| 397 | 3300005615 | Ga0070702_100008166 | Ga0070702_1000081661 | 287 |
| 398 | 3300005617 | Ga0068859_100003507 | Ga0068859_10000350710 | 287 |
| 399 | 3300005843 | Ga0068860_100103379 | Ga0068860_1001033792 | 287 |
| 400 | 3300005937 | Ga0081455_10002418 | Ga0081455_100024184 | 287 |
| 401 | 3300006163 | Ga0070715_10064716 | Ga0070715_100647162 | 287 |
| 402 | 3300006163 | Ga0070715_10111335 | Ga0070715_101113352 | 287 |
| 403 | 3300006173 | Ga0070716_100049868 | Ga0070716_1000498683 | 287 |
| 404 | 3300006173 | Ga0070716_100107551 | Ga0070716_1001075512 | 287 |
| 405 | 3300006237 | Ga0097621_100007547 | Ga0097621_1000075474 | 287 |
| 406 | 3300006237 | Ga0097621_100015212 | Ga0097621_1000152124 | 287 |
| 407 | 3300006237 | Ga0097621_100196611 | Ga0097621_1001966112 | 287 |
| 408 | 3300006358 | Ga0068871_100018386 | Ga0068871_1000183862 | 287 |
| 409 | 3300006358 | Ga0068871_100023078 | Ga0068871_1000230786 | 287 |
| 410 | 3300006844 | Ga0075428_100044459 | Ga0075428_1000444596 | 287 |
| 411 | 3300006846 | Ga0075430_100002247 | Ga0075430_1000022476 | 287 |
| 412 | 3300006846 | Ga0075430_100173673 | Ga0075430_1001736732 | 287 |
| 413 | 3300006852 | Ga0075433_10078793 | Ga0075433_100787933 | 287 |
| 414 | 3300006852 | Ga0075433_10182979 | Ga0075433_101829792 | 287 |
| 415 | 3300006852 | Ga0075433_10316434 | Ga0075433_103164342 | 287 |
| 416 | 3300006871 | Ga0075434_100218520 | Ga0075434_1002185201 | 287 |
| 417 | 3300006871 | Ga0075434_100271478 | Ga0075434_1002714783 | 287 |
| 418 | 3300006871 | Ga0075434_100370437 | Ga0075434_1003704372 | 287 |
| 419 | 3300006880 | Ga0075429_100439037 | Ga0075429_1004390372 | 287 |
| 420 | 3300006914 | Ga0075436_100033049 | Ga0075436_1000330493 | 287 |
| 421 | 3300006914 | Ga0075436_100041870 | Ga0075436_1000418703 | 287 |
| 422 | 3300006931 | Ga0097620_100003507 | Ga0097620_10000350710 | 287 |
| 423 | 3300007076 | Ga0075435_100020219 | Ga0075435_1000202196 | 287 |
| 424 | 3300007265 | Ga0099794_10053906 | Ga0099794_100539062 | 287 |
| 425 | 3300009093 | Ga0105240_10634056 | Ga0105240_106340561 | 287 |
| 426 | 3300009094 | Ga0111539_10000081 | Ga0111539_1000008181 | 287 |
| 427 | 3300009098 | Ga0105245_10093804 | Ga0105245_100938042 | 287 |
| 428 | 3300009176 | Ga0105242_10136137 | Ga0105242_101361372 | 287 |
| 429 | 3300009177 | Ga0105248_10000986 | Ga0105248_1000098636 | 287 |
| 430 | 3300009177 | Ga0105248_10214972 | Ga0105248_102149722 | 287 |
| 431 | 3300013102 | Ga0157371_10015408 | Ga0157371_100154082 | 287 |
| 432 | 3300013104 | Ga0157370_10056802 | Ga0157370_100568024 | 287 |
| 433 | 3300013105 | Ga0157369_10696640 | Ga0157369_106966401 | 287 |
| 434 | 3300013296 | Ga0157374_10039617 | Ga0157374_100396175 | 287 |
| 435 | 3300013297 | Ga0157378_10000610 | Ga0157378_1000061029 | 287 |
| 436 | 3300013297 | Ga0157378_10061302 | Ga0157378_100613024 | 287 |
| 437 | 3300013297 | Ga0157378_10080404 | Ga0157378_100804043 | 287 |
| 438 | 3300013307 | Ga0157372_10301702 | Ga0157372_103017022 | 287 |
| 439 | 3300013308 | Ga0157375_10005069 | Ga0157375_100050698 | 287 |
| 440 | 3300013308 | Ga0157375_10056602 | Ga0157375_100566025 | 287 |
| 441 | 3300014325 | Ga0163163_10316225 | Ga0163163_103162252 | 287 |
| 442 | 3300014326 | Ga0157380_10000693 | Ga0157380_100006936 | 287 |
| 443 | 3300014326 | Ga0157380_10006017 | Ga0157380_100060176 | 287 |
| 444 | 3300014326 | Ga0157380_10034037 | Ga0157380_100340376 | 287 |
| 445 | 3300014968 | Ga0157379_10141149 | Ga0157379_101411492 | 287 |
| 446 | 3300014969 | Ga0157376_10005233 | Ga0157376_100052335 | 287 |
| 447 | 3300025315 | Ga0207697_10062047 | Ga0207697_100620472 | 287 |
| 448 | 3300025885 | Ga0207653_10073523 | Ga0207653_100735232 | 287 |
| 449 | 3300025898 | Ga0207692_10179711 | Ga0207692_101797112 | 287 |
| 450 | 3300025903 | Ga0207680_10164300 | Ga0207680_101643002 | 287 |
| 451 | 3300025905 | Ga0207685_10098803 | Ga0207685_100988031 | 287 |
| 452 | 3300025907 | Ga0207645_10011166 | Ga0207645_100111662 | 287 |
| 453 | 3300025910 | Ga0207684_10047017 | Ga0207684_100470174 | 287 |
| 454 | 3300025910 | Ga0207684_10258846 | Ga0207684_102588462 | 287 |
| 455 | 3300025912 | Ga0207707_10033042 | Ga0207707_100330425 | 287 |
| 456 | 3300025916 | Ga0207663_10016813 | Ga0207663_100168133 | 287 |
| 457 | 3300025917 | Ga0207660_10042127 | Ga0207660_100421272 | 287 |
| 458 | 3300025917 | Ga0207660_10050073 | Ga0207660_100500731 | 287 |
| 459 | 3300025918 | Ga0207662_10007817 | Ga0207662_100078177 | 287 |
| 460 | 3300025918 | Ga0207662_10092831 | Ga0207662_100928313 | 287 |
| 461 | 3300025921 | Ga0207652_10027811 | Ga0207652_100278112 | 287 |
| 462 | 3300025921 | Ga0207652_10220854 | Ga0207652_102208542 | 287 |
| 463 | 3300025922 | Ga0207646_10000163 | Ga0207646_1000016350 | 287 |
| 464 | 3300025922 | Ga0207646_10014015 | Ga0207646_100140156 | 287 |
| 465 | 3300025923 | Ga0207681_10058275 | Ga0207681_100582751 | 287 |
| 466 | 3300025926 | Ga0207659_10043589 | Ga0207659_100435892 | 287 |
| 467 | 3300025926 | Ga0207659_10299634 | Ga0207659_102996341 | 287 |
| 468 | 3300025927 | Ga0207687_10205637 | Ga0207687_102056372 | 287 |
| 469 | 3300025931 | Ga0207644_10053118 | Ga0207644_100531183 | 287 |
| 470 | 3300025932 | Ga0207690_10096302 | Ga0207690_100963022 | 287 |
| 471 | 3300025933 | Ga0207706_10003099 | Ga0207706_1000309916 | 287 |
| 472 | 3300025934 | Ga0207686_10149949 | Ga0207686_101499491 | 287 |
| 473 | 3300025936 | Ga0207670_10001520 | Ga0207670_100015202 | 287 |
| 474 | 3300025937 | Ga0207669_10020258 | Ga0207669_100202584 | 287 |
| 475 | 3300025939 | Ga0207665_10011128 | Ga0207665_100111283 | 287 |
| 476 | 3300025940 | Ga0207691_10000080 | Ga0207691_1000008043 | 287 |
| 477 | 3300025940 | Ga0207691_10082615 | Ga0207691_100826153 | 287 |
| 478 | 3300025941 | Ga0207711_10085133 | Ga0207711_100851333 | 287 |
| 479 | 3300025942 | Ga0207689_10156275 | Ga0207689_101562751 | 287 |
| 480 | 3300025945 | Ga0207679_10001532 | Ga0207679_100015329 | 287 |
| 481 | 3300025960 | Ga0207651_10000078 | Ga0207651_1000007832 | 287 |
| 482 | 3300025960 | Ga0207651_10284059 | Ga0207651_102840592 | 287 |
| 483 | 3300025981 | Ga0207640_10022528 | Ga0207640_100225282 | 287 |
| 484 | 3300026023 | Ga0207677_10097106 | Ga0207677_100971062 | 287 |
| 485 | 3300026075 | Ga0207708_10000207 | Ga0207708_1000020735 | 287 |
| 486 | 3300026075 | Ga0207708_10254334 | Ga0207708_102543341 | 287 |
| 487 | 3300026089 | Ga0207648_10006188 | Ga0207648_100061886 | 287 |
| 488 | 3300026089 | Ga0207648_10044257 | Ga0207648_100442573 | 287 |
| 489 | 3300026089 | Ga0207648_10328143 | Ga0207648_103281432 | 287 |
| 490 | 3300026121 | Ga0207683_10005661 | Ga0207683_100056619 | 287 |
| 491 | 3300026121 | Ga0207683_10614336 | Ga0207683_106143361 | 287 |
| 492 | 3300027695 | Ga0209966_1017447 | Ga0209966_10174471 | 287 |
| 493 | 3300027907 | Ga0207428_10004729 | Ga0207428_100047299 | 287 |
| 494 | 3300028381 | Ga0268264_10079364 | Ga0268264_100793642 | 287 |
| 495 | 3300031852 | Ga0307410_10195303 | Ga0307410_101953031 | 287 |
| 496 | 3300031995 | Ga0307409_100252355 | Ga0307409_1002523552 | 287 |
| 497 | 3300032002 | Ga0307416_100042987 | Ga0307416_1000429873 | 287 |
| 498 | 3300032005 | Ga0307411_10010860 | Ga0307411_100108603 | 287 |
| 499 | 3300032005 | Ga0307411_10450908 | Ga0307411_104509081 | 287 |
| 500 | 3300035083 | Ga0373926_0015991 | Ga0373926_0015991_731_1597 | 287 |
| 501 | 3300035116 | Ga0373945_0045156 | Ga0373945_0045156_452_1318 | 287 |
| 502 | 3300035692 | Ga0373935_0184308 | Ga0373935_0184308_200_1066 | 287 |
| 503 | 3300035724 | Ga0373933_0042796 | Ga0373933_0042796_140_1006 | 287 |
| 504 | 3300036401 | Ga0373937_0268739 | Ga0373937_0268739_604_1470 | 287 |
| 505 | 3300037068 | Ga0373925_0070409 | Ga0373925_0070409_1575_2441 | 287 |
| 506 | 3300041411 | Ga0439466_0057542 | Ga0439466_0057542_380_1246 | 287 |
| 507 | 3300041999 | Ga0439433_0037166 | Ga0439433_0037166_187_1053 | 287 |
| 508 | 3300042006 | Ga0439432_029127 | Ga0439432_029127_241_1107 | 287 |
| 509 | 3300042010 | Ga0439452_002900 | Ga0439452_002900_3519_4385 | 287 |
| 510 | 3300042013 | Ga0439456_024964 | Ga0439456_024964_126_992 | 287 |
| 511 | 3300042015 | Ga0439462_0021271 | Ga0439462_0021271_380_1246 | 287 |
| 512 | 3300042156 | Ga0439446_0008143 | Ga0439446_0008143_1861_2727 | 287 |
| 513 | 3300042435 | Ga0439434_0005421 | Ga0439434_0005421_1218_2084 | 287 |
| 514 | 3300042437 | Ga0439444_0013099 | Ga0439444_0013099_373_1239 | 287 |
| 515 | 3300042461 | Ga0439460_0008942 | Ga0439460_0008942_889_1764 | 287 |
| 516 | 3300045051 | Ga0451576_0004157 | Ga0451576_0004157_4821_5687 | 287 |
| 517 | 3300045051 | Ga0451576_0432850 | Ga0451576_0432850_274_1140 | 287 |
| 518 | 3300045976 | Ga0466967_0064347 | Ga0466967_0064347_445_1311 | 287 |
| 519 | 3300046499 | Ga0495594_0019012 | Ga0495594_0019012_616_1482 | 287 |
| 520 | 3300046499 | Ga0495594_0078748 | Ga0495594_0078748_581_1447 | 287 |
| 521 | 3300046683 | Ga0495658_0124447 | Ga0495658_0124447_441_1307 | 287 |
| 522 | 3300047321 | Ga0495676_0341787 | Ga0495676_0341787_43_909 | 287 |
| 523 | 3300047322 | Ga0495680_0019066 | Ga0495680_0019066_2339_3205 | 287 |
| 524 | 3300047322 | Ga0495680_0023451 | Ga0495680_0023451_984_1850 | 287 |
| 525 | 3300048904 | Ga0496101_0201695 | Ga0496101_0201695_643_1509 | 287 |
| 526 | 3300048907 | Ga0496104_0081394 | Ga0496104_0081394_1666_2532 | 287 |
| 527 | 3300048911 | Ga0496108_0036239 | Ga0496108_0036239_1354_2220 | 287 |
| 528 | 3300048912 | Ga0496109_0012412 | Ga0496109_0012412_4876_5742 | 287 |
| 529 | 3300048913 | Ga0496110_0271418 | Ga0496110_0271418_534_1400 | 287 |
| 530 | 3300048917 | Ga0496114_0004335 | Ga0496114_0004335_5309_6175 | 287 |
| 531 | 3300049513 | Ga0501290_000006 | Ga0501290_000006_11781_12647 | 287 |
| 532 | 3300049514 | Ga0501291_000100 | Ga0501291_000100_1447_2313 | 287 |
| 533 | 3300049515 | Ga0501292_000119 | Ga0501292_000119_5905_6771 | 287 |
| 534 | 3300049516 | Ga0501293_000069 | Ga0501293_000069_5526_6392 | 287 |
| 535 | 3300049517 | Ga0501294_000531 | Ga0501294_000531_688_1554 | 287 |
| 536 | 3300049518 | Ga0501295_000505 | Ga0501295_000505_817_1683 | 287 |
| 537 | 3300049519 | Ga0501296_000055 | Ga0501296_000055_1622_2488 | 287 |
| 538 | 3300049520 | Ga0501297_000036 | Ga0501297_000036_2077_2943 | 287 |
| 539 | 3300049521 | Ga0501298_000067 | Ga0501298_000067_7856_8722 | 287 |
| 540 | 3300049522 | Ga0501299_000019 | Ga0501299_000019_7856_8722 | 287 |
| 541 | 3300049522 | Ga0501299_022016 | Ga0501299_022016_30_896 | 287 |
| 542 | 3300049523 | Ga0501300_000028 | Ga0501300_000028_20142_21008 | 287 |
| 543 | 3300049524 | Ga0501301_000101 | Ga0501301_000101_1380_2246 | 287 |
| 544 | 3300049525 | Ga0501302_000132 | Ga0501302_000132_1026_1892 | 287 |
| 545 | 3300049568 | Ga0501031_0002722 | Ga0501031_0002722_9048_9920 | 287 |
| 546 | 3300049568 | Ga0501031_0013748 | Ga0501031_0013748_3399_4265 | 287 |
| 547 | 3300049568 | Ga0501031_0028809 | Ga0501031_0028809_331_1197 | 287 |
| 548 | 3300049568 | Ga0501031_0037335 | Ga0501031_0037335_1318_2184 | 287 |
| 549 | 3300049569 | Ga0501032_0012130 | Ga0501032_0012130_3910_4776 | 287 |
| 550 | 3300049569 | Ga0501032_0019570 | Ga0501032_0019570_1485_2351 | 287 |
| 551 | 3300049570 | Ga0501033_0127486 | Ga0501033_0127486_900_1766 | 287 |
| 552 | 3300049572 | Ga0501036_0015358 | Ga0501036_0015358_3656_4522 | 287 |
| 553 | 3300049573 | Ga0501037_0005036 | Ga0501037_0005036_8192_9058 | 287 |
| 554 | 3300049573 | Ga0501037_0028005 | Ga0501037_0028005_1692_2564 | 287 |
| 555 | 3300049573 | Ga0501037_0056965 | Ga0501037_0056965_1173_2039 | 287 |
| 556 | 3300049573 | Ga0501037_0092472 | Ga0501037_0092472_862_1728 | 287 |
| 557 | 3300049574 | Ga0501038_0002519 | Ga0501038_0002519_13679_14545 | 287 |
| 558 | 3300049574 | Ga0501038_0023120 | Ga0501038_0023120_2636_3502 | 287 |
| 559 | 3300049574 | Ga0501038_0029364 | Ga0501038_0029364_337_1209 | 287 |
| 560 | 3300049575 | Ga0501039_0001919 | Ga0501039_0001919_7916_8788 | 287 |
| 561 | 3300049575 | Ga0501039_0005939 | Ga0501039_0005939_6087_6953 | 287 |
| 562 | 3300049575 | Ga0501039_0021109 | Ga0501039_0021109_556_1422 | 287 |
| 563 | 3300049575 | Ga0501039_0032056 | Ga0501039_0032056_389_1255 | 287 |
| 564 | 3300049575 | Ga0501039_0039904 | Ga0501039_0039904_2742_3608 | 287 |
| 565 | 3300049576 | Ga0501040_0021975 | Ga0501040_0021975_1108_1980 | 287 |
| 566 | 3300049576 | Ga0501040_0315729 | Ga0501040_0315729_132_998 | 287 |
| 567 | 3300049577 | Ga0501041_0003539 | Ga0501041_0003539_3225_4097 | 287 |
| 568 | 3300049578 | Ga0501042_0001433 | Ga0501042_0001433_1994_2866 | 287 |
| 569 | 3300049578 | Ga0501042_0013466 | Ga0501042_0013466_218_1084 | 287 |
| 570 | 3300049578 | Ga0501042_0174000 | Ga0501042_0174000_186_1052 | 287 |
| 571 | 3300049580 | Ga0501046_0004340 | Ga0501046_0004340_7085_7957 | 287 |
| 572 | 3300049580 | Ga0501046_0011649 | Ga0501046_0011649_6547_7413 | 287 |
| 573 | 3300049580 | Ga0501046_0247533 | Ga0501046_0247533_118_984 | 287 |
| 574 | 3300049582 | Ga0501048_0003804 | Ga0501048_0003804_3602_4474 | 287 |
| 575 | 3300049582 | Ga0501048_0064663 | Ga0501048_0064663_751_1617 | 287 |
| 576 | 3300049582 | Ga0501048_0074444 | Ga0501048_0074444_920_1786 | 287 |
| 577 | 3300049584 | Ga0501068_0034500 | Ga0501068_0034500_1310_2176 | 287 |
| 578 | 3300049587 | Ga0501071_0027727 | Ga0501071_0027727_2352_3224 | 287 |
| 579 | 3300049588 | Ga0501072_0068011 | Ga0501072_0068011_1207_2079 | 287 |
| 580 | 3300049591 | Ga0501075_0008450 | Ga0501075_0008450_3117_3983 | 287 |
| 581 | 3300049591 | Ga0501075_0053736 | Ga0501075_0053736_2067_2933 | 287 |
| 582 | 3300049592 | Ga0501076_0013762 | Ga0501076_0013762_4487_5359 | 287 |
| 583 | 3300049593 | Ga0501077_0038008 | Ga0501077_0038008_479_1345 | 287 |
| 584 | 3300049593 | Ga0501077_0040188 | Ga0501077_0040188_2042_2908 | 287 |
| 585 | 3300049649 | Ga0501198_000924 | Ga0501198_000924_1332_2198 | 287 |
| 586 | 3300049650 | Ga0501199_000140 | Ga0501199_000140_3207_4073 | 287 |
| 587 | 3300049651 | Ga0501201_000548 | Ga0501201_000548_1541_2407 | 287 |
| 588 | 3300049652 | Ga0501202_002648 | Ga0501202_002648_1924_2790 | 287 |
| 589 | 3300049653 | Ga0501206_000044 | Ga0501206_000044_4672_5538 | 287 |
| 590 | 3300049655 | Ga0501208_000495 | Ga0501208_000495_2024_2890 | 287 |
| 591 | 3300049660 | Ga0501216_003634 | Ga0501216_003634_234_1100 | 287 |
| 592 | 3300049663 | Ga0501223_000510 | Ga0501223_000510_4137_5003 | 287 |
| 593 | 3300049666 | Ga0501228_000261 | Ga0501228_000261_1757_2623 | 287 |
| 594 | 3300049667 | Ga0501230_000608 | Ga0501230_000608_1097_1963 | 287 |
| 595 | 3300049669 | Ga0501235_000120 | Ga0501235_000120_3637_4503 | 287 |
| 596 | 3300049672 | Ga0501239_000073 | Ga0501239_000073_1191_2057 | 287 |
| 597 | 3300049675 | Ga0501243_000672 | Ga0501243_000672_2639_3505 | 287 |
| 598 | 3300049676 | Ga0501246_000145 | Ga0501246_000145_659_1525 | 287 |
| 599 | 3300049679 | Ga0501249_000424 | Ga0501249_000424_8165_9031 | 287 |
| 600 | 3300049683 | Ga0501253_000048 | Ga0501253_000048_1832_2698 | 287 |
| 601 | 3300049688 | Ga0501259_001393 | Ga0501259_001393_1474_2340 | 287 |
| 602 | 3300049689 | Ga0501260_000199 | Ga0501260_000199_773_1639 | 287 |
| 603 | 3300049705 | Ga0501225_0000414 | Ga0501225_0000414_4934_5800 | 287 |
| 604 | 3300049706 | Ga0501229_000122 | Ga0501229_000122_88_954 | 287 |
| 605 | 3300049742 | Ga0501080_0034665 | Ga0501080_0034665_1355_2221 | 287 |
| 606 | 3300049743 | Ga0501081_0046335 | Ga0501081_0046335_1777_2643 | 287 |
| 607 | 3300049743 | Ga0501081_0222191 | Ga0501081_0222191_155_1021 | 287 |
| 608 | 3300049761 | Ga0501264_001111 | Ga0501264_001111_2170_3036 | 287 |
| 609 | 3300049762 | Ga0501265_000946 | Ga0501265_000946_689_1555 | 287 |
| 610 | 3300049767 | Ga0501270_000296 | Ga0501270_000296_2032_2898 | 287 |
| 611 | 3300049771 | Ga0501274_000292 | Ga0501274_000292_1845_2711 | 287 |
| 612 | 3300049772 | Ga0501275_000725 | Ga0501275_000725_528_1394 | 287 |
| 613 | 3300049774 | Ga0501278_000609 | Ga0501278_000609_544_1410 | 287 |
| 614 | 3300049775 | Ga0501279_000476 | Ga0501279_000476_3048_3914 | 287 |
| 615 | 3300049776 | Ga0501280_003633 | Ga0501280_003633_551_1417 | 287 |
| 616 | 3300049779 | Ga0501283_000006 | Ga0501283_000006_17525_18391 | 287 |
| 617 | 3300049822 | Ga0501035_0008334 | Ga0501035_0008334_8323_9195 | 287 |
| 618 | 3300049822 | Ga0501035_0012688 | Ga0501035_0012688_556_1422 | 287 |
| 619 | 3300049822 | Ga0501035_0133891 | Ga0501035_0133891_826_1692 | 287 |
| 620 | 3300049824 | Ga0501045_0103171 | Ga0501045_0103171_944_1810 | 287 |
| 621 | 3300049851 | Ga0501212_005330 | Ga0501212_005330_677_1543 | 287 |
| 622 | 3300049853 | Ga0501226_002060 | Ga0501226_002060_635_1501 | 287 |
| 623 | 3300050508 | nmdc:mga09592_38682_c1 | nmdc:mga09592_38682_c1_963_1829 | 287 |
| 624 | 3300050509 | nmdc:mga0qj67_161965_c1 | nmdc:mga0qj67_161965_c1_324_1190 | 287 |
| 625 | 3300050509 | nmdc:mga0qj67_332798_c1 | nmdc:mga0qj67_332798_c1_80_946 | 287 |
| 626 | 3300050509 | nmdc:mga0qj67_33280_c1 | nmdc:mga0qj67_33280_c1_913_1779 | 287 |
| 627 | 3300050510 | nmdc:mga06r32_54184_c1 | nmdc:mga06r32_54184_c1_2176_3042 | 287 |
| 628 | 3300050511 | nmdc:mga08y16_196_c1 | nmdc:mga08y16_196_c1_25904_26770 | 287 |
| 629 | 3300050512 | nmdc:mga0n895_194417_c1 | nmdc:mga0n895_194417_c1_1013_1879 | 287 |
| 630 | 3300050513 | nmdc:mga0rr50_146437_c1 | nmdc:mga0rr50_146437_c1_113_979 | 287 |
| 631 | 3300053077 | Ga0495601_0081697 | Ga0495601_0081697_440_1306 | 287 |
| 632 | 3300053078 | Ga0495612_0053083 | Ga0495612_0053083_739_1605 | 287 |
| 633 | 3300054114 | Ga0501084_0084443 | Ga0501084_0084443_1201_2067 | 287 |
| 634 | 3300054114 | Ga0501084_0087948 | Ga0501084_0087948_1471_2379 | 287 |
| 635 | 3300059423 | Ga0590074_032420 | Ga0590074_032420_38_904 | 287 |
| 636 | 3300060353 | Ga0501082_0044269 | Ga0501082_0044269_2144_3010 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o5s-assembly1.cif.gz_A-2 | x-ray crystal structure of the rapz c-terminal domain from escherichia coli | 0.9555 | 164 | 285 |
| 5o5s-assembly1.cif.gz_A-2 | x-ray crystal structure of the rapz c-terminal domain from escherichia coli | 0.9406 | 164 | 285 |
| 7e9v-assembly1.cif.gz_A | the crystal structure of human ump-cmp kinase from biortus. | 0.7054 | 4 | 159 |
| 1tev-assembly1.cif.gz_A | crystal structure of the human ump/cmp kinase in open conformation | 0.6955 | 6 | 159 |
| 3cm0-assembly1.cif.gz_A | crystal structure of adenylate kinase from thermus thermophilus hb8 | 0.6617 | 4 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G039_182_303_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9818 | 171 | 283 | 3.40.50.720 |
| af_Q2G039_182_303_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9031 | 171 | 283 | 3.40.50.720 |
| 1tevA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6955 | 6 | 159 | 3.40.50.300 |
| af_O43012_3_162_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6943 | 7 | 154 | 3.40.50.300 |
| af_Q55C94_4_190_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6883 | 5 | 155 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661X7Z5-F1-model_v4 | RapZ C-terminal domain-containing protein | 0.9931 | 164 | 282 |
GO:0005524
|
| AF-A0A174LCA3-F1-model_v4 | GlmZ(SRNA)-inactivating NTPase | 0.9921 | 164 | 286 |
GO:0005524
|
| AF-A0A644XCL4-F1-model_v4 | Nucleotide-binding protein | 0.9912 | 166 | 285 |
GO:0005524
|
| AF-X0TVE7-F1-model_v4 | RapZ C-terminal domain-containing protein | 0.9897 | 161 | 286 |
GO:0005524
|
| AF-A0A3B0VBF3-F1-model_v4 | RNase adapter protein RapZ | 0.9891 | 164 | 286 |
GO:0005524
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar