F471269
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 284 | 621 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10074122|Ga0307513_100741223 |
| Length | 194 |
| Sequence | MIGGLFYLFLRAKRTLMVKHPWHEVSIGDNPPEHVNGIIEIPKGSRAKYEIDKDSGLIKLDRVLYASMYYPLNYGFIPQTLGEDHDPLDIVVLTQVTVVPRCLIPSKVIGVMRMIDRGEADDKIIAVAEQDVSVSHINDVDQLPEYFRMELKHFFENYKTLENKKVVVDEFESKAKAMEIIQQSIEFYKKTYPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 2 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 3 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 4 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 5 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 6 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 7 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 8 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 9 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 10 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 11 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 12 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 13 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 14 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 264 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 282 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 283 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 0.16 |
| Isolates | 2.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.2 |
| Nodule | 0 |
| Rhizoplane | 4.09 |
| Rhizosphere | 90.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1031188 | 3300002076 | Bacteria | 765 |
| 2 | JGI24751J29686_10000639 | 3300002459 | Bacteria | 8942 |
| 3 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 4 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 5 | JGI25153J46596_10000037 | 3300003215 | Bacteria | 182199 |
| 6 | rootL2_10147111 | 3300003322 | Bacteria | 14666 |
| 7 | rootH1_10286969 | 3300003323 | Bacteria | 2767 |
| 8 | Ga0055530_10000821 | 3300003791 | Bacteria | 25754 |
| 9 | Ga0065715_10101024 | 3300005293 | Bacteria | 3245 |
| 10 | Ga0065707_10096444 | 3300005295 | Bacteria | 3268 |
| 11 | Ga0065707_10317398 | 3300005295 | Bacteria | 973 |
| 12 | Ga0070658_10025188 | 3300005327 | Bacteria | 4768 |
| 13 | Ga0070658_10083116 | 3300005327 | Bacteria | 2632 |
| 14 | Ga0070676_10025162 | 3300005328 | Bacteria | 3362 |
| 15 | Ga0070683_100033131 | 3300005329 | Bacteria | 4709 |
| 16 | Ga0070683_100049423 | 3300005329 | Bacteria | 3890 |
| 17 | Ga0070683_100160096 | 3300005329 | Bacteria | 2136 |
| 18 | Ga0070683_100316229 | 3300005329 | Bacteria | 1486 |
| 19 | Ga0070683_100380014 | 3300005329 | Bacteria | 1346 |
| 20 | Ga0070690_100077086 | 3300005330 | Bacteria | 2175 |
| 21 | Ga0070690_100334252 | 3300005330 | Bacteria | 1095 |
| 22 | Ga0070670_100003099 | 3300005331 | Bacteria | 13755 |
| 23 | Ga0070670_100021244 | 3300005331 | Bacteria | 5585 |
| 24 | Ga0070670_100260357 | 3300005331 | Bacteria | 1512 |
| 25 | Ga0068869_100004390 | 3300005334 | Bacteria | 8760 |
| 26 | Ga0068869_100022398 | 3300005334 | Bacteria | 4354 |
| 27 | Ga0068869_100071961 | 3300005334 | Bacteria | 2561 |
| 28 | Ga0070682_100025959 | 3300005337 | Bacteria | 3500 |
| 29 | Ga0070682_101033622 | 3300005337 | Bacteria | 684 |
| 30 | Ga0068868_100006594 | 3300005338 | Bacteria | 8228 |
| 31 | Ga0068868_100016727 | 3300005338 | Bacteria | 5454 |
| 32 | Ga0068868_100069462 | 3300005338 | Bacteria | 2807 |
| 33 | Ga0068868_100612732 | 3300005338 | Bacteria | 966 |
| 34 | Ga0070660_100180944 | 3300005339 | Bacteria | 1706 |
| 35 | Ga0070689_100046712 | 3300005340 | Bacteria | 3337 |
| 36 | Ga0070689_100243635 | 3300005340 | Bacteria | 1481 |
| 37 | Ga0070687_100037647 | 3300005343 | Bacteria | 2419 |
| 38 | Ga0070661_100005344 | 3300005344 | Bacteria | 8860 |
| 39 | Ga0070661_100010101 | 3300005344 | Bacteria | 6557 |
| 40 | Ga0070661_100278810 | 3300005344 | Unclassified | 1296 |
| 41 | Ga0070668_100003459 | 3300005347 | Bacteria | 11658 |
| 42 | Ga0070669_100163854 | 3300005353 | Bacteria | 1729 |
| 43 | Ga0070675_100168493 | 3300005354 | Bacteria | 1888 |
| 44 | Ga0070675_100985457 | 3300005354 | Bacteria | 774 |
| 45 | Ga0070671_100021299 | 3300005355 | Bacteria | 5296 |
| 46 | Ga0070671_100042095 | 3300005355 | Bacteria | 3797 |
| 47 | Ga0070671_100190928 | 3300005355 | Bacteria | 1736 |
| 48 | Ga0070674_100011032 | 3300005356 | Bacteria | 5482 |
| 49 | Ga0070674_100072261 | 3300005356 | Bacteria | 2442 |
| 50 | Ga0070674_101012338 | 3300005356 | Bacteria | 729 |
| 51 | Ga0070673_100032379 | 3300005364 | Bacteria | 3936 |
| 52 | Ga0070673_100096308 | 3300005364 | Bacteria | 2428 |
| 53 | Ga0070673_100990811 | 3300005364 | Bacteria | 782 |
| 54 | Ga0070688_100020259 | 3300005365 | Bacteria | 3865 |
| 55 | Ga0070688_100229152 | 3300005365 | Bacteria | 1313 |
| 56 | Ga0070659_100001874 | 3300005366 | Bacteria | 15069 |
| 57 | Ga0070667_100118694 | 3300005367 | Bacteria | 2299 |
| 58 | Ga0070709_10007779 | 3300005434 | Bacteria | 5885 |
| 59 | Ga0070709_10128175 | 3300005434 | Bacteria | 1729 |
| 60 | Ga0070714_100020154 | 3300005435 | Bacteria | 5442 |
| 61 | Ga0070714_100047876 | 3300005435 | Bacteria | 3634 |
| 62 | Ga0070714_100061534 | 3300005435 | Bacteria | 3225 |
| 63 | Ga0070714_100137789 | 3300005435 | Bacteria | 2187 |
| 64 | Ga0070714_100190622 | 3300005435 | Bacteria | 1870 |
| 65 | Ga0070714_100705905 | 3300005435 | Bacteria | 973 |
| 66 | Ga0070713_100006935 | 3300005436 | Bacteria | 7908 |
| 67 | Ga0070713_100021071 | 3300005436 | Bacteria | 5006 |
| 68 | Ga0070713_100085430 | 3300005436 | Bacteria | 2703 |
| 69 | Ga0070713_100622596 | 3300005436 | Bacteria | 1026 |
| 70 | Ga0070713_100843497 | 3300005436 | Unclassified | 880 |
| 71 | Ga0070710_10016059 | 3300005437 | Unclassified | 3802 |
| 72 | Ga0070710_10028225 | 3300005437 | Bacteria | 3000 |
| 73 | Ga0070701_10421555 | 3300005438 | Bacteria | 850 |
| 74 | Ga0070711_100003906 | 3300005439 | Bacteria | 8750 |
| 75 | Ga0070711_100010563 | 3300005439 | Bacteria | 5717 |
| 76 | Ga0070711_100187225 | 3300005439 | Bacteria | 1588 |
| 77 | Ga0070711_100346771 | 3300005439 | Bacteria | 1193 |
| 78 | Ga0070711_100414670 | 3300005439 | Bacteria | 1096 |
| 79 | Ga0070708_100007922 | 3300005445 | Bacteria | 8508 |
| 80 | Ga0070663_100015826 | 3300005455 | Bacteria | 4880 |
| 81 | Ga0070678_100017852 | 3300005456 | Bacteria | 4581 |
| 82 | Ga0070681_10000672 | 3300005458 | Bacteria | 28308 |
| 83 | Ga0070681_10002267 | 3300005458 | Bacteria | 17569 |
| 84 | Ga0068867_100029969 | 3300005459 | Bacteria | 3923 |
| 85 | Ga0070685_10000700 | 3300005466 | Bacteria | 18186 |
| 86 | Ga0070685_10130440 | 3300005466 | Bacteria | 1571 |
| 87 | Ga0070706_100697755 | 3300005467 | Bacteria | 941 |
| 88 | Ga0070698_100700604 | 3300005471 | Bacteria | 955 |
| 89 | Ga0070679_100007996 | 3300005530 | Bacteria | 9929 |
| 90 | Ga0070679_101051070 | 3300005530 | Bacteria | 759 |
| 91 | Ga0070684_100050608 | 3300005535 | Bacteria | 3609 |
| 92 | Ga0070684_100433637 | 3300005535 | Bacteria | 1214 |
| 93 | Ga0068853_100003881 | 3300005539 | Bacteria | 11456 |
| 94 | Ga0068853_100041435 | 3300005539 | Bacteria | 3933 |
| 95 | Ga0068853_100100252 | 3300005539 | Bacteria | 2560 |
| 96 | Ga0068853_100163119 | 3300005539 | Unclassified | 2012 |
| 97 | Ga0068853_100242010 | 3300005539 | Bacteria | 1654 |
| 98 | Ga0068853_100351130 | 3300005539 | Bacteria | 1372 |
| 99 | Ga0068853_100464952 | 3300005539 | Bacteria | 1191 |
| 100 | Ga0070672_100012268 | 3300005543 | Bacteria | 6007 |
| 101 | Ga0070672_100076519 | 3300005543 | Bacteria | 2673 |
| 102 | Ga0070672_100115267 | 3300005543 | Bacteria | 2194 |
| 103 | Ga0070686_100003013 | 3300005544 | Bacteria | 9232 |
| 104 | Ga0070686_100191471 | 3300005544 | Bacteria | 1460 |
| 105 | Ga0070693_100030761 | 3300005547 | Unclassified | 2938 |
| 106 | Ga0070693_100037406 | 3300005547 | Unclassified | 2706 |
| 107 | Ga0070693_100043191 | 3300005547 | Unclassified | 2545 |
| 108 | Ga0070665_100189978 | 3300005548 | Bacteria | 2055 |
| 109 | Ga0070665_100203971 | 3300005548 | Bacteria | 1978 |
| 110 | Ga0068855_100003709 | 3300005563 | Bacteria | 18674 |
| 111 | Ga0068855_100008412 | 3300005563 | Bacteria | 12480 |
| 112 | Ga0068855_100045071 | 3300005563 | Bacteria | 5216 |
| 113 | Ga0068855_100142479 | 3300005563 | Bacteria | 2730 |
| 114 | Ga0068855_100878719 | 3300005563 | Bacteria | 948 |
| 115 | Ga0070664_100005991 | 3300005564 | Bacteria | 9829 |
| 116 | Ga0070664_100284808 | 3300005564 | Bacteria | 1491 |
| 117 | Ga0070664_100950410 | 3300005564 | Bacteria | 807 |
| 118 | Ga0068857_100000154 | 3300005577 | Bacteria | 42680 |
| 119 | Ga0068857_100003038 | 3300005577 | Bacteria | 13880 |
| 120 | Ga0068857_100009899 | 3300005577 | Bacteria | 8275 |
| 121 | Ga0068857_100021773 | 3300005577 | Bacteria | 5641 |
| 122 | Ga0068854_100029316 | 3300005578 | Unclassified | 3810 |
| 123 | Ga0068854_100390366 | 3300005578 | Bacteria | 1149 |
| 124 | Ga0068856_100000612 | 3300005614 | Bacteria | 39134 |
| 125 | Ga0068856_100009151 | 3300005614 | Bacteria | 9628 |
| 126 | Ga0068856_100035661 | 3300005614 | Bacteria | 4875 |
| 127 | Ga0068852_100032793 | 3300005616 | Bacteria | 4304 |
| 128 | Ga0068852_100699227 | 3300005616 | Bacteria | 1024 |
| 129 | Ga0068859_100004113 | 3300005617 | Bacteria | 14836 |
| 130 | Ga0068859_100132900 | 3300005617 | Bacteria | 2560 |
| 131 | Ga0068859_101037588 | 3300005617 | Bacteria | 901 |
| 132 | Ga0068864_100009624 | 3300005618 | Bacteria | 7972 |
| 133 | Ga0068864_100046472 | 3300005618 | Unclassified | 3725 |
| 134 | Ga0068864_100067466 | 3300005618 | Bacteria | 3106 |
| 135 | Ga0068864_100433679 | 3300005618 | Bacteria | 1254 |
| 136 | Ga0068866_10000452 | 3300005718 | Bacteria | 18811 |
| 137 | Ga0068861_100031294 | 3300005719 | Bacteria | 3908 |
| 138 | Ga0068861_100368463 | 3300005719 | Unclassified | 1265 |
| 139 | Ga0068851_10022057 | 3300005834 | Bacteria | 3098 |
| 140 | Ga0068870_10002694 | 3300005840 | Bacteria | 7443 |
| 141 | Ga0068863_100016101 | 3300005841 | Bacteria | 7172 |
| 142 | Ga0068863_100017029 | 3300005841 | Bacteria | 6970 |
| 143 | Ga0068863_100889674 | 3300005841 | Bacteria | 890 |
| 144 | Ga0068858_100000401 | 3300005842 | Bacteria | 45107 |
| 145 | Ga0068858_100000491 | 3300005842 | Bacteria | 41299 |
| 146 | Ga0068858_100018183 | 3300005842 | Bacteria | 6583 |
| 147 | Ga0068858_100110342 | 3300005842 | Bacteria | 2569 |
| 148 | Ga0068858_100706494 | 3300005842 | Bacteria | 981 |
| 149 | Ga0068858_100878343 | 3300005842 | Unclassified | 876 |
| 150 | Ga0068860_100017308 | 3300005843 | Bacteria | 7023 |
| 151 | Ga0068860_100027170 | 3300005843 | Bacteria | 5514 |
| 152 | Ga0068860_100119468 | 3300005843 | Bacteria | 2523 |
| 153 | Ga0068860_100192819 | 3300005843 | Bacteria | 1972 |
| 154 | Ga0068860_100517227 | 3300005843 | Bacteria | 1193 |
| 155 | Ga0068862_100099717 | 3300005844 | Bacteria | 2539 |
| 156 | Ga0081540_1118985 | 3300005983 | Bacteria | 1100 |
| 157 | Ga0070717_10008365 | 3300006028 | Bacteria | 7727 |
| 158 | Ga0070717_10015758 | 3300006028 | Bacteria | 5843 |
| 159 | Ga0070717_10020100 | 3300006028 | Bacteria | 5248 |
| 160 | Ga0070717_10143272 | 3300006028 | Bacteria | 2063 |
| 161 | Ga0070717_10472680 | 3300006028 | Unclassified | 1131 |
| 162 | Ga0070717_10620951 | 3300006028 | Unclassified | 981 |
| 163 | Ga0070715_10003382 | 3300006163 | Bacteria | 5059 |
| 164 | Ga0070716_100000138 | 3300006173 | Bacteria | 29465 |
| 165 | Ga0070716_100005555 | 3300006173 | Bacteria | 6119 |
| 166 | Ga0070716_100022019 | 3300006173 | Bacteria | 3365 |
| 167 | Ga0070716_100028494 | 3300006173 | Bacteria | 3009 |
| 168 | Ga0070716_100174340 | 3300006173 | Bacteria | 1406 |
| 169 | Ga0070716_100450975 | 3300006173 | Bacteria | 938 |
| 170 | Ga0070712_100000854 | 3300006175 | Bacteria | 18137 |
| 171 | Ga0070712_100001206 | 3300006175 | Bacteria | 15640 |
| 172 | Ga0070712_100015362 | 3300006175 | Bacteria | 4929 |
| 173 | Ga0070712_100165104 | 3300006175 | Bacteria | 1713 |
| 174 | Ga0097621_100000805 | 3300006237 | Bacteria | 22117 |
| 175 | Ga0097621_100001391 | 3300006237 | Bacteria | 16653 |
| 176 | Ga0097621_100085707 | 3300006237 | Bacteria | 2628 |
| 177 | Ga0097621_100090806 | 3300006237 | Unclassified | 2556 |
| 178 | Ga0097621_100137229 | 3300006237 | Bacteria | 2087 |
| 179 | Ga0068871_100000803 | 3300006358 | Bacteria | 21113 |
| 180 | Ga0068871_100028421 | 3300006358 | Bacteria | 4383 |
| 181 | Ga0068871_100175524 | 3300006358 | Unclassified | 1839 |
| 182 | Ga0068871_100766549 | 3300006358 | Bacteria | 888 |
| 183 | Ga0075428_100735584 | 3300006844 | Unclassified | 1050 |
| 184 | Ga0075431_101254123 | 3300006847 | Bacteria | 703 |
| 185 | Ga0075433_10605088 | 3300006852 | Unclassified | 962 |
| 186 | Ga0075434_100144274 | 3300006871 | Unclassified | 2401 |
| 187 | Ga0075429_101000398 | 3300006880 | Bacteria | 731 |
| 188 | Ga0068865_100004959 | 3300006881 | Bacteria | 8050 |
| 189 | Ga0068865_100009927 | 3300006881 | Bacteria | 5916 |
| 190 | Ga0068865_100022980 | 3300006881 | Bacteria | 4076 |
| 191 | Ga0068865_100036240 | 3300006881 | Bacteria | 3324 |
| 192 | Ga0075436_100121279 | 3300006914 | Bacteria | 1829 |
| 193 | Ga0097620_100004113 | 3300006931 | Bacteria | 14836 |
| 194 | Ga0097620_100132911 | 3300006931 | Bacteria | 2560 |
| 195 | Ga0097620_101037637 | 3300006931 | Bacteria | 901 |
| 196 | Ga0075435_100019604 | 3300007076 | Bacteria | 5170 |
| 197 | Ga0075435_100557700 | 3300007076 | Unclassified | 992 |
| 198 | Ga0105244_10036466 | 3300009036 | Bacteria | 2576 |
| 199 | Ga0105240_10057938 | 3300009093 | Bacteria | 4837 |
| 200 | Ga0105240_10082755 | 3300009093 | Unclassified | 3941 |
| 201 | Ga0105240_10335856 | 3300009093 | Unclassified | 1718 |
| 202 | Ga0111539_10021661 | 3300009094 | Bacteria | 7906 |
| 203 | Ga0111539_10069045 | 3300009094 | Bacteria | 4172 |
| 204 | Ga0111539_10754351 | 3300009094 | Bacteria | 1133 |
| 205 | Ga0111539_11159947 | 3300009094 | Unclassified | 898 |
| 206 | Ga0111539_11418152 | 3300009094 | Bacteria | 806 |
| 207 | Ga0105245_10001141 | 3300009098 | Bacteria | 24022 |
| 208 | Ga0105245_10005753 | 3300009098 | Bacteria | 10881 |
| 209 | Ga0105245_10019131 | 3300009098 | Bacteria | 5996 |
| 210 | Ga0105245_10721425 | 3300009098 | Bacteria | 1031 |
| 211 | Ga0105247_10072287 | 3300009101 | Bacteria | 2159 |
| 212 | Ga0114129_10834176 | 3300009147 | Bacteria | 1173 |
| 213 | Ga0114129_11660514 | 3300009147 | Bacteria | 781 |
| 214 | Ga0105243_12042307 | 3300009148 | Bacteria | 608 |
| 215 | Ga0105241_10022255 | 3300009174 | Bacteria | 4693 |
| 216 | Ga0105241_10045281 | 3300009174 | Bacteria | 3337 |
| 217 | Ga0105241_10052655 | 3300009174 | Unclassified | 3109 |
| 218 | Ga0105241_10657653 | 3300009174 | Bacteria | 952 |
| 219 | Ga0105241_11199696 | 3300009174 | Bacteria | 719 |
| 220 | Ga0105242_10007671 | 3300009176 | Bacteria | 8304 |
| 221 | Ga0105242_10609766 | 3300009176 | Bacteria | 1055 |
| 222 | Ga0105242_11395753 | 3300009176 | Bacteria | 728 |
| 223 | Ga0105248_10001672 | 3300009177 | Bacteria | 24677 |
| 224 | Ga0105248_10067166 | 3300009177 | Bacteria | 4025 |
| 225 | Ga0105248_10070960 | 3300009177 | Bacteria | 3911 |
| 226 | Ga0105237_10023243 | 3300009545 | Bacteria | 6354 |
| 227 | Ga0105237_10045613 | 3300009545 | Bacteria | 4410 |
| 228 | Ga0105237_10070395 | 3300009545 | Unclassified | 3494 |
| 229 | Ga0105237_10105265 | 3300009545 | Bacteria | 2812 |
| 230 | Ga0105237_10706801 | 3300009545 | Bacteria | 1014 |
| 231 | Ga0105238_10000339 | 3300009551 | Bacteria | 51013 |
| 232 | Ga0105238_10099777 | 3300009551 | Unclassified | 2886 |
| 233 | Ga0105238_10140076 | 3300009551 | Bacteria | 2396 |
| 234 | Ga0105238_10265341 | 3300009551 | Bacteria | 1697 |
| 235 | Ga0105249_10011435 | 3300009553 | Bacteria | 7796 |
| 236 | Ga0105249_10155975 | 3300009553 | Bacteria | 2202 |
| 237 | Ga0105249_11088121 | 3300009553 | Bacteria | 869 |
| 238 | Ga0105239_10024001 | 3300010375 | Bacteria | 6716 |
| 239 | Ga0105239_10038911 | 3300010375 | Bacteria | 5210 |
| 240 | Ga0105239_10039578 | 3300010375 | Bacteria | 5165 |
| 241 | Ga0105239_10078560 | 3300010375 | Bacteria | 3632 |
| 242 | Ga0105239_10146124 | 3300010375 | Unclassified | 2637 |
| 243 | Ga0105239_10364274 | 3300010375 | Bacteria | 1633 |
| 244 | Ga0105239_10372081 | 3300010375 | Bacteria | 1615 |
| 245 | Ga0105246_10281543 | 3300011119 | Bacteria | 1334 |
| 246 | Ga0157373_10002653 | 3300013100 | Bacteria | 13569 |
| 247 | Ga0157373_10082741 | 3300013100 | Unclassified | 2262 |
| 248 | Ga0157373_10173368 | 3300013100 | Bacteria | 1518 |
| 249 | Ga0157371_10000027 | 3300013102 | Bacteria | 269243 |
| 250 | Ga0157371_10178806 | 3300013102 | Bacteria | 1517 |
| 251 | Ga0157370_10034394 | 3300013104 | Bacteria | 4936 |
| 252 | Ga0157370_10189244 | 3300013104 | Bacteria | 1910 |
| 253 | Ga0157370_10497644 | 3300013104 | Bacteria | 1119 |
| 254 | Ga0157370_10665610 | 3300013104 | Unclassified | 951 |
| 255 | Ga0157369_10000053 | 3300013105 | Bacteria | 162962 |
| 256 | Ga0157369_10001152 | 3300013105 | Bacteria | 33000 |
| 257 | Ga0157369_10057271 | 3300013105 | Bacteria | 4205 |
| 258 | Ga0157369_10116778 | 3300013105 | Bacteria | 2833 |
| 259 | Ga0157369_10146773 | 3300013105 | Bacteria | 2494 |
| 260 | Ga0157369_10229084 | 3300013105 | Bacteria | 1943 |
| 261 | Ga0157369_10875885 | 3300013105 | Bacteria | 921 |
| 262 | Ga0157374_10000384 | 3300013296 | Bacteria | 40618 |
| 263 | Ga0157374_10001410 | 3300013296 | Bacteria | 20395 |
| 264 | Ga0157374_10018130 | 3300013296 | Bacteria | 6209 |
| 265 | Ga0157374_10092195 | 3300013296 | Bacteria | 2890 |
| 266 | Ga0157378_10000121 | 3300013297 | Bacteria | 75263 |
| 267 | Ga0157378_10000188 | 3300013297 | Bacteria | 59526 |
| 268 | Ga0157378_10001045 | 3300013297 | Bacteria | 25293 |
| 269 | Ga0157378_10043993 | 3300013297 | Bacteria | 3964 |
| 270 | Ga0157378_10071976 | 3300013297 | Bacteria | 3105 |
| 271 | Ga0163162_10000078 | 3300013306 | Bacteria | 89842 |
| 272 | Ga0163162_10221418 | 3300013306 | Bacteria | 2022 |
| 273 | Ga0163162_10494549 | 3300013306 | Bacteria | 1354 |
| 274 | Ga0157372_10002460 | 3300013307 | Bacteria | 20067 |
| 275 | Ga0157372_10002767 | 3300013307 | Bacteria | 18959 |
| 276 | Ga0157372_10008312 | 3300013307 | Bacteria | 11035 |
| 277 | Ga0157372_10013774 | 3300013307 | Bacteria | 8641 |
| 278 | Ga0157372_10017992 | 3300013307 | Bacteria | 7594 |
| 279 | Ga0157372_10033586 | 3300013307 | Bacteria | 5637 |
| 280 | Ga0157372_10056006 | 3300013307 | Bacteria | 4405 |
| 281 | Ga0157372_10069578 | 3300013307 | Bacteria | 3958 |
| 282 | Ga0157372_10116403 | 3300013307 | Bacteria | 3065 |
| 283 | Ga0157372_10154085 | 3300013307 | Unclassified | 2654 |
| 284 | Ga0157372_11127001 | 3300013307 | Bacteria | 907 |
| 285 | Ga0157375_10005888 | 3300013308 | Bacteria | 10680 |
| 286 | Ga0157375_10108020 | 3300013308 | Bacteria | 2877 |
| 287 | Ga0157375_10370205 | 3300013308 | Bacteria | 1599 |
| 288 | Ga0157375_10713036 | 3300013308 | Bacteria | 1156 |
| 289 | Ga0157375_11997537 | 3300013308 | Unclassified | 689 |
| 290 | Ga0163163_10000593 | 3300014325 | Bacteria | 31910 |
| 291 | Ga0163163_11130300 | 3300014325 | Bacteria | 846 |
| 292 | Ga0163163_12194915 | 3300014325 | Bacteria | 611 |
| 293 | Ga0157380_10001491 | 3300014326 | Bacteria | 15326 |
| 294 | Ga0157380_10813713 | 3300014326 | Bacteria | 952 |
| 295 | Ga0157380_11485090 | 3300014326 | Bacteria | 730 |
| 296 | Ga0182008_10000334 | 3300014497 | Bacteria | 37000 |
| 297 | Ga0157377_10004015 | 3300014745 | Bacteria | 6711 |
| 298 | Ga0157377_10262146 | 3300014745 | Bacteria | 1125 |
| 299 | Ga0157379_10017143 | 3300014968 | Bacteria | 6378 |
| 300 | Ga0157379_10023370 | 3300014968 | Bacteria | 5485 |
| 301 | Ga0157379_10629160 | 3300014968 | Bacteria | 1003 |
| 302 | Ga0157379_11467758 | 3300014968 | Bacteria | 663 |
| 303 | Ga0157376_10005719 | 3300014969 | Bacteria | 8707 |
| 304 | Ga0157376_10137091 | 3300014969 | Bacteria | 2191 |
| 305 | Ga0157376_10153764 | 3300014969 | Bacteria | 2077 |
| 306 | Ga0157376_10222717 | 3300014969 | Bacteria | 1748 |
| 307 | Ga0157376_10335836 | 3300014969 | Unclassified | 1441 |
| 308 | Ga0157376_10817788 | 3300014969 | Unclassified | 945 |
| 309 | Ga0182006_1000755 | 3300015261 | Bacteria | 22108 |
| 310 | Ga0182006_1000787 | 3300015261 | Bacteria | 21397 |
| 311 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 312 | Ga0183373_1007 | 3300015682 | Bacteria | 282776 |
| 313 | Ga0163161_10010869 | 3300017792 | Bacteria | 6310 |
| 314 | Ga0163161_10043332 | 3300017792 | Bacteria | 3240 |
| 315 | Ga0213872_10148104 | 3300021361 | Bacteria | 1027 |
| 316 | Ga0213875_10041285 | 3300021388 | Bacteria | 2171 |
| 317 | Ga0213871_10021025 | 3300021441 | Bacteria | 1623 |
| 318 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 319 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 320 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 321 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 322 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 323 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 324 | Ga0209050_1002956 | 3300025298 | Bacteria | 13286 |
| 325 | Ga0207697_10003082 | 3300025315 | Bacteria | 8350 |
| 326 | Ga0207656_10051872 | 3300025321 | Unclassified | 1775 |
| 327 | Ga0207692_10015594 | 3300025898 | Bacteria | 3346 |
| 328 | Ga0207692_10045754 | 3300025898 | Unclassified | 2191 |
| 329 | Ga0207642_10001789 | 3300025899 | Bacteria | 6651 |
| 330 | Ga0207688_10003396 | 3300025901 | Bacteria | 8680 |
| 331 | Ga0207688_10122497 | 3300025901 | Bacteria | 1518 |
| 332 | Ga0207647_10002192 | 3300025904 | Bacteria | 14895 |
| 333 | Ga0207647_10006891 | 3300025904 | Bacteria | 8235 |
| 334 | Ga0207647_10020875 | 3300025904 | Bacteria | 4384 |
| 335 | Ga0207685_10020401 | 3300025905 | Bacteria | 2202 |
| 336 | Ga0207685_10119552 | 3300025905 | Bacteria | 1154 |
| 337 | Ga0207699_10004717 | 3300025906 | Bacteria | 6513 |
| 338 | Ga0207699_10012372 | 3300025906 | Bacteria | 4341 |
| 339 | Ga0207699_10017551 | 3300025906 | Bacteria | 3771 |
| 340 | Ga0207699_10026207 | 3300025906 | Bacteria | 3210 |
| 341 | Ga0207645_10000054 | 3300025907 | Bacteria | 83043 |
| 342 | Ga0207643_10000357 | 3300025908 | Bacteria | 30643 |
| 343 | Ga0207705_10047799 | 3300025909 | Bacteria | 3077 |
| 344 | Ga0207705_10309307 | 3300025909 | Bacteria | 1213 |
| 345 | Ga0207654_10032858 | 3300025911 | Unclassified | 2871 |
| 346 | Ga0207654_10347732 | 3300025911 | Bacteria | 1020 |
| 347 | Ga0207707_10002233 | 3300025912 | Bacteria | 17498 |
| 348 | Ga0207707_10066332 | 3300025912 | Bacteria | 3143 |
| 349 | Ga0207695_10014898 | 3300025913 | Bacteria | 9177 |
| 350 | Ga0207695_10048448 | 3300025913 | Bacteria | 4487 |
| 351 | Ga0207695_10836382 | 3300025913 | Unclassified | 800 |
| 352 | Ga0207671_10106109 | 3300025914 | Bacteria | 2132 |
| 353 | Ga0207693_10000453 | 3300025915 | Bacteria | 37587 |
| 354 | Ga0207693_10001705 | 3300025915 | Bacteria | 19338 |
| 355 | Ga0207693_10034013 | 3300025915 | Bacteria | 4021 |
| 356 | Ga0207693_10041884 | 3300025915 | Unclassified | 3604 |
| 357 | Ga0207693_10166787 | 3300025915 | Bacteria | 1734 |
| 358 | Ga0207693_10565731 | 3300025915 | Bacteria | 886 |
| 359 | Ga0207663_10015278 | 3300025916 | Bacteria | 4232 |
| 360 | Ga0207663_10040025 | 3300025916 | Bacteria | 2845 |
| 361 | Ga0207663_10053294 | 3300025916 | Unclassified | 2527 |
| 362 | Ga0207663_10153221 | 3300025916 | Bacteria | 1619 |
| 363 | Ga0207663_10157607 | 3300025916 | Bacteria | 1599 |
| 364 | Ga0207663_10323603 | 3300025916 | Bacteria | 1159 |
| 365 | Ga0207662_10000665 | 3300025918 | Bacteria | 15604 |
| 366 | Ga0207662_10152322 | 3300025918 | Unclassified | 1471 |
| 367 | Ga0207657_10000255 | 3300025919 | Bacteria | 56523 |
| 368 | Ga0207657_11171496 | 3300025919 | Bacteria | 585 |
| 369 | Ga0207649_10000195 | 3300025920 | Bacteria | 50018 |
| 370 | Ga0207649_10007569 | 3300025920 | Bacteria | 5905 |
| 371 | Ga0207649_10539946 | 3300025920 | Unclassified | 891 |
| 372 | Ga0207681_10381368 | 3300025923 | Bacteria | 1135 |
| 373 | Ga0207694_10001944 | 3300025924 | Bacteria | 17106 |
| 374 | Ga0207694_10156415 | 3300025924 | Bacteria | 1839 |
| 375 | Ga0207694_10181728 | 3300025924 | Bacteria | 1706 |
| 376 | Ga0207694_10388955 | 3300025924 | Bacteria | 1158 |
| 377 | Ga0207650_10000042 | 3300025925 | Bacteria | 191592 |
| 378 | Ga0207650_10006009 | 3300025925 | Bacteria | 8283 |
| 379 | Ga0207659_10058271 | 3300025926 | Bacteria | 2772 |
| 380 | Ga0207687_10013423 | 3300025927 | Bacteria | 5347 |
| 381 | Ga0207687_10014207 | 3300025927 | Bacteria | 5209 |
| 382 | Ga0207687_10018575 | 3300025927 | Bacteria | 4593 |
| 383 | Ga0207687_10636465 | 3300025927 | Bacteria | 901 |
| 384 | Ga0207700_10004433 | 3300025928 | Bacteria | 8279 |
| 385 | Ga0207700_10004738 | 3300025928 | Bacteria | 8068 |
| 386 | Ga0207700_10029295 | 3300025928 | Bacteria | 3883 |
| 387 | Ga0207700_10158677 | 3300025928 | Bacteria | 1876 |
| 388 | Ga0207700_10234562 | 3300025928 | Bacteria | 1561 |
| 389 | Ga0207664_10002243 | 3300025929 | Bacteria | 12723 |
| 390 | Ga0207664_10028417 | 3300025929 | Bacteria | 4249 |
| 391 | Ga0207664_10034311 | 3300025929 | Bacteria | 3907 |
| 392 | Ga0207664_10065041 | 3300025929 | Bacteria | 2919 |
| 393 | Ga0207664_10078188 | 3300025929 | Bacteria | 2683 |
| 394 | Ga0207664_10287670 | 3300025929 | Bacteria | 1444 |
| 395 | Ga0207664_10341865 | 3300025929 | Bacteria | 1323 |
| 396 | Ga0207664_10477231 | 3300025929 | Bacteria | 1115 |
| 397 | Ga0207644_10010266 | 3300025931 | Bacteria | 6170 |
| 398 | Ga0207644_10091267 | 3300025931 | Bacteria | 2271 |
| 399 | Ga0207644_10416940 | 3300025931 | Bacteria | 1099 |
| 400 | Ga0207690_10229710 | 3300025932 | Bacteria | 1424 |
| 401 | Ga0207690_10512009 | 3300025932 | Bacteria | 972 |
| 402 | Ga0207706_10000945 | 3300025933 | Bacteria | 29679 |
| 403 | Ga0207686_10167722 | 3300025934 | Bacteria | 1545 |
| 404 | Ga0207686_10905940 | 3300025934 | Bacteria | 712 |
| 405 | Ga0207670_10024052 | 3300025936 | Bacteria | 3802 |
| 406 | Ga0207669_10010463 | 3300025937 | Bacteria | 4468 |
| 407 | Ga0207669_10150494 | 3300025937 | Bacteria | 1629 |
| 408 | Ga0207704_10002101 | 3300025938 | Bacteria | 8926 |
| 409 | Ga0207704_10009335 | 3300025938 | Bacteria | 4728 |
| 410 | Ga0207704_10029250 | 3300025938 | Unclassified | 3069 |
| 411 | Ga0207704_10279901 | 3300025938 | Bacteria | 1267 |
| 412 | Ga0207665_10000187 | 3300025939 | Bacteria | 41612 |
| 413 | Ga0207665_10009538 | 3300025939 | Bacteria | 6375 |
| 414 | Ga0207665_10017633 | 3300025939 | Bacteria | 4691 |
| 415 | Ga0207691_10000051 | 3300025940 | Bacteria | 94390 |
| 416 | Ga0207691_10006756 | 3300025940 | Bacteria | 11064 |
| 417 | Ga0207691_10242578 | 3300025940 | Bacteria | 1558 |
| 418 | Ga0207711_10002420 | 3300025941 | Bacteria | 16664 |
| 419 | Ga0207711_10017040 | 3300025941 | Bacteria | 6035 |
| 420 | Ga0207711_10029474 | 3300025941 | Bacteria | 4630 |
| 421 | Ga0207711_10049454 | 3300025941 | Bacteria | 3600 |
| 422 | Ga0207689_10000325 | 3300025942 | Bacteria | 44284 |
| 423 | Ga0207689_10006870 | 3300025942 | Bacteria | 10005 |
| 424 | Ga0207689_10041762 | 3300025942 | Bacteria | 3794 |
| 425 | Ga0207661_10000084 | 3300025944 | Bacteria | 65203 |
| 426 | Ga0207661_10100241 | 3300025944 | Bacteria | 2431 |
| 427 | Ga0207661_10117955 | 3300025944 | Bacteria | 2255 |
| 428 | Ga0207661_10354381 | 3300025944 | Bacteria | 1324 |
| 429 | Ga0207661_10400231 | 3300025944 | Bacteria | 1245 |
| 430 | Ga0207679_10000050 | 3300025945 | Bacteria | 112411 |
| 431 | Ga0207679_10002335 | 3300025945 | Bacteria | 11667 |
| 432 | Ga0207679_10271822 | 3300025945 | Bacteria | 1450 |
| 433 | Ga0207667_10001412 | 3300025949 | Bacteria | 30075 |
| 434 | Ga0207667_10038382 | 3300025949 | Bacteria | 5116 |
| 435 | Ga0207667_10041026 | 3300025949 | Bacteria | 4924 |
| 436 | Ga0207667_10224671 | 3300025949 | Bacteria | 1924 |
| 437 | Ga0207667_10761572 | 3300025949 | Bacteria | 967 |
| 438 | Ga0207651_10007772 | 3300025960 | Bacteria | 5732 |
| 439 | Ga0207651_10059734 | 3300025960 | Bacteria | 2643 |
| 440 | Ga0207651_10353375 | 3300025960 | Unclassified | 1238 |
| 441 | Ga0207712_10095560 | 3300025961 | Bacteria | 2198 |
| 442 | Ga0207668_10021597 | 3300025972 | Bacteria | 4107 |
| 443 | Ga0207640_10206139 | 3300025981 | Bacteria | 1494 |
| 444 | Ga0207640_10597674 | 3300025981 | Bacteria | 933 |
| 445 | Ga0207658_10012280 | 3300025986 | Bacteria | 5846 |
| 446 | Ga0207677_10001997 | 3300026023 | Bacteria | 10778 |
| 447 | Ga0207677_10051364 | 3300026023 | Bacteria | 2795 |
| 448 | Ga0207677_10161889 | 3300026023 | Bacteria | 1739 |
| 449 | Ga0207677_10268022 | 3300026023 | Bacteria | 1395 |
| 450 | Ga0207677_10270779 | 3300026023 | Bacteria | 1389 |
| 451 | Ga0207703_10005593 | 3300026035 | Bacteria | 10089 |
| 452 | Ga0207703_10032290 | 3300026035 | Bacteria | 4143 |
| 453 | Ga0207703_10052693 | 3300026035 | Bacteria | 3305 |
| 454 | Ga0207703_10102661 | 3300026035 | Bacteria | 2426 |
| 455 | Ga0207703_10670737 | 3300026035 | Bacteria | 985 |
| 456 | Ga0207703_11661683 | 3300026035 | Bacteria | 614 |
| 457 | Ga0207639_10477597 | 3300026041 | Bacteria | 1136 |
| 458 | Ga0207639_10746188 | 3300026041 | Bacteria | 910 |
| 459 | Ga0207678_10000023 | 3300026067 | Bacteria | 126241 |
| 460 | Ga0207702_10000714 | 3300026078 | Bacteria | 35703 |
| 461 | Ga0207702_10001156 | 3300026078 | Bacteria | 26911 |
| 462 | Ga0207702_10003644 | 3300026078 | Bacteria | 13957 |
| 463 | Ga0207702_10858700 | 3300026078 | Bacteria | 898 |
| 464 | Ga0207702_11143193 | 3300026078 | Bacteria | 773 |
| 465 | Ga0207641_10000059 | 3300026088 | Bacteria | 164728 |
| 466 | Ga0207641_10009583 | 3300026088 | Bacteria | 7980 |
| 467 | Ga0207641_10044221 | 3300026088 | Bacteria | 3745 |
| 468 | Ga0207641_10053949 | 3300026088 | Bacteria | 3409 |
| 469 | Ga0207648_10000041 | 3300026089 | Bacteria | 115866 |
| 470 | Ga0207648_10033463 | 3300026089 | Bacteria | 4533 |
| 471 | Ga0207648_10462947 | 3300026089 | Bacteria | 1156 |
| 472 | Ga0207648_10681091 | 3300026089 | Bacteria | 952 |
| 473 | Ga0207676_10000080 | 3300026095 | Bacteria | 94513 |
| 474 | Ga0207676_10008126 | 3300026095 | Bacteria | 7459 |
| 475 | Ga0207676_10027950 | 3300026095 | Unclassified | 4208 |
| 476 | Ga0207676_10558741 | 3300026095 | Bacteria | 1094 |
| 477 | Ga0207674_10000047 | 3300026116 | Bacteria | 120929 |
| 478 | Ga0207674_10001103 | 3300026116 | Bacteria | 35082 |
| 479 | Ga0207674_10001717 | 3300026116 | Bacteria | 28034 |
| 480 | Ga0207674_10017454 | 3300026116 | Bacteria | 7832 |
| 481 | Ga0207675_100007292 | 3300026118 | Bacteria | 10452 |
| 482 | Ga0207675_100291470 | 3300026118 | Unclassified | 1587 |
| 483 | Ga0207683_10000017 | 3300026121 | Bacteria | 123119 |
| 484 | Ga0207683_10056544 | 3300026121 | Bacteria | 3442 |
| 485 | Ga0207683_10061644 | 3300026121 | Bacteria | 3302 |
| 486 | Ga0207683_10223919 | 3300026121 | Bacteria | 1714 |
| 487 | Ga0207698_10176934 | 3300026142 | Bacteria | 1885 |
| 488 | Ga0207698_10676997 | 3300026142 | Bacteria | 1024 |
| 489 | Ga0207428_10260282 | 3300027907 | Bacteria | 1292 |
| 490 | Ga0207428_10359752 | 3300027907 | Unclassified | 1070 |
| 491 | Ga0268266_10002321 | 3300028379 | Bacteria | 20620 |
| 492 | Ga0268266_10273725 | 3300028379 | Bacteria | 1568 |
| 493 | Ga0268265_10008423 | 3300028380 | Bacteria | 6962 |
| 494 | Ga0268265_10525337 | 3300028380 | Bacteria | 1119 |
| 495 | Ga0268265_11054161 | 3300028380 | Bacteria | 805 |
| 496 | Ga0268264_10010763 | 3300028381 | Bacteria | 7557 |
| 497 | Ga0268264_10018155 | 3300028381 | Bacteria | 5753 |
| 498 | Ga0268264_10039245 | 3300028381 | Bacteria | 3912 |
| 499 | Ga0268264_10358872 | 3300028381 | Bacteria | 1389 |
| 500 | Ga0265338_10204237 | 3300028800 | Bacteria | 1488 |
| 501 | Ga0307513_10074122 | 3300031456 | Bacteria | 3541 |
| 502 | Ga0265313_10068357 | 3300031595 | Unclassified | 1642 |
| 503 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 504 | Ga0307413_10157596 | 3300031824 | Bacteria | 1591 |
| 505 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 506 | Ga0307412_10185167 | 3300031911 | Bacteria | 1570 |
| 507 | Ga0307409_100034309 | 3300031995 | Bacteria | 3704 |
| 508 | Ga0307409_100086880 | 3300031995 | Bacteria | 2547 |
| 509 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 510 | Ga0307416_101996178 | 3300032002 | Bacteria | 683 |
| 511 | Ga0307414_10188021 | 3300032004 | Bacteria | 1668 |
| 512 | Ga0307414_10215768 | 3300032004 | Bacteria | 1572 |
| 513 | Ga0307411_10037272 | 3300032005 | Bacteria | 3056 |
| 514 | Ga0373926_0075975 | 3300035083 | Bacteria | 1238 |
| 515 | Ga0373926_0221778 | 3300035083 | Bacteria | 730 |
| 516 | Ga0373936_0089531 | 3300035113 | Unclassified | 1289 |
| 517 | Ga0373946_0268737 | 3300035171 | Bacteria | 836 |
| 518 | Ga0373935_0345880 | 3300035692 | Bacteria | 1059 |
| 519 | Ga0373935_0476212 | 3300035692 | Bacteria | 904 |
| 520 | Ga0373935_0493896 | 3300035692 | Bacteria | 888 |
| 521 | Ga0373947_0008139 | 3300035725 | Bacteria | 6045 |
| 522 | Ga0373947_0149734 | 3300035725 | Bacteria | 1502 |
| 523 | Ga0373937_0027871 | 3300036401 | Bacteria | 5110 |
| 524 | Ga0373925_0009291 | 3300037068 | Bacteria | 7156 |
| 525 | Ga0373925_0036133 | 3300037068 | Bacteria | 3647 |
| 526 | Ga0373925_0458443 | 3300037068 | Unclassified | 1044 |
| 527 | Ga0395898_0217237 | 3300037466 | Bacteria | 1824 |
| 528 | Ga0436364_0687620 | 3300037853 | Bacteria | 770 |
| 529 | Ga0436364_0751971 | 3300037853 | Bacteria | 718 |
| 530 | Ga0436364_0752377 | 3300037853 | Bacteria | 5743 |
| 531 | Ga0395901_0404620 | 3300038443 | Unclassified | 1402 |
| 532 | Ga0395901_0516985 | 3300038443 | Bacteria | 1213 |
| 533 | Ga0436365_1400891 | 3300039437 | Bacteria | 845 |
| 534 | Ga0436361_0705453 | 3300039447 | Bacteria | 895 |
| 535 | Ga0436361_0720369 | 3300039447 | Bacteria | 4244 |
| 536 | Ga0436363_0215964 | 3300039450 | Bacteria | 801 |
| 537 | Ga0436363_1146649 | 3300039450 | Unclassified | 2835 |
| 538 | Ga0436362_1292569 | 3300039453 | Bacteria | 2264 |
| 539 | Ga0451835_0382775 | 3300041492 | Bacteria | 664 |
| 540 | Ga0453684_0185874 | 3300044712 | Bacteria | 2435 |
| 541 | Ga0451576_0163768 | 3300045051 | Unclassified | 2321 |
| 542 | Ga0451576_0230572 | 3300045051 | Bacteria | 1934 |
| 543 | Ga0495629_0646771 | 3300046459 | Bacteria | 705 |
| 544 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 545 | Ga0495651_0894177 | 3300046462 | Unclassified | 543 |
| 546 | Ga0495653_0451034 | 3300046463 | Bacteria | 809 |
| 547 | Ga0495580_0001485 | 3300046472 | Bacteria | 20582 |
| 548 | Ga0495580_0010703 | 3300046472 | Bacteria | 7125 |
| 549 | Ga0495580_0018662 | 3300046472 | Bacteria | 5161 |
| 550 | Ga0495580_0049522 | 3300046472 | Bacteria | 2973 |
| 551 | Ga0495582_0239099 | 3300046473 | Bacteria | 1041 |
| 552 | Ga0495582_0270407 | 3300046473 | Bacteria | 975 |
| 553 | Ga0495664_0148143 | 3300046477 | Bacteria | 1424 |
| 554 | Ga0495606_0032528 | 3300046507 | Bacteria | 3612 |
| 555 | Ga0495610_0000129 | 3300046512 | Bacteria | 83051 |
| 556 | Ga0495618_0309070 | 3300046514 | Unclassified | 981 |
| 557 | Ga0495630_0005812 | 3300046517 | Bacteria | 8718 |
| 558 | Ga0495630_0783335 | 3300046517 | Unclassified | 728 |
| 559 | Ga0495637_0005395 | 3300046520 | Bacteria | 6531 |
| 560 | Ga0495652_0884403 | 3300046529 | Bacteria | 590 |
| 561 | Ga0495588_0234441 | 3300046674 | Bacteria | 968 |
| 562 | Ga0495669_0172841 | 3300046684 | Bacteria | 1028 |
| 563 | Ga0495613_0222418 | 3300046689 | Bacteria | 1325 |
| 564 | Ga0495674_0032150 | 3300047319 | Bacteria | 4762 |
| 565 | Ga0495674_0263125 | 3300047319 | Bacteria | 1417 |
| 566 | Ga0495674_0672515 | 3300047319 | Bacteria | 815 |
| 567 | Ga0495681_0149756 | 3300047470 | Bacteria | 980 |
| 568 | Ga0495602_0023682 | 3300048088 | Bacteria | 5977 |
| 569 | Ga0496102_0028242 | 3300048905 | Bacteria | 5010 |
| 570 | Ga0496102_0028521 | 3300048905 | Bacteria | 4987 |
| 571 | Ga0496102_0314734 | 3300048905 | Bacteria | 1475 |
| 572 | Ga0496102_0374412 | 3300048905 | Bacteria | 1340 |
| 573 | Ga0496104_0444877 | 3300048907 | Bacteria | 1208 |
| 574 | Ga0496104_1071811 | 3300048907 | Bacteria | 709 |
| 575 | Ga0496105_0062549 | 3300048908 | Bacteria | 3072 |
| 576 | Ga0496105_0065836 | 3300048908 | Bacteria | 2991 |
| 577 | Ga0496106_0492577 | 3300048909 | Bacteria | 985 |
| 578 | Ga0496106_0656772 | 3300048909 | Bacteria | 838 |
| 579 | Ga0496107_0241591 | 3300048910 | Bacteria | 1344 |
| 580 | Ga0496108_0007842 | 3300048911 | Bacteria | 8653 |
| 581 | Ga0496109_0000122 | 3300048912 | Bacteria | 80310 |
| 582 | Ga0496109_1000366 | 3300048912 | Bacteria | 774 |
| 583 | Ga0496110_0004464 | 3300048913 | Bacteria | 10847 |
| 584 | Ga0496110_0224667 | 3300048913 | Bacteria | 1708 |
| 585 | Ga0496110_0486459 | 3300048913 | Bacteria | 1124 |
| 586 | Ga0496111_0005613 | 3300048914 | Bacteria | 8068 |
| 587 | Ga0496112_0000027 | 3300048915 | Bacteria | 139514 |
| 588 | Ga0496112_0000572 | 3300048915 | Bacteria | 25337 |
| 589 | Ga0496112_0039024 | 3300048915 | Bacteria | 4638 |
| 590 | Ga0496112_0059711 | 3300048915 | Bacteria | 3758 |
| 591 | Ga0496113_0003205 | 3300048916 | Bacteria | 9752 |
| 592 | Ga0496113_0614955 | 3300048916 | Bacteria | 870 |
| 593 | Ga0496114_0353963 | 3300048917 | Bacteria | 1299 |
| 594 | Ga0496114_0666614 | 3300048917 | Bacteria | 914 |
| 595 | Ga0501291_088672 | 3300049514 | Bacteria | 628 |
| 596 | Ga0501298_019163 | 3300049521 | Bacteria | 1266 |
| 597 | Ga0501032_0099369 | 3300049569 | Bacteria | 1928 |
| 598 | Ga0501034_0014078 | 3300049571 | Bacteria | 8241 |
| 599 | Ga0501047_0006360 | 3300049581 | Bacteria | 11108 |
| 600 | Ga0501047_0205898 | 3300049581 | Bacteria | 1827 |
| 601 | Ga0501067_0385123 | 3300049583 | Bacteria | 782 |
| 602 | Ga0501070_0250360 | 3300049586 | Bacteria | 1449 |
| 603 | Ga0501080_0002571 | 3300049742 | Bacteria | 15889 |
| 604 | Ga0501083_0082223 | 3300049744 | Bacteria | 2134 |
| 605 | Ga0501083_0140562 | 3300049744 | Bacteria | 1581 |
| 606 | Ga0501044_0001865 | 3300049823 | Bacteria | 24437 |
| 607 | nmdc:mga03n38_432848_c1 | 3300050490 | Bacteria | 729 |
| 608 | nmdc:mga09592_283908_c1 | 3300050508 | Bacteria | 1435 |
| 609 | nmdc:mga0qj67_767106_c1 | 3300050509 | Bacteria | 765 |
| 610 | nmdc:mga08y16_120423_c1 | 3300050511 | Unclassified | 2731 |
| 611 | nmdc:mga08y16_540962_c1 | 3300050511 | Bacteria | 1180 |
| 612 | nmdc:mga0n895_9096_c1 | 3300050512 | Bacteria | 8667 |
| 613 | nmdc:mga0rr50_1537_c2 | 3300050513 | Bacteria | 8773 |
| 614 | nmdc:mga0rr50_98449_c1 | 3300050513 | Unclassified | 2292 |
| 615 | nmdc:mga08x19_145153_c1 | 3300050514 | Bacteria | 1605 |
| 616 | nmdc:mga0a205_546156_c1 | 3300050515 | Unclassified | 1014 |
| 617 | nmdc:mga0a205_987839_c1 | 3300050515 | Bacteria | 689 |
| 618 | Ga0500557_020248 | 3300053105 | Bacteria | 1889 |
| 619 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 620 | Ga0587079_081840 | 3300059647 | Bacteria | 740 |
| 621 | Ga0501082_0471968 | 3300060353 | Bacteria | 1096 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1400891 | Ga0436365_1400891_92_559 | 155 |
| 2 | 3300039450 | Ga0436363_0215964 | Ga0436363_0215964_13_480 | 155 |
| 3 | 3300049514 | Ga0501291_088672 | Ga0501291_088672_93_578 | 161 |
| 4 | 3300005547 | Ga0070693_100037406 | Ga0070693_1000374062 | 163 |
| 5 | 3300025927 | Ga0207687_10014207 | Ga0207687_100142072 | 163 |
| 6 | 3300035725 | Ga0373947_0149734 | Ga0373947_0149734_811_1302 | 163 |
| 7 | 3300049744 | Ga0501083_0140562 | Ga0501083_0140562_651_1199 | 163 |
| 8 | 3300009553 | Ga0105249_10155975 | Ga0105249_101559753 | 164 |
| 9 | 3300046462 | Ga0495651_0894177 | Ga0495651_0894177_22_516 | 164 |
| 10 | 3300026121 | Ga0207683_10056544 | Ga0207683_100565445 | 169 |
| 11 | 3300038443 | Ga0395901_0404620 | Ga0395901_0404620_858_1388 | 176 |
| 12 | iso_pu_bacteria | 2896344016 | 2896346811 | 176 |
| 13 | 3300003322 | rootL2_10147111 | rootL2_101471113 | 177 |
| 14 | 3300006844 | Ga0075428_100735584 | Ga0075428_1007355842 | 177 |
| 15 | 3300009094 | Ga0111539_10021661 | Ga0111539_100216618 | 177 |
| 16 | 3300014326 | Ga0157380_10001491 | Ga0157380_100014913 | 177 |
| 17 | 3300014326 | Ga0157380_11485090 | Ga0157380_114850901 | 177 |
| 18 | 3300025298 | Ga0209050_1002956 | Ga0209050_100295610 | 177 |
| 19 | 3300027907 | Ga0207428_10359752 | Ga0207428_103597522 | 177 |
| 20 | 3300031456 | Ga0307513_10074122 | Ga0307513_100741223 | 177 |
| 21 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_730026_730610 | 177 |
| 22 | 3300050511 | nmdc:mga08y16_120423_c1 | nmdc:mga08y16_120423_c1_674_1210 | 177 |
| 23 | 3300053105 | Ga0500557_020248 | Ga0500557_020248_1148_1732 | 177 |
| 24 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_36838_37422 | 177 |
| 25 | iso_pu_bacteria | 2585427687 | 2586206973 | 177 |
| 26 | iso_pu_bacteria | 2738541302 | 2738854602 | 177 |
| 27 | iso_pu_bacteria | 2739367651 | 2739587113 | 177 |
| 28 | iso_pu_bacteria | 2739367656 | 2739615212 | 177 |
| 29 | iso_pu_bacteria | 2739367663 | 2739645663 | 177 |
| 30 | iso_pu_bacteria | 2818991437 | 2819547578 | 177 |
| 31 | iso_pu_bacteria | 2842722452 | 2842726592 | 177 |
| 32 | iso_pu_bacteria | 2842909656 | 2842911436 | 177 |
| 33 | iso_pu_bacteria | 2849281842 | 2849284218 | 177 |
| 34 | iso_pu_bacteria | 2857627736 | 2857627823 | 177 |
| 35 | iso_pu_bacteria | 2904445276 | 2904449015 | 177 |
| 36 | iso_pu_bacteria | 2945997725 | 2946003106 | 177 |
| 37 | iso_pu_bacteria | 2954016120 | 2954019965 | 177 |
| 38 | 3300006847 | Ga0075431_101254123 | Ga0075431_1012541231 | 178 |
| 39 | 3300009094 | Ga0111539_10069045 | Ga0111539_100690455 | 178 |
| 40 | 3300009147 | Ga0114129_11660514 | Ga0114129_116605142 | 178 |
| 41 | 3300027907 | Ga0207428_10260282 | Ga0207428_102602822 | 178 |
| 42 | 3300031824 | Ga0307413_10157596 | Ga0307413_101575962 | 178 |
| 43 | 3300031911 | Ga0307412_10185167 | Ga0307412_101851672 | 178 |
| 44 | 3300032004 | Ga0307414_10188021 | Ga0307414_101880212 | 178 |
| 45 | 3300032005 | Ga0307411_10037272 | Ga0307411_100372722 | 178 |
| 46 | 3300050511 | nmdc:mga08y16_540962_c1 | nmdc:mga08y16_540962_c1_615_1154 | 178 |
| 47 | 3300002774 | JGI25150J39212_1000004 | JGI25150J39212_1000004139 | 179 |
| 48 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002486 | 179 |
| 49 | 3300003215 | JGI25153J46596_10000037 | JGI25153J46596_10000037142 | 179 |
| 50 | 3300003791 | Ga0055530_10000821 | Ga0055530_1000082116 | 179 |
| 51 | 3300005563 | Ga0068855_100878719 | Ga0068855_1008787192 | 179 |
| 52 | 3300009036 | Ga0105244_10036466 | Ga0105244_100364663 | 179 |
| 53 | 3300009174 | Ga0105241_11199696 | Ga0105241_111996961 | 179 |
| 54 | 3300013100 | Ga0157373_10173368 | Ga0157373_101733682 | 179 |
| 55 | 3300013102 | Ga0157371_10000027 | Ga0157371_1000002720 | 179 |
| 56 | 3300013104 | Ga0157370_10034394 | Ga0157370_100343945 | 179 |
| 57 | 3300013104 | Ga0157370_10497644 | Ga0157370_104976442 | 179 |
| 58 | 3300013105 | Ga0157369_10000053 | Ga0157369_10000053139 | 179 |
| 59 | 3300013306 | Ga0163162_10000078 | Ga0163162_1000007833 | 179 |
| 60 | 3300013308 | Ga0157375_10713036 | Ga0157375_107130362 | 179 |
| 61 | 3300013308 | Ga0157375_11997537 | Ga0157375_119975371 | 179 |
| 62 | 3300014497 | Ga0182008_10000334 | Ga0182008_100003348 | 179 |
| 63 | 3300015261 | Ga0182006_1000755 | Ga0182006_100075513 | 179 |
| 64 | 3300015261 | Ga0182006_1000787 | Ga0182006_100078711 | 179 |
| 65 | 3300015262 | Ga0182007_10000005 | Ga0182007_10000005276 | 179 |
| 66 | 3300015682 | Ga0183373_1007 | Ga0183373_1007202 | 179 |
| 67 | 3300017792 | Ga0163161_10043332 | Ga0163161_100433323 | 179 |
| 68 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003361 | 179 |
| 69 | 3300025258 | Ga0209129_1000022 | Ga0209129_1000022361 | 179 |
| 70 | 3300025292 | Ga0209676_1000039 | Ga0209676_1000039161 | 179 |
| 71 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007360 | 179 |
| 72 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012361 | 179 |
| 73 | 3300025298 | Ga0209050_1000033 | Ga0209050_1000033288 | 179 |
| 74 | 3300025923 | Ga0207681_10381368 | Ga0207681_103813681 | 179 |
| 75 | 3300025949 | Ga0207667_10761572 | Ga0207667_107615722 | 179 |
| 76 | 3300026089 | Ga0207648_10462947 | Ga0207648_104629471 | 179 |
| 77 | 3300031731 | Ga0307405_10000009 | Ga0307405_1000000910 | 179 |
| 78 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001191 | 179 |
| 79 | 3300031995 | Ga0307409_100034309 | Ga0307409_1000343092 | 179 |
| 80 | 3300032002 | Ga0307416_100000008 | Ga0307416_100000008198 | 179 |
| 81 | 3300041492 | Ga0451835_0382775 | Ga0451835_0382775_78_629 | 179 |
| 82 | 3300046507 | Ga0495606_0032528 | Ga0495606_0032528_807_1358 | 179 |
| 83 | 3300046512 | Ga0495610_0000129 | Ga0495610_0000129_65512_66063 | 179 |
| 84 | 3300046520 | Ga0495637_0005395 | Ga0495637_0005395_4941_5492 | 179 |
| 85 | 3300047470 | Ga0495681_0149756 | Ga0495681_0149756_356_907 | 179 |
| 86 | 3300005329 | Ga0070683_100316229 | Ga0070683_1003162291 | 180 |
| 87 | 3300005329 | Ga0070683_100380014 | Ga0070683_1003800142 | 180 |
| 88 | 3300005331 | Ga0070670_100260357 | Ga0070670_1002603573 | 180 |
| 89 | 3300005354 | Ga0070675_100168493 | Ga0070675_1001684932 | 180 |
| 90 | 3300005354 | Ga0070675_100985457 | Ga0070675_1009854572 | 180 |
| 91 | 3300005355 | Ga0070671_100021299 | Ga0070671_1000212992 | 180 |
| 92 | 3300005356 | Ga0070674_100072261 | Ga0070674_1000722612 | 180 |
| 93 | 3300005356 | Ga0070674_101012338 | Ga0070674_1010123381 | 180 |
| 94 | 3300005364 | Ga0070673_100096308 | Ga0070673_1000963082 | 180 |
| 95 | 3300005543 | Ga0070672_100076519 | Ga0070672_1000765192 | 180 |
| 96 | 3300005548 | Ga0070665_100203971 | Ga0070665_1002039712 | 180 |
| 97 | 3300005564 | Ga0070664_100284808 | Ga0070664_1002848082 | 180 |
| 98 | 3300005617 | Ga0068859_101037588 | Ga0068859_1010375882 | 180 |
| 99 | 3300005618 | Ga0068864_100433679 | Ga0068864_1004336792 | 180 |
| 100 | 3300006931 | Ga0097620_101037637 | Ga0097620_1010376371 | 180 |
| 101 | 3300013105 | Ga0157369_10057271 | Ga0157369_100572711 | 180 |
| 102 | 3300013308 | Ga0157375_10370205 | Ga0157375_103702052 | 180 |
| 103 | 3300014325 | Ga0163163_12194915 | Ga0163163_121949151 | 180 |
| 104 | 3300014968 | Ga0157379_11467758 | Ga0157379_114677581 | 180 |
| 105 | 3300021361 | Ga0213872_10148104 | Ga0213872_101481041 | 180 |
| 106 | 3300021441 | Ga0213871_10021025 | Ga0213871_100210252 | 180 |
| 107 | 3300025924 | Ga0207694_10388955 | Ga0207694_103889552 | 180 |
| 108 | 3300025937 | Ga0207669_10150494 | Ga0207669_101504942 | 180 |
| 109 | 3300025940 | Ga0207691_10006756 | Ga0207691_100067565 | 180 |
| 110 | 3300025944 | Ga0207661_10100241 | Ga0207661_101002413 | 180 |
| 111 | 3300025945 | Ga0207679_10271822 | Ga0207679_102718222 | 180 |
| 112 | 3300025960 | Ga0207651_10059734 | Ga0207651_100597342 | 180 |
| 113 | 3300026041 | Ga0207639_10746188 | Ga0207639_107461882 | 180 |
| 114 | 3300026089 | Ga0207648_10681091 | Ga0207648_106810911 | 180 |
| 115 | 3300026095 | Ga0207676_10558741 | Ga0207676_105587412 | 180 |
| 116 | 3300026121 | Ga0207683_10061644 | Ga0207683_100616443 | 180 |
| 117 | 3300028380 | Ga0268265_11054161 | Ga0268265_110541611 | 180 |
| 118 | 3300031595 | Ga0265313_10068357 | Ga0265313_100683572 | 180 |
| 119 | 3300031995 | Ga0307409_100086880 | Ga0307409_1000868802 | 180 |
| 120 | 3300032002 | Ga0307416_101996178 | Ga0307416_1019961781 | 180 |
| 121 | 3300032004 | Ga0307414_10215768 | Ga0307414_102157682 | 180 |
| 122 | 3300037853 | Ga0436364_0687620 | Ga0436364_0687620_96_638 | 180 |
| 123 | 3300037853 | Ga0436364_0751971 | Ga0436364_0751971_76_618 | 180 |
| 124 | 3300039447 | Ga0436361_0705453 | Ga0436361_0705453_164_706 | 180 |
| 125 | 3300039447 | Ga0436361_0720369 | Ga0436361_0720369_1833_2375 | 180 |
| 126 | 3300039453 | Ga0436362_1292569 | Ga0436362_1292569_233_775 | 180 |
| 127 | 3300044712 | Ga0453684_0185874 | Ga0453684_0185874_148_690 | 180 |
| 128 | 3300046473 | Ga0495582_0239099 | Ga0495582_0239099_289_831 | 180 |
| 129 | 3300046529 | Ga0495652_0884403 | Ga0495652_0884403_24_566 | 180 |
| 130 | 3300047319 | Ga0495674_0263125 | Ga0495674_0263125_211_753 | 180 |
| 131 | 3300049521 | Ga0501298_019163 | Ga0501298_019163_561_1103 | 180 |
| 132 | 3300049569 | Ga0501032_0099369 | Ga0501032_0099369_756_1298 | 180 |
| 133 | 3300049571 | Ga0501034_0014078 | Ga0501034_0014078_5880_6422 | 180 |
| 134 | 3300049581 | Ga0501047_0006360 | Ga0501047_0006360_1195_1737 | 180 |
| 135 | 3300049586 | Ga0501070_0250360 | Ga0501070_0250360_467_1009 | 180 |
| 136 | 3300049742 | Ga0501080_0002571 | Ga0501080_0002571_4565_5107 | 180 |
| 137 | 3300049823 | Ga0501044_0001865 | Ga0501044_0001865_6943_7485 | 180 |
| 138 | 3300060353 | Ga0501082_0471968 | Ga0501082_0471968_76_618 | 180 |
| 139 | 3300005344 | Ga0070661_100278810 | Ga0070661_1002788102 | 181 |
| 140 | 3300005530 | Ga0070679_101051070 | Ga0070679_1010510701 | 181 |
| 141 | 3300005842 | Ga0068858_100706494 | Ga0068858_1007064941 | 181 |
| 142 | 3300009098 | Ga0105245_10005753 | Ga0105245_100057533 | 181 |
| 143 | 3300009148 | Ga0105243_12042307 | Ga0105243_120423071 | 181 |
| 144 | 3300013296 | Ga0157374_10092195 | Ga0157374_100921953 | 181 |
| 145 | 3300013307 | Ga0157372_11127001 | Ga0157372_111270012 | 181 |
| 146 | 3300025920 | Ga0207649_10539946 | Ga0207649_105399462 | 181 |
| 147 | 3300025927 | Ga0207687_10013423 | Ga0207687_100134234 | 181 |
| 148 | 3300026035 | Ga0207703_10670737 | Ga0207703_106707371 | 181 |
| 149 | 3300026035 | Ga0207703_11661683 | Ga0207703_116616831 | 181 |
| 150 | 3300045051 | Ga0451576_0230572 | Ga0451576_0230572_1319_1867 | 181 |
| 151 | 3300050508 | nmdc:mga09592_283908_c1 | nmdc:mga09592_283908_c1_280_825 | 181 |
| 152 | 3300050509 | nmdc:mga0qj67_767106_c1 | nmdc:mga0qj67_767106_c1_171_716 | 181 |
| 153 | 3300005327 | Ga0070658_10025188 | Ga0070658_100251885 | 182 |
| 154 | 3300005355 | Ga0070671_100042095 | Ga0070671_1000420953 | 182 |
| 155 | 3300005434 | Ga0070709_10007779 | Ga0070709_100077792 | 182 |
| 156 | 3300005434 | Ga0070709_10128175 | Ga0070709_101281752 | 182 |
| 157 | 3300005435 | Ga0070714_100061534 | Ga0070714_1000615342 | 182 |
| 158 | 3300005435 | Ga0070714_100137789 | Ga0070714_1001377891 | 182 |
| 159 | 3300005435 | Ga0070714_100705905 | Ga0070714_1007059051 | 182 |
| 160 | 3300005436 | Ga0070713_100006935 | Ga0070713_1000069359 | 182 |
| 161 | 3300005437 | Ga0070710_10016059 | Ga0070710_100160592 | 182 |
| 162 | 3300005439 | Ga0070711_100010563 | Ga0070711_1000105637 | 182 |
| 163 | 3300005439 | Ga0070711_100414670 | Ga0070711_1004146701 | 182 |
| 164 | 3300005445 | Ga0070708_100007922 | Ga0070708_1000079228 | 182 |
| 165 | 3300005467 | Ga0070706_100697755 | Ga0070706_1006977551 | 182 |
| 166 | 3300005539 | Ga0068853_100351130 | Ga0068853_1003511301 | 182 |
| 167 | 3300005539 | Ga0068853_100464952 | Ga0068853_1004649522 | 182 |
| 168 | 3300005563 | Ga0068855_100045071 | Ga0068855_1000450712 | 182 |
| 169 | 3300005563 | Ga0068855_100142479 | Ga0068855_1001424793 | 182 |
| 170 | 3300005577 | Ga0068857_100009899 | Ga0068857_1000098996 | 182 |
| 171 | 3300006028 | Ga0070717_10015758 | Ga0070717_100157583 | 182 |
| 172 | 3300006028 | Ga0070717_10020100 | Ga0070717_100201008 | 182 |
| 173 | 3300006173 | Ga0070716_100022019 | Ga0070716_1000220194 | 182 |
| 174 | 3300006173 | Ga0070716_100028494 | Ga0070716_1000284944 | 182 |
| 175 | 3300006175 | Ga0070712_100015362 | Ga0070712_1000153624 | 182 |
| 176 | 3300009174 | Ga0105241_10045281 | Ga0105241_100452812 | 182 |
| 177 | 3300009551 | Ga0105238_10140076 | Ga0105238_101400762 | 182 |
| 178 | 3300010375 | Ga0105239_10024001 | Ga0105239_100240014 | 182 |
| 179 | 3300010375 | Ga0105239_10364274 | Ga0105239_103642741 | 182 |
| 180 | 3300013105 | Ga0157369_10229084 | Ga0157369_102290842 | 182 |
| 181 | 3300013105 | Ga0157369_10875885 | Ga0157369_108758851 | 182 |
| 182 | 3300013307 | Ga0157372_10056006 | Ga0157372_100560063 | 182 |
| 183 | 3300013307 | Ga0157372_10069578 | Ga0157372_100695782 | 182 |
| 184 | 3300025898 | Ga0207692_10045754 | Ga0207692_100457542 | 182 |
| 185 | 3300025906 | Ga0207699_10004717 | Ga0207699_100047172 | 182 |
| 186 | 3300025906 | Ga0207699_10026207 | Ga0207699_100262073 | 182 |
| 187 | 3300025909 | Ga0207705_10047799 | Ga0207705_100477993 | 182 |
| 188 | 3300025909 | Ga0207705_10309307 | Ga0207705_103093071 | 182 |
| 189 | 3300025915 | Ga0207693_10000453 | Ga0207693_1000045322 | 182 |
| 190 | 3300025916 | Ga0207663_10323603 | Ga0207663_103236031 | 182 |
| 191 | 3300025919 | Ga0207657_11171496 | Ga0207657_111714961 | 182 |
| 192 | 3300025924 | Ga0207694_10181728 | Ga0207694_101817282 | 182 |
| 193 | 3300025928 | Ga0207700_10004738 | Ga0207700_100047384 | 182 |
| 194 | 3300025928 | Ga0207700_10158677 | Ga0207700_101586772 | 182 |
| 195 | 3300025929 | Ga0207664_10078188 | Ga0207664_100781882 | 182 |
| 196 | 3300025929 | Ga0207664_10287670 | Ga0207664_102876701 | 182 |
| 197 | 3300025929 | Ga0207664_10341865 | Ga0207664_103418652 | 182 |
| 198 | 3300025929 | Ga0207664_10477231 | Ga0207664_104772311 | 182 |
| 199 | 3300025931 | Ga0207644_10091267 | Ga0207644_100912671 | 182 |
| 200 | 3300025932 | Ga0207690_10229710 | Ga0207690_102297102 | 182 |
| 201 | 3300025939 | Ga0207665_10009538 | Ga0207665_100095387 | 182 |
| 202 | 3300025949 | Ga0207667_10041026 | Ga0207667_100410262 | 182 |
| 203 | 3300025949 | Ga0207667_10224671 | Ga0207667_102246711 | 182 |
| 204 | 3300026078 | Ga0207702_11143193 | Ga0207702_111431931 | 182 |
| 205 | 3300026116 | Ga0207674_10001103 | Ga0207674_100011039 | 182 |
| 206 | 3300026118 | Ga0207675_100291470 | Ga0207675_1002914704 | 182 |
| 207 | 3300037466 | Ga0395898_0217237 | Ga0395898_0217237_627_1175 | 182 |
| 208 | 3300038443 | Ga0395901_0516985 | Ga0395901_0516985_313_861 | 182 |
| 209 | 3300046514 | Ga0495618_0309070 | Ga0495618_0309070_301_852 | 182 |
| 210 | 3300048905 | Ga0496102_0314734 | Ga0496102_0314734_16_570 | 182 |
| 211 | 3300048907 | Ga0496104_1071811 | Ga0496104_1071811_96_650 | 182 |
| 212 | 3300049581 | Ga0501047_0205898 | Ga0501047_0205898_231_779 | 182 |
| 213 | 3300049583 | Ga0501067_0385123 | Ga0501067_0385123_90_638 | 182 |
| 214 | 3300059647 | Ga0587079_081840 | Ga0587079_081840_182_730 | 182 |
| 215 | 3300003323 | rootH1_10286969 | rootH1_102869692 | 183 |
| 216 | 3300005295 | Ga0065707_10096444 | Ga0065707_100964443 | 183 |
| 217 | 3300005329 | Ga0070683_100033131 | Ga0070683_1000331318 | 183 |
| 218 | 3300005329 | Ga0070683_100160096 | Ga0070683_1001600963 | 183 |
| 219 | 3300005331 | Ga0070670_100003099 | Ga0070670_1000030999 | 183 |
| 220 | 3300005334 | Ga0068869_100022398 | Ga0068869_1000223983 | 183 |
| 221 | 3300005337 | Ga0070682_101033622 | Ga0070682_1010336221 | 183 |
| 222 | 3300005338 | Ga0068868_100006594 | Ga0068868_1000065949 | 183 |
| 223 | 3300005338 | Ga0068868_100069462 | Ga0068868_1000694622 | 183 |
| 224 | 3300005338 | Ga0068868_100612732 | Ga0068868_1006127321 | 183 |
| 225 | 3300005344 | Ga0070661_100010101 | Ga0070661_1000101012 | 183 |
| 226 | 3300005355 | Ga0070671_100190928 | Ga0070671_1001909282 | 183 |
| 227 | 3300005364 | Ga0070673_100032379 | Ga0070673_1000323792 | 183 |
| 228 | 3300005364 | Ga0070673_100990811 | Ga0070673_1009908112 | 183 |
| 229 | 3300005435 | Ga0070714_100020154 | Ga0070714_1000201542 | 183 |
| 230 | 3300005435 | Ga0070714_100047876 | Ga0070714_1000478762 | 183 |
| 231 | 3300005436 | Ga0070713_100021071 | Ga0070713_1000210713 | 183 |
| 232 | 3300005436 | Ga0070713_100085430 | Ga0070713_1000854302 | 183 |
| 233 | 3300005436 | Ga0070713_100622596 | Ga0070713_1006225962 | 183 |
| 234 | 3300005437 | Ga0070710_10028225 | Ga0070710_100282252 | 183 |
| 235 | 3300005439 | Ga0070711_100187225 | Ga0070711_1001872252 | 183 |
| 236 | 3300005439 | Ga0070711_100346771 | Ga0070711_1003467712 | 183 |
| 237 | 3300005458 | Ga0070681_10000672 | Ga0070681_1000067213 | 183 |
| 238 | 3300005458 | Ga0070681_10002267 | Ga0070681_100022675 | 183 |
| 239 | 3300005471 | Ga0070698_100700604 | Ga0070698_1007006041 | 183 |
| 240 | 3300005530 | Ga0070679_100007996 | Ga0070679_1000079969 | 183 |
| 241 | 3300005535 | Ga0070684_100433637 | Ga0070684_1004336372 | 183 |
| 242 | 3300005539 | Ga0068853_100041435 | Ga0068853_1000414355 | 183 |
| 243 | 3300005539 | Ga0068853_100163119 | Ga0068853_1001631192 | 183 |
| 244 | 3300005539 | Ga0068853_100242010 | Ga0068853_1002420102 | 183 |
| 245 | 3300005547 | Ga0070693_100030761 | Ga0070693_1000307613 | 183 |
| 246 | 3300005547 | Ga0070693_100043191 | Ga0070693_1000431912 | 183 |
| 247 | 3300005563 | Ga0068855_100003709 | Ga0068855_1000037092 | 183 |
| 248 | 3300005563 | Ga0068855_100008412 | Ga0068855_10000841212 | 183 |
| 249 | 3300005564 | Ga0070664_100005991 | Ga0070664_10000599111 | 183 |
| 250 | 3300005577 | Ga0068857_100000154 | Ga0068857_10000015416 | 183 |
| 251 | 3300005577 | Ga0068857_100021773 | Ga0068857_1000217732 | 183 |
| 252 | 3300005578 | Ga0068854_100029316 | Ga0068854_1000293165 | 183 |
| 253 | 3300005614 | Ga0068856_100000612 | Ga0068856_10000061214 | 183 |
| 254 | 3300005614 | Ga0068856_100035661 | Ga0068856_1000356612 | 183 |
| 255 | 3300005617 | Ga0068859_100004113 | Ga0068859_10000411310 | 183 |
| 256 | 3300005618 | Ga0068864_100009624 | Ga0068864_1000096243 | 183 |
| 257 | 3300005618 | Ga0068864_100046472 | Ga0068864_1000464725 | 183 |
| 258 | 3300005719 | Ga0068861_100368463 | Ga0068861_1003684633 | 183 |
| 259 | 3300005834 | Ga0068851_10022057 | Ga0068851_100220572 | 183 |
| 260 | 3300005841 | Ga0068863_100016101 | Ga0068863_1000161015 | 183 |
| 261 | 3300005841 | Ga0068863_100017029 | Ga0068863_1000170293 | 183 |
| 262 | 3300005842 | Ga0068858_100000491 | Ga0068858_10000049115 | 183 |
| 263 | 3300005842 | Ga0068858_100110342 | Ga0068858_1001103422 | 183 |
| 264 | 3300005842 | Ga0068858_100878343 | Ga0068858_1008783431 | 183 |
| 265 | 3300005843 | Ga0068860_100027170 | Ga0068860_1000271703 | 183 |
| 266 | 3300005843 | Ga0068860_100517227 | Ga0068860_1005172272 | 183 |
| 267 | 3300006028 | Ga0070717_10008365 | Ga0070717_100083655 | 183 |
| 268 | 3300006028 | Ga0070717_10143272 | Ga0070717_101432723 | 183 |
| 269 | 3300006028 | Ga0070717_10620951 | Ga0070717_106209512 | 183 |
| 270 | 3300006173 | Ga0070716_100005555 | Ga0070716_1000055552 | 183 |
| 271 | 3300006173 | Ga0070716_100450975 | Ga0070716_1004509752 | 183 |
| 272 | 3300006175 | Ga0070712_100165104 | Ga0070712_1001651042 | 183 |
| 273 | 3300006237 | Ga0097621_100000805 | Ga0097621_1000008053 | 183 |
| 274 | 3300006237 | Ga0097621_100001391 | Ga0097621_1000013919 | 183 |
| 275 | 3300006237 | Ga0097621_100085707 | Ga0097621_1000857072 | 183 |
| 276 | 3300006237 | Ga0097621_100090806 | Ga0097621_1000908062 | 183 |
| 277 | 3300006237 | Ga0097621_100137229 | Ga0097621_1001372292 | 183 |
| 278 | 3300006358 | Ga0068871_100000803 | Ga0068871_1000008032 | 183 |
| 279 | 3300006358 | Ga0068871_100028421 | Ga0068871_1000284212 | 183 |
| 280 | 3300006358 | Ga0068871_100175524 | Ga0068871_1001755242 | 183 |
| 281 | 3300006852 | Ga0075433_10605088 | Ga0075433_106050881 | 183 |
| 282 | 3300006871 | Ga0075434_100144274 | Ga0075434_1001442743 | 183 |
| 283 | 3300006881 | Ga0068865_100004959 | Ga0068865_1000049593 | 183 |
| 284 | 3300006881 | Ga0068865_100009927 | Ga0068865_1000099273 | 183 |
| 285 | 3300006914 | Ga0075436_100121279 | Ga0075436_1001212793 | 183 |
| 286 | 3300006931 | Ga0097620_100004113 | Ga0097620_10000411310 | 183 |
| 287 | 3300007076 | Ga0075435_100019604 | Ga0075435_1000196045 | 183 |
| 288 | 3300007076 | Ga0075435_100557700 | Ga0075435_1005577002 | 183 |
| 289 | 3300009093 | Ga0105240_10057938 | Ga0105240_100579383 | 183 |
| 290 | 3300009093 | Ga0105240_10082755 | Ga0105240_100827555 | 183 |
| 291 | 3300009093 | Ga0105240_10335856 | Ga0105240_103358563 | 183 |
| 292 | 3300009094 | Ga0111539_10754351 | Ga0111539_107543512 | 183 |
| 293 | 3300009098 | Ga0105245_10001141 | Ga0105245_100011413 | 183 |
| 294 | 3300009147 | Ga0114129_10834176 | Ga0114129_108341761 | 183 |
| 295 | 3300009174 | Ga0105241_10052655 | Ga0105241_100526555 | 183 |
| 296 | 3300009174 | Ga0105241_10657653 | Ga0105241_106576531 | 183 |
| 297 | 3300009176 | Ga0105242_11395753 | Ga0105242_113957531 | 183 |
| 298 | 3300009177 | Ga0105248_10001672 | Ga0105248_100016721 | 183 |
| 299 | 3300009177 | Ga0105248_10070960 | Ga0105248_100709605 | 183 |
| 300 | 3300009545 | Ga0105237_10045613 | Ga0105237_100456134 | 183 |
| 301 | 3300009545 | Ga0105237_10070395 | Ga0105237_100703955 | 183 |
| 302 | 3300009545 | Ga0105237_10706801 | Ga0105237_107068011 | 183 |
| 303 | 3300009551 | Ga0105238_10000339 | Ga0105238_1000033917 | 183 |
| 304 | 3300009551 | Ga0105238_10099777 | Ga0105238_100997775 | 183 |
| 305 | 3300010375 | Ga0105239_10038911 | Ga0105239_100389118 | 183 |
| 306 | 3300010375 | Ga0105239_10146124 | Ga0105239_101461243 | 183 |
| 307 | 3300010375 | Ga0105239_10372081 | Ga0105239_103720812 | 183 |
| 308 | 3300013100 | Ga0157373_10082741 | Ga0157373_100827412 | 183 |
| 309 | 3300013102 | Ga0157371_10178806 | Ga0157371_101788062 | 183 |
| 310 | 3300013104 | Ga0157370_10189244 | Ga0157370_101892441 | 183 |
| 311 | 3300013104 | Ga0157370_10665610 | Ga0157370_106656101 | 183 |
| 312 | 3300013105 | Ga0157369_10001152 | Ga0157369_100011529 | 183 |
| 313 | 3300013105 | Ga0157369_10116778 | Ga0157369_101167783 | 183 |
| 314 | 3300013296 | Ga0157374_10000384 | Ga0157374_1000038423 | 183 |
| 315 | 3300013296 | Ga0157374_10001410 | Ga0157374_1000141013 | 183 |
| 316 | 3300013296 | Ga0157374_10018130 | Ga0157374_100181309 | 183 |
| 317 | 3300013297 | Ga0157378_10000121 | Ga0157378_1000012116 | 183 |
| 318 | 3300013297 | Ga0157378_10000188 | Ga0157378_100001882 | 183 |
| 319 | 3300013297 | Ga0157378_10001045 | Ga0157378_1000104512 | 183 |
| 320 | 3300013297 | Ga0157378_10043993 | Ga0157378_100439931 | 183 |
| 321 | 3300013306 | Ga0163162_10494549 | Ga0163162_104945491 | 183 |
| 322 | 3300013307 | Ga0157372_10002460 | Ga0157372_1000246015 | 183 |
| 323 | 3300013307 | Ga0157372_10002767 | Ga0157372_1000276720 | 183 |
| 324 | 3300013307 | Ga0157372_10008312 | Ga0157372_1000831211 | 183 |
| 325 | 3300013307 | Ga0157372_10013774 | Ga0157372_100137749 | 183 |
| 326 | 3300013307 | Ga0157372_10017992 | Ga0157372_100179923 | 183 |
| 327 | 3300013307 | Ga0157372_10116403 | Ga0157372_101164033 | 183 |
| 328 | 3300013307 | Ga0157372_10154085 | Ga0157372_101540852 | 183 |
| 329 | 3300014969 | Ga0157376_10153764 | Ga0157376_101537642 | 183 |
| 330 | 3300014969 | Ga0157376_10335836 | Ga0157376_103358362 | 183 |
| 331 | 3300014969 | Ga0157376_10817788 | Ga0157376_108177882 | 183 |
| 332 | 3300021388 | Ga0213875_10041285 | Ga0213875_100412853 | 183 |
| 333 | 3300025321 | Ga0207656_10051872 | Ga0207656_100518722 | 183 |
| 334 | 3300025904 | Ga0207647_10020875 | Ga0207647_100208753 | 183 |
| 335 | 3300025905 | Ga0207685_10119552 | Ga0207685_101195522 | 183 |
| 336 | 3300025906 | Ga0207699_10012372 | Ga0207699_100123722 | 183 |
| 337 | 3300025911 | Ga0207654_10032858 | Ga0207654_100328582 | 183 |
| 338 | 3300025911 | Ga0207654_10347732 | Ga0207654_103477322 | 183 |
| 339 | 3300025912 | Ga0207707_10002233 | Ga0207707_1000223316 | 183 |
| 340 | 3300025912 | Ga0207707_10066332 | Ga0207707_100663323 | 183 |
| 341 | 3300025913 | Ga0207695_10014898 | Ga0207695_100148985 | 183 |
| 342 | 3300025913 | Ga0207695_10048448 | Ga0207695_100484485 | 183 |
| 343 | 3300025913 | Ga0207695_10836382 | Ga0207695_108363822 | 183 |
| 344 | 3300025914 | Ga0207671_10106109 | Ga0207671_101061093 | 183 |
| 345 | 3300025915 | Ga0207693_10041884 | Ga0207693_100418842 | 183 |
| 346 | 3300025915 | Ga0207693_10166787 | Ga0207693_101667872 | 183 |
| 347 | 3300025916 | Ga0207663_10153221 | Ga0207663_101532212 | 183 |
| 348 | 3300025916 | Ga0207663_10157607 | Ga0207663_101576071 | 183 |
| 349 | 3300025918 | Ga0207662_10152322 | Ga0207662_101523222 | 183 |
| 350 | 3300025920 | Ga0207649_10007569 | Ga0207649_100075692 | 183 |
| 351 | 3300025924 | Ga0207694_10001944 | Ga0207694_1000194414 | 183 |
| 352 | 3300025924 | Ga0207694_10156415 | Ga0207694_101564153 | 183 |
| 353 | 3300025925 | Ga0207650_10006009 | Ga0207650_100060097 | 183 |
| 354 | 3300025928 | Ga0207700_10004433 | Ga0207700_100044335 | 183 |
| 355 | 3300025928 | Ga0207700_10234562 | Ga0207700_102345623 | 183 |
| 356 | 3300025929 | Ga0207664_10002243 | Ga0207664_100022432 | 183 |
| 357 | 3300025929 | Ga0207664_10028417 | Ga0207664_100284172 | 183 |
| 358 | 3300025929 | Ga0207664_10034311 | Ga0207664_100343113 | 183 |
| 359 | 3300025931 | Ga0207644_10416940 | Ga0207644_104169402 | 183 |
| 360 | 3300025932 | Ga0207690_10512009 | Ga0207690_105120092 | 183 |
| 361 | 3300025938 | Ga0207704_10002101 | Ga0207704_100021013 | 183 |
| 362 | 3300025938 | Ga0207704_10029250 | Ga0207704_100292503 | 183 |
| 363 | 3300025938 | Ga0207704_10279901 | Ga0207704_102799012 | 183 |
| 364 | 3300025939 | Ga0207665_10017633 | Ga0207665_100176333 | 183 |
| 365 | 3300025941 | Ga0207711_10002420 | Ga0207711_100024201 | 183 |
| 366 | 3300025941 | Ga0207711_10017040 | Ga0207711_100170404 | 183 |
| 367 | 3300025942 | Ga0207689_10041762 | Ga0207689_100417624 | 183 |
| 368 | 3300025944 | Ga0207661_10117955 | Ga0207661_101179554 | 183 |
| 369 | 3300025944 | Ga0207661_10354381 | Ga0207661_103543812 | 183 |
| 370 | 3300025944 | Ga0207661_10400231 | Ga0207661_104002312 | 183 |
| 371 | 3300025945 | Ga0207679_10002335 | Ga0207679_100023353 | 183 |
| 372 | 3300025949 | Ga0207667_10001412 | Ga0207667_1000141219 | 183 |
| 373 | 3300025949 | Ga0207667_10038382 | Ga0207667_100383828 | 183 |
| 374 | 3300025960 | Ga0207651_10353375 | Ga0207651_103533751 | 183 |
| 375 | 3300025981 | Ga0207640_10597674 | Ga0207640_105976741 | 183 |
| 376 | 3300026023 | Ga0207677_10001997 | Ga0207677_100019973 | 183 |
| 377 | 3300026023 | Ga0207677_10051364 | Ga0207677_100513643 | 183 |
| 378 | 3300026023 | Ga0207677_10268022 | Ga0207677_102680221 | 183 |
| 379 | 3300026035 | Ga0207703_10032290 | Ga0207703_100322903 | 183 |
| 380 | 3300026035 | Ga0207703_10102661 | Ga0207703_101026613 | 183 |
| 381 | 3300026041 | Ga0207639_10477597 | Ga0207639_104775971 | 183 |
| 382 | 3300026078 | Ga0207702_10000714 | Ga0207702_100007143 | 183 |
| 383 | 3300026078 | Ga0207702_10001156 | Ga0207702_1000115619 | 183 |
| 384 | 3300026078 | Ga0207702_10003644 | Ga0207702_100036449 | 183 |
| 385 | 3300026088 | Ga0207641_10009583 | Ga0207641_100095836 | 183 |
| 386 | 3300026088 | Ga0207641_10044221 | Ga0207641_100442213 | 183 |
| 387 | 3300026095 | Ga0207676_10008126 | Ga0207676_100081263 | 183 |
| 388 | 3300026095 | Ga0207676_10027950 | Ga0207676_100279505 | 183 |
| 389 | 3300026116 | Ga0207674_10001717 | Ga0207674_1000171716 | 183 |
| 390 | 3300026116 | Ga0207674_10017454 | Ga0207674_100174544 | 183 |
| 391 | 3300026121 | Ga0207683_10223919 | Ga0207683_102239191 | 183 |
| 392 | 3300028381 | Ga0268264_10010763 | Ga0268264_100107634 | 183 |
| 393 | 3300028381 | Ga0268264_10358872 | Ga0268264_103588722 | 183 |
| 394 | 3300035083 | Ga0373926_0075975 | Ga0373926_0075975_614_1165 | 183 |
| 395 | 3300035113 | Ga0373936_0089531 | Ga0373936_0089531_63_614 | 183 |
| 396 | 3300035171 | Ga0373946_0268737 | Ga0373946_0268737_107_658 | 183 |
| 397 | 3300035692 | Ga0373935_0345880 | Ga0373935_0345880_180_731 | 183 |
| 398 | 3300035692 | Ga0373935_0493896 | Ga0373935_0493896_165_716 | 183 |
| 399 | 3300035725 | Ga0373947_0008139 | Ga0373947_0008139_4406_4957 | 183 |
| 400 | 3300036401 | Ga0373937_0027871 | Ga0373937_0027871_1831_2382 | 183 |
| 401 | 3300037068 | Ga0373925_0009291 | Ga0373925_0009291_1677_2228 | 183 |
| 402 | 3300037068 | Ga0373925_0458443 | Ga0373925_0458443_268_819 | 183 |
| 403 | 3300037853 | Ga0436364_0752377 | Ga0436364_0752377_2128_2679 | 183 |
| 404 | 3300039450 | Ga0436363_1146649 | Ga0436363_1146649_1413_1964 | 183 |
| 405 | 3300045051 | Ga0451576_0163768 | Ga0451576_0163768_1316_1867 | 183 |
| 406 | 3300046459 | Ga0495629_0646771 | Ga0495629_0646771_63_614 | 183 |
| 407 | 3300046463 | Ga0495653_0451034 | Ga0495653_0451034_172_723 | 183 |
| 408 | 3300046472 | Ga0495580_0010703 | Ga0495580_0010703_2727_3278 | 183 |
| 409 | 3300046472 | Ga0495580_0018662 | Ga0495580_0018662_3448_3999 | 183 |
| 410 | 3300046473 | Ga0495582_0270407 | Ga0495582_0270407_329_880 | 183 |
| 411 | 3300046477 | Ga0495664_0148143 | Ga0495664_0148143_819_1370 | 183 |
| 412 | 3300046517 | Ga0495630_0005812 | Ga0495630_0005812_7957_8508 | 183 |
| 413 | 3300046517 | Ga0495630_0783335 | Ga0495630_0783335_55_606 | 183 |
| 414 | 3300046674 | Ga0495588_0234441 | Ga0495588_0234441_368_919 | 183 |
| 415 | 3300046689 | Ga0495613_0222418 | Ga0495613_0222418_568_1119 | 183 |
| 416 | 3300047319 | Ga0495674_0032150 | Ga0495674_0032150_399_950 | 183 |
| 417 | 3300047319 | Ga0495674_0672515 | Ga0495674_0672515_106_657 | 183 |
| 418 | 3300048088 | Ga0495602_0023682 | Ga0495602_0023682_4702_5253 | 183 |
| 419 | 3300048905 | Ga0496102_0028242 | Ga0496102_0028242_287_838 | 183 |
| 420 | 3300048907 | Ga0496104_0444877 | Ga0496104_0444877_569_1120 | 183 |
| 421 | 3300048908 | Ga0496105_0062549 | Ga0496105_0062549_67_618 | 183 |
| 422 | 3300048909 | Ga0496106_0656772 | Ga0496106_0656772_120_671 | 183 |
| 423 | 3300048912 | Ga0496109_1000366 | Ga0496109_1000366_198_749 | 183 |
| 424 | 3300048913 | Ga0496110_0486459 | Ga0496110_0486459_27_578 | 183 |
| 425 | 3300048915 | Ga0496112_0039024 | Ga0496112_0039024_1849_2400 | 183 |
| 426 | 3300048915 | Ga0496112_0059711 | Ga0496112_0059711_2484_3035 | 183 |
| 427 | 3300048916 | Ga0496113_0614955 | Ga0496113_0614955_178_729 | 183 |
| 428 | 3300048917 | Ga0496114_0666614 | Ga0496114_0666614_165_716 | 183 |
| 429 | 3300050490 | nmdc:mga03n38_432848_c1 | nmdc:mga03n38_432848_c1_14_568 | 183 |
| 430 | 3300050512 | nmdc:mga0n895_9096_c1 | nmdc:mga0n895_9096_c1_7271_7822 | 183 |
| 431 | 3300050513 | nmdc:mga0rr50_1537_c2 | nmdc:mga0rr50_1537_c2_1689_2240 | 183 |
| 432 | 3300050513 | nmdc:mga0rr50_98449_c1 | nmdc:mga0rr50_98449_c1_143_694 | 183 |
| 433 | 3300050514 | nmdc:mga08x19_145153_c1 | nmdc:mga08x19_145153_c1_13_564 | 183 |
| 434 | 3300050515 | nmdc:mga0a205_546156_c1 | nmdc:mga0a205_546156_c1_90_641 | 183 |
| 435 | 3300050515 | nmdc:mga0a205_987839_c1 | nmdc:mga0a205_987839_c1_37_588 | 183 |
| 436 | 3300005330 | Ga0070690_100334252 | Ga0070690_1003342522 | 184 |
| 437 | 3300005334 | Ga0068869_100004390 | Ga0068869_1000043905 | 184 |
| 438 | 3300005338 | Ga0068868_100016727 | Ga0068868_1000167272 | 184 |
| 439 | 3300005340 | Ga0070689_100243635 | Ga0070689_1002436353 | 184 |
| 440 | 3300005365 | Ga0070688_100229152 | Ga0070688_1002291522 | 184 |
| 441 | 3300005466 | Ga0070685_10130440 | Ga0070685_101304401 | 184 |
| 442 | 3300005539 | Ga0068853_100100252 | Ga0068853_1001002522 | 184 |
| 443 | 3300005543 | Ga0070672_100115267 | Ga0070672_1001152672 | 184 |
| 444 | 3300005544 | Ga0070686_100191471 | Ga0070686_1001914711 | 184 |
| 445 | 3300005548 | Ga0070665_100189978 | Ga0070665_1001899782 | 184 |
| 446 | 3300005578 | Ga0068854_100390366 | Ga0068854_1003903661 | 184 |
| 447 | 3300005616 | Ga0068852_100699227 | Ga0068852_1006992272 | 184 |
| 448 | 3300005841 | Ga0068863_100889674 | Ga0068863_1008896741 | 184 |
| 449 | 3300005842 | Ga0068858_100000401 | Ga0068858_10000040128 | 184 |
| 450 | 3300005843 | Ga0068860_100017308 | Ga0068860_1000173085 | 184 |
| 451 | 3300006358 | Ga0068871_100766549 | Ga0068871_1007665491 | 184 |
| 452 | 3300006881 | Ga0068865_100036240 | Ga0068865_1000362402 | 184 |
| 453 | 3300009098 | Ga0105245_10721425 | Ga0105245_107214252 | 184 |
| 454 | 3300009176 | Ga0105242_10609766 | Ga0105242_106097661 | 184 |
| 455 | 3300009177 | Ga0105248_10067166 | Ga0105248_100671662 | 184 |
| 456 | 3300009545 | Ga0105237_10023243 | Ga0105237_100232432 | 184 |
| 457 | 3300010375 | Ga0105239_10039578 | Ga0105239_100395781 | 184 |
| 458 | 3300013306 | Ga0163162_10221418 | Ga0163162_102214182 | 184 |
| 459 | 3300013308 | Ga0157375_10108020 | Ga0157375_101080202 | 184 |
| 460 | 3300014326 | Ga0157380_10813713 | Ga0157380_108137131 | 184 |
| 461 | 3300014745 | Ga0157377_10262146 | Ga0157377_102621462 | 184 |
| 462 | 3300014968 | Ga0157379_10017143 | Ga0157379_100171435 | 184 |
| 463 | 3300014969 | Ga0157376_10137091 | Ga0157376_101370912 | 184 |
| 464 | 3300025901 | Ga0207688_10122497 | Ga0207688_101224971 | 184 |
| 465 | 3300025904 | Ga0207647_10002192 | Ga0207647_100021927 | 184 |
| 466 | 3300025916 | Ga0207663_10040025 | Ga0207663_100400253 | 184 |
| 467 | 3300025927 | Ga0207687_10636465 | Ga0207687_106364652 | 184 |
| 468 | 3300025934 | Ga0207686_10905940 | Ga0207686_109059401 | 184 |
| 469 | 3300025938 | Ga0207704_10009335 | Ga0207704_100093352 | 184 |
| 470 | 3300025940 | Ga0207691_10242578 | Ga0207691_102425781 | 184 |
| 471 | 3300025941 | Ga0207711_10049454 | Ga0207711_100494544 | 184 |
| 472 | 3300025942 | Ga0207689_10006870 | Ga0207689_100068706 | 184 |
| 473 | 3300025981 | Ga0207640_10206139 | Ga0207640_102061391 | 184 |
| 474 | 3300026023 | Ga0207677_10161889 | Ga0207677_101618892 | 184 |
| 475 | 3300026035 | Ga0207703_10005593 | Ga0207703_100055939 | 184 |
| 476 | 3300026089 | Ga0207648_10033463 | Ga0207648_100334634 | 184 |
| 477 | 3300026142 | Ga0207698_10676997 | Ga0207698_106769972 | 184 |
| 478 | 3300028379 | Ga0268266_10273725 | Ga0268266_102737252 | 184 |
| 479 | 3300028380 | Ga0268265_10525337 | Ga0268265_105253372 | 184 |
| 480 | 3300028381 | Ga0268264_10039245 | Ga0268264_100392452 | 184 |
| 481 | 3300028800 | Ga0265338_10204237 | Ga0265338_102042371 | 184 |
| 482 | 3300035083 | Ga0373926_0221778 | Ga0373926_0221778_43_597 | 184 |
| 483 | 3300035692 | Ga0373935_0476212 | Ga0373935_0476212_92_646 | 184 |
| 484 | 3300037068 | Ga0373925_0036133 | Ga0373925_0036133_1300_1854 | 184 |
| 485 | 3300046472 | Ga0495580_0049522 | Ga0495580_0049522_604_1158 | 184 |
| 486 | 3300048905 | Ga0496102_0374412 | Ga0496102_0374412_222_776 | 184 |
| 487 | 3300048913 | Ga0496110_0224667 | Ga0496110_0224667_425_979 | 184 |
| 488 | 3300048915 | Ga0496112_0000572 | Ga0496112_0000572_4134_4688 | 184 |
| 489 | 3300005439 | Ga0070711_100003906 | Ga0070711_1000039062 | 185 |
| 490 | 3300006163 | Ga0070715_10003382 | Ga0070715_100033826 | 185 |
| 491 | 3300006173 | Ga0070716_100000138 | Ga0070716_10000013814 | 185 |
| 492 | 3300006175 | Ga0070712_100000854 | Ga0070712_10000085416 | 185 |
| 493 | 3300006175 | Ga0070712_100001206 | Ga0070712_1000012062 | 185 |
| 494 | 3300025898 | Ga0207692_10015594 | Ga0207692_100155941 | 185 |
| 495 | 3300025905 | Ga0207685_10020401 | Ga0207685_100204012 | 185 |
| 496 | 3300025906 | Ga0207699_10017551 | Ga0207699_100175512 | 185 |
| 497 | 3300025915 | Ga0207693_10001705 | Ga0207693_100017052 | 185 |
| 498 | 3300025915 | Ga0207693_10034013 | Ga0207693_100340135 | 185 |
| 499 | 3300025916 | Ga0207663_10015278 | Ga0207663_100152786 | 185 |
| 500 | 3300025916 | Ga0207663_10053294 | Ga0207663_100532941 | 185 |
| 501 | 3300025939 | Ga0207665_10000187 | Ga0207665_1000018723 | 185 |
| 502 | 3300046472 | Ga0495580_0001485 | Ga0495580_0001485_10149_10706 | 185 |
| 503 | 3300049744 | Ga0501083_0082223 | Ga0501083_0082223_1532_2089 | 185 |
| 504 | 3300002076 | JGI24749J21850_1031188 | JGI24749J21850_10311882 | 186 |
| 505 | 3300002459 | JGI24751J29686_10000639 | JGI24751J29686_100006392 | 186 |
| 506 | 3300005293 | Ga0065715_10101024 | Ga0065715_101010242 | 186 |
| 507 | 3300005295 | Ga0065707_10317398 | Ga0065707_103173981 | 186 |
| 508 | 3300005327 | Ga0070658_10083116 | Ga0070658_100831162 | 186 |
| 509 | 3300005328 | Ga0070676_10025162 | Ga0070676_100251623 | 186 |
| 510 | 3300005329 | Ga0070683_100049423 | Ga0070683_1000494233 | 186 |
| 511 | 3300005330 | Ga0070690_100077086 | Ga0070690_1000770862 | 186 |
| 512 | 3300005331 | Ga0070670_100021244 | Ga0070670_1000212443 | 186 |
| 513 | 3300005334 | Ga0068869_100071961 | Ga0068869_1000719613 | 186 |
| 514 | 3300005337 | Ga0070682_100025959 | Ga0070682_1000259594 | 186 |
| 515 | 3300005339 | Ga0070660_100180944 | Ga0070660_1001809442 | 186 |
| 516 | 3300005340 | Ga0070689_100046712 | Ga0070689_1000467123 | 186 |
| 517 | 3300005343 | Ga0070687_100037647 | Ga0070687_1000376472 | 186 |
| 518 | 3300005344 | Ga0070661_100005344 | Ga0070661_1000053443 | 186 |
| 519 | 3300005347 | Ga0070668_100003459 | Ga0070668_1000034598 | 186 |
| 520 | 3300005353 | Ga0070669_100163854 | Ga0070669_1001638541 | 186 |
| 521 | 3300005356 | Ga0070674_100011032 | Ga0070674_1000110327 | 186 |
| 522 | 3300005365 | Ga0070688_100020259 | Ga0070688_1000202594 | 186 |
| 523 | 3300005366 | Ga0070659_100001874 | Ga0070659_1000018745 | 186 |
| 524 | 3300005367 | Ga0070667_100118694 | Ga0070667_1001186941 | 186 |
| 525 | 3300005435 | Ga0070714_100190622 | Ga0070714_1001906221 | 186 |
| 526 | 3300005436 | Ga0070713_100843497 | Ga0070713_1008434971 | 186 |
| 527 | 3300005438 | Ga0070701_10421555 | Ga0070701_104215551 | 186 |
| 528 | 3300005455 | Ga0070663_100015826 | Ga0070663_1000158262 | 186 |
| 529 | 3300005456 | Ga0070678_100017852 | Ga0070678_1000178524 | 186 |
| 530 | 3300005459 | Ga0068867_100029969 | Ga0068867_1000299691 | 186 |
| 531 | 3300005466 | Ga0070685_10000700 | Ga0070685_1000070014 | 186 |
| 532 | 3300005535 | Ga0070684_100050608 | Ga0070684_1000506082 | 186 |
| 533 | 3300005539 | Ga0068853_100003881 | Ga0068853_1000038819 | 186 |
| 534 | 3300005543 | Ga0070672_100012268 | Ga0070672_1000122683 | 186 |
| 535 | 3300005544 | Ga0070686_100003013 | Ga0070686_1000030135 | 186 |
| 536 | 3300005564 | Ga0070664_100950410 | Ga0070664_1009504102 | 186 |
| 537 | 3300005577 | Ga0068857_100003038 | Ga0068857_10000303814 | 186 |
| 538 | 3300005614 | Ga0068856_100009151 | Ga0068856_1000091514 | 186 |
| 539 | 3300005616 | Ga0068852_100032793 | Ga0068852_1000327934 | 186 |
| 540 | 3300005617 | Ga0068859_100132900 | Ga0068859_1001329003 | 186 |
| 541 | 3300005618 | Ga0068864_100067466 | Ga0068864_1000674663 | 186 |
| 542 | 3300005718 | Ga0068866_10000452 | Ga0068866_1000045213 | 186 |
| 543 | 3300005719 | Ga0068861_100031294 | Ga0068861_1000312943 | 186 |
| 544 | 3300005840 | Ga0068870_10002694 | Ga0068870_100026948 | 186 |
| 545 | 3300005842 | Ga0068858_100018183 | Ga0068858_1000181832 | 186 |
| 546 | 3300005843 | Ga0068860_100119468 | Ga0068860_1001194682 | 186 |
| 547 | 3300005843 | Ga0068860_100192819 | Ga0068860_1001928192 | 186 |
| 548 | 3300005844 | Ga0068862_100099717 | Ga0068862_1000997174 | 186 |
| 549 | 3300005983 | Ga0081540_1118985 | Ga0081540_11189852 | 186 |
| 550 | 3300006028 | Ga0070717_10472680 | Ga0070717_104726801 | 186 |
| 551 | 3300006173 | Ga0070716_100174340 | Ga0070716_1001743402 | 186 |
| 552 | 3300006880 | Ga0075429_101000398 | Ga0075429_1010003981 | 186 |
| 553 | 3300006881 | Ga0068865_100022980 | Ga0068865_1000229802 | 186 |
| 554 | 3300006931 | Ga0097620_100132911 | Ga0097620_1001329113 | 186 |
| 555 | 3300009094 | Ga0111539_11159947 | Ga0111539_111599471 | 186 |
| 556 | 3300009094 | Ga0111539_11418152 | Ga0111539_114181521 | 186 |
| 557 | 3300009098 | Ga0105245_10019131 | Ga0105245_100191311 | 186 |
| 558 | 3300009101 | Ga0105247_10072287 | Ga0105247_100722872 | 186 |
| 559 | 3300009174 | Ga0105241_10022255 | Ga0105241_100222554 | 186 |
| 560 | 3300009176 | Ga0105242_10007671 | Ga0105242_100076716 | 186 |
| 561 | 3300009545 | Ga0105237_10105265 | Ga0105237_101052653 | 186 |
| 562 | 3300009551 | Ga0105238_10265341 | Ga0105238_102653413 | 186 |
| 563 | 3300009553 | Ga0105249_10011435 | Ga0105249_100114355 | 186 |
| 564 | 3300009553 | Ga0105249_11088121 | Ga0105249_110881211 | 186 |
| 565 | 3300010375 | Ga0105239_10078560 | Ga0105239_100785604 | 186 |
| 566 | 3300011119 | Ga0105246_10281543 | Ga0105246_102815431 | 186 |
| 567 | 3300013100 | Ga0157373_10002653 | Ga0157373_100026535 | 186 |
| 568 | 3300013105 | Ga0157369_10146773 | Ga0157369_101467731 | 186 |
| 569 | 3300013297 | Ga0157378_10071976 | Ga0157378_100719762 | 186 |
| 570 | 3300013307 | Ga0157372_10033586 | Ga0157372_100335865 | 186 |
| 571 | 3300013308 | Ga0157375_10005888 | Ga0157375_100058889 | 186 |
| 572 | 3300014325 | Ga0163163_10000593 | Ga0163163_1000059326 | 186 |
| 573 | 3300014325 | Ga0163163_11130300 | Ga0163163_111303001 | 186 |
| 574 | 3300014745 | Ga0157377_10004015 | Ga0157377_100040155 | 186 |
| 575 | 3300014968 | Ga0157379_10023370 | Ga0157379_100233702 | 186 |
| 576 | 3300014968 | Ga0157379_10629160 | Ga0157379_106291601 | 186 |
| 577 | 3300014969 | Ga0157376_10005719 | Ga0157376_100057192 | 186 |
| 578 | 3300014969 | Ga0157376_10222717 | Ga0157376_102227172 | 186 |
| 579 | 3300017792 | Ga0163161_10010869 | Ga0163161_100108695 | 186 |
| 580 | 3300025315 | Ga0207697_10003082 | Ga0207697_100030824 | 186 |
| 581 | 3300025899 | Ga0207642_10001789 | Ga0207642_100017892 | 186 |
| 582 | 3300025901 | Ga0207688_10003396 | Ga0207688_100033962 | 186 |
| 583 | 3300025904 | Ga0207647_10006891 | Ga0207647_100068915 | 186 |
| 584 | 3300025907 | Ga0207645_10000054 | Ga0207645_1000005444 | 186 |
| 585 | 3300025908 | Ga0207643_10000357 | Ga0207643_100003574 | 186 |
| 586 | 3300025915 | Ga0207693_10565731 | Ga0207693_105657312 | 186 |
| 587 | 3300025918 | Ga0207662_10000665 | Ga0207662_1000066512 | 186 |
| 588 | 3300025919 | Ga0207657_10000255 | Ga0207657_1000025545 | 186 |
| 589 | 3300025920 | Ga0207649_10000195 | Ga0207649_1000019536 | 186 |
| 590 | 3300025925 | Ga0207650_10000042 | Ga0207650_10000042106 | 186 |
| 591 | 3300025926 | Ga0207659_10058271 | Ga0207659_100582711 | 186 |
| 592 | 3300025927 | Ga0207687_10018575 | Ga0207687_100185752 | 186 |
| 593 | 3300025928 | Ga0207700_10029295 | Ga0207700_100292953 | 186 |
| 594 | 3300025929 | Ga0207664_10065041 | Ga0207664_100650414 | 186 |
| 595 | 3300025931 | Ga0207644_10010266 | Ga0207644_100102663 | 186 |
| 596 | 3300025933 | Ga0207706_10000945 | Ga0207706_1000094527 | 186 |
| 597 | 3300025934 | Ga0207686_10167722 | Ga0207686_101677222 | 186 |
| 598 | 3300025936 | Ga0207670_10024052 | Ga0207670_100240522 | 186 |
| 599 | 3300025937 | Ga0207669_10010463 | Ga0207669_100104634 | 186 |
| 600 | 3300025940 | Ga0207691_10000051 | Ga0207691_1000005131 | 186 |
| 601 | 3300025941 | Ga0207711_10029474 | Ga0207711_100294744 | 186 |
| 602 | 3300025942 | Ga0207689_10000325 | Ga0207689_100003259 | 186 |
| 603 | 3300025944 | Ga0207661_10000084 | Ga0207661_1000008412 | 186 |
| 604 | 3300025945 | Ga0207679_10000050 | Ga0207679_1000005013 | 186 |
| 605 | 3300025960 | Ga0207651_10007772 | Ga0207651_100077724 | 186 |
| 606 | 3300025961 | Ga0207712_10095560 | Ga0207712_100955602 | 186 |
| 607 | 3300025972 | Ga0207668_10021597 | Ga0207668_100215973 | 186 |
| 608 | 3300025986 | Ga0207658_10012280 | Ga0207658_100122804 | 186 |
| 609 | 3300026023 | Ga0207677_10270779 | Ga0207677_102707792 | 186 |
| 610 | 3300026035 | Ga0207703_10052693 | Ga0207703_100526933 | 186 |
| 611 | 3300026067 | Ga0207678_10000023 | Ga0207678_1000002326 | 186 |
| 612 | 3300026078 | Ga0207702_10858700 | Ga0207702_108587001 | 186 |
| 613 | 3300026088 | Ga0207641_10000059 | Ga0207641_1000005964 | 186 |
| 614 | 3300026088 | Ga0207641_10053949 | Ga0207641_100539492 | 186 |
| 615 | 3300026089 | Ga0207648_10000041 | Ga0207648_1000004116 | 186 |
| 616 | 3300026095 | Ga0207676_10000080 | Ga0207676_1000008064 | 186 |
| 617 | 3300026116 | Ga0207674_10000047 | Ga0207674_1000004737 | 186 |
| 618 | 3300026118 | Ga0207675_100007292 | Ga0207675_1000072925 | 186 |
| 619 | 3300026121 | Ga0207683_10000017 | Ga0207683_1000001731 | 186 |
| 620 | 3300026142 | Ga0207698_10176934 | Ga0207698_101769341 | 186 |
| 621 | 3300028379 | Ga0268266_10002321 | Ga0268266_100023219 | 186 |
| 622 | 3300028380 | Ga0268265_10008423 | Ga0268265_100084233 | 186 |
| 623 | 3300028381 | Ga0268264_10018155 | Ga0268264_100181553 | 186 |
| 624 | 3300046684 | Ga0495669_0172841 | Ga0495669_0172841_68_628 | 186 |
| 625 | 3300048905 | Ga0496102_0028521 | Ga0496102_0028521_3316_3876 | 186 |
| 626 | 3300048908 | Ga0496105_0065836 | Ga0496105_0065836_427_987 | 186 |
| 627 | 3300048909 | Ga0496106_0492577 | Ga0496106_0492577_293_853 | 186 |
| 628 | 3300048910 | Ga0496107_0241591 | Ga0496107_0241591_643_1203 | 186 |
| 629 | 3300048911 | Ga0496108_0007842 | Ga0496108_0007842_5164_5724 | 186 |
| 630 | 3300048912 | Ga0496109_0000122 | Ga0496109_0000122_4635_5195 | 186 |
| 631 | 3300048913 | Ga0496110_0004464 | Ga0496110_0004464_3108_3668 | 186 |
| 632 | 3300048914 | Ga0496111_0005613 | Ga0496111_0005613_2961_3521 | 186 |
| 633 | 3300048915 | Ga0496112_0000027 | Ga0496112_0000027_42537_43097 | 186 |
| 634 | 3300048916 | Ga0496113_0003205 | Ga0496113_0003205_3639_4199 | 186 |
| 635 | 3300048917 | Ga0496114_0353963 | Ga0496114_0353963_505_1065 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mt2-assembly1.cif.gz_B | crystal structure of inorganic pyrophosphatase from medicago truncatula (i23 crystal form) | 0.9238 | 1 | 177 |
| 5ls0-assembly2.cif.gz_B | crystal structure of inorganic pyrophosphatase ppa1 from arabidopsis thaliana | 0.9198 | 1 | 173 |
| 1ude-assembly1.cif.gz_C-2 | crystal structure of the inorganic pyrophosphatase from the hyperthermophilic archaeon pyrococcus horikoshii ot3 | 0.9193 | 6 | 171 |
| 1twl-assembly1.cif.gz_A | inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 | 0.919 | 4 | 174 |
| 6mt2-assembly2.cif.gz_D | crystal structure of inorganic pyrophosphatase from medicago truncatula (i23 crystal form) | 0.9163 | 2 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9358 | 17 | 176 | 3.90.80.10 |
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9193 | 17 | 176 | 3.90.80.10 |
| af_A0A0R0EZ04_29_196_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.914 | 1 | 166 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9086 | 2 | 175 | 3.90.80.10 |
| 2prdA00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9086 | 5 | 172 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J7NR96-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9547 | 79 | 166 |
GO:0000287
GO:0003700 GO:0004427 GO:0005634 GO:0005737 GO:0006796 GO:0016740 GO:0043565 |
| AF-A0A5J5A4I9-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9463 | 73 | 177 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A834GV20-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9445 | 3 | 178 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A803LWU5-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9435 | 3 | 177 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A078H1Z4-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9424 | 3 | 177 |
GO:0000287
GO:0004427 GO:0005829 GO:0006796 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar