F471269

General Info

Members Datasets Scaffolds Average Seq Length
635 284 621 183

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10074122|Ga0307513_100741223
Length 194
Sequence MIGGLFYLFLRAKRTLMVKHPWHEVSIGDNPPEHVNGIIEIPKGSRAKYEIDKDSGLIKLDRVLYASMYYPLNYGFIPQTLGEDHDPLDIVVLTQVTVVPRCLIPSKVIGVMRMIDRGEADDKIIAVAEQDVSVSHINDVDQLPEYFRMELKHFFENYKTLENKKVVVDEFESKAKAMEIIQQSIEFYKKTYPK

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2739367651 Pedobacter sp. OK291 Isolate Unclassified
4 2739367656 Pedobacter sp. CF523 Isolate Unclassified
5 2739367663 Pedobacter sp. YR510 Isolate Unclassified
6 2818991437 Pedobacter terrae 518 Isolate Unclassified
7 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
10 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
11 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
12 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
13 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
14 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
264 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0.16
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 4.09
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1031188 3300002076 Bacteria 765
2 JGI24751J29686_10000639 3300002459 Bacteria 8942
3 JGI25150J39212_1000004 3300002774 Bacteria 417320
4 JGI25151J46595_10000002 3300003187 Bacteria 731381
5 JGI25153J46596_10000037 3300003215 Bacteria 182199
6 rootL2_10147111 3300003322 Bacteria 14666
7 rootH1_10286969 3300003323 Bacteria 2767
8 Ga0055530_10000821 3300003791 Bacteria 25754
9 Ga0065715_10101024 3300005293 Bacteria 3245
10 Ga0065707_10096444 3300005295 Bacteria 3268
11 Ga0065707_10317398 3300005295 Bacteria 973
12 Ga0070658_10025188 3300005327 Bacteria 4768
13 Ga0070658_10083116 3300005327 Bacteria 2632
14 Ga0070676_10025162 3300005328 Bacteria 3362
15 Ga0070683_100033131 3300005329 Bacteria 4709
16 Ga0070683_100049423 3300005329 Bacteria 3890
17 Ga0070683_100160096 3300005329 Bacteria 2136
18 Ga0070683_100316229 3300005329 Bacteria 1486
19 Ga0070683_100380014 3300005329 Bacteria 1346
20 Ga0070690_100077086 3300005330 Bacteria 2175
21 Ga0070690_100334252 3300005330 Bacteria 1095
22 Ga0070670_100003099 3300005331 Bacteria 13755
23 Ga0070670_100021244 3300005331 Bacteria 5585
24 Ga0070670_100260357 3300005331 Bacteria 1512
25 Ga0068869_100004390 3300005334 Bacteria 8760
26 Ga0068869_100022398 3300005334 Bacteria 4354
27 Ga0068869_100071961 3300005334 Bacteria 2561
28 Ga0070682_100025959 3300005337 Bacteria 3500
29 Ga0070682_101033622 3300005337 Bacteria 684
30 Ga0068868_100006594 3300005338 Bacteria 8228
31 Ga0068868_100016727 3300005338 Bacteria 5454
32 Ga0068868_100069462 3300005338 Bacteria 2807
33 Ga0068868_100612732 3300005338 Bacteria 966
34 Ga0070660_100180944 3300005339 Bacteria 1706
35 Ga0070689_100046712 3300005340 Bacteria 3337
36 Ga0070689_100243635 3300005340 Bacteria 1481
37 Ga0070687_100037647 3300005343 Bacteria 2419
38 Ga0070661_100005344 3300005344 Bacteria 8860
39 Ga0070661_100010101 3300005344 Bacteria 6557
40 Ga0070661_100278810 3300005344 Unclassified 1296
41 Ga0070668_100003459 3300005347 Bacteria 11658
42 Ga0070669_100163854 3300005353 Bacteria 1729
43 Ga0070675_100168493 3300005354 Bacteria 1888
44 Ga0070675_100985457 3300005354 Bacteria 774
45 Ga0070671_100021299 3300005355 Bacteria 5296
46 Ga0070671_100042095 3300005355 Bacteria 3797
47 Ga0070671_100190928 3300005355 Bacteria 1736
48 Ga0070674_100011032 3300005356 Bacteria 5482
49 Ga0070674_100072261 3300005356 Bacteria 2442
50 Ga0070674_101012338 3300005356 Bacteria 729
51 Ga0070673_100032379 3300005364 Bacteria 3936
52 Ga0070673_100096308 3300005364 Bacteria 2428
53 Ga0070673_100990811 3300005364 Bacteria 782
54 Ga0070688_100020259 3300005365 Bacteria 3865
55 Ga0070688_100229152 3300005365 Bacteria 1313
56 Ga0070659_100001874 3300005366 Bacteria 15069
57 Ga0070667_100118694 3300005367 Bacteria 2299
58 Ga0070709_10007779 3300005434 Bacteria 5885
59 Ga0070709_10128175 3300005434 Bacteria 1729
60 Ga0070714_100020154 3300005435 Bacteria 5442
61 Ga0070714_100047876 3300005435 Bacteria 3634
62 Ga0070714_100061534 3300005435 Bacteria 3225
63 Ga0070714_100137789 3300005435 Bacteria 2187
64 Ga0070714_100190622 3300005435 Bacteria 1870
65 Ga0070714_100705905 3300005435 Bacteria 973
66 Ga0070713_100006935 3300005436 Bacteria 7908
67 Ga0070713_100021071 3300005436 Bacteria 5006
68 Ga0070713_100085430 3300005436 Bacteria 2703
69 Ga0070713_100622596 3300005436 Bacteria 1026
70 Ga0070713_100843497 3300005436 Unclassified 880
71 Ga0070710_10016059 3300005437 Unclassified 3802
72 Ga0070710_10028225 3300005437 Bacteria 3000
73 Ga0070701_10421555 3300005438 Bacteria 850
74 Ga0070711_100003906 3300005439 Bacteria 8750
75 Ga0070711_100010563 3300005439 Bacteria 5717
76 Ga0070711_100187225 3300005439 Bacteria 1588
77 Ga0070711_100346771 3300005439 Bacteria 1193
78 Ga0070711_100414670 3300005439 Bacteria 1096
79 Ga0070708_100007922 3300005445 Bacteria 8508
80 Ga0070663_100015826 3300005455 Bacteria 4880
81 Ga0070678_100017852 3300005456 Bacteria 4581
82 Ga0070681_10000672 3300005458 Bacteria 28308
83 Ga0070681_10002267 3300005458 Bacteria 17569
84 Ga0068867_100029969 3300005459 Bacteria 3923
85 Ga0070685_10000700 3300005466 Bacteria 18186
86 Ga0070685_10130440 3300005466 Bacteria 1571
87 Ga0070706_100697755 3300005467 Bacteria 941
88 Ga0070698_100700604 3300005471 Bacteria 955
89 Ga0070679_100007996 3300005530 Bacteria 9929
90 Ga0070679_101051070 3300005530 Bacteria 759
91 Ga0070684_100050608 3300005535 Bacteria 3609
92 Ga0070684_100433637 3300005535 Bacteria 1214
93 Ga0068853_100003881 3300005539 Bacteria 11456
94 Ga0068853_100041435 3300005539 Bacteria 3933
95 Ga0068853_100100252 3300005539 Bacteria 2560
96 Ga0068853_100163119 3300005539 Unclassified 2012
97 Ga0068853_100242010 3300005539 Bacteria 1654
98 Ga0068853_100351130 3300005539 Bacteria 1372
99 Ga0068853_100464952 3300005539 Bacteria 1191
100 Ga0070672_100012268 3300005543 Bacteria 6007
101 Ga0070672_100076519 3300005543 Bacteria 2673
102 Ga0070672_100115267 3300005543 Bacteria 2194
103 Ga0070686_100003013 3300005544 Bacteria 9232
104 Ga0070686_100191471 3300005544 Bacteria 1460
105 Ga0070693_100030761 3300005547 Unclassified 2938
106 Ga0070693_100037406 3300005547 Unclassified 2706
107 Ga0070693_100043191 3300005547 Unclassified 2545
108 Ga0070665_100189978 3300005548 Bacteria 2055
109 Ga0070665_100203971 3300005548 Bacteria 1978
110 Ga0068855_100003709 3300005563 Bacteria 18674
111 Ga0068855_100008412 3300005563 Bacteria 12480
112 Ga0068855_100045071 3300005563 Bacteria 5216
113 Ga0068855_100142479 3300005563 Bacteria 2730
114 Ga0068855_100878719 3300005563 Bacteria 948
115 Ga0070664_100005991 3300005564 Bacteria 9829
116 Ga0070664_100284808 3300005564 Bacteria 1491
117 Ga0070664_100950410 3300005564 Bacteria 807
118 Ga0068857_100000154 3300005577 Bacteria 42680
119 Ga0068857_100003038 3300005577 Bacteria 13880
120 Ga0068857_100009899 3300005577 Bacteria 8275
121 Ga0068857_100021773 3300005577 Bacteria 5641
122 Ga0068854_100029316 3300005578 Unclassified 3810
123 Ga0068854_100390366 3300005578 Bacteria 1149
124 Ga0068856_100000612 3300005614 Bacteria 39134
125 Ga0068856_100009151 3300005614 Bacteria 9628
126 Ga0068856_100035661 3300005614 Bacteria 4875
127 Ga0068852_100032793 3300005616 Bacteria 4304
128 Ga0068852_100699227 3300005616 Bacteria 1024
129 Ga0068859_100004113 3300005617 Bacteria 14836
130 Ga0068859_100132900 3300005617 Bacteria 2560
131 Ga0068859_101037588 3300005617 Bacteria 901
132 Ga0068864_100009624 3300005618 Bacteria 7972
133 Ga0068864_100046472 3300005618 Unclassified 3725
134 Ga0068864_100067466 3300005618 Bacteria 3106
135 Ga0068864_100433679 3300005618 Bacteria 1254
136 Ga0068866_10000452 3300005718 Bacteria 18811
137 Ga0068861_100031294 3300005719 Bacteria 3908
138 Ga0068861_100368463 3300005719 Unclassified 1265
139 Ga0068851_10022057 3300005834 Bacteria 3098
140 Ga0068870_10002694 3300005840 Bacteria 7443
141 Ga0068863_100016101 3300005841 Bacteria 7172
142 Ga0068863_100017029 3300005841 Bacteria 6970
143 Ga0068863_100889674 3300005841 Bacteria 890
144 Ga0068858_100000401 3300005842 Bacteria 45107
145 Ga0068858_100000491 3300005842 Bacteria 41299
146 Ga0068858_100018183 3300005842 Bacteria 6583
147 Ga0068858_100110342 3300005842 Bacteria 2569
148 Ga0068858_100706494 3300005842 Bacteria 981
149 Ga0068858_100878343 3300005842 Unclassified 876
150 Ga0068860_100017308 3300005843 Bacteria 7023
151 Ga0068860_100027170 3300005843 Bacteria 5514
152 Ga0068860_100119468 3300005843 Bacteria 2523
153 Ga0068860_100192819 3300005843 Bacteria 1972
154 Ga0068860_100517227 3300005843 Bacteria 1193
155 Ga0068862_100099717 3300005844 Bacteria 2539
156 Ga0081540_1118985 3300005983 Bacteria 1100
157 Ga0070717_10008365 3300006028 Bacteria 7727
158 Ga0070717_10015758 3300006028 Bacteria 5843
159 Ga0070717_10020100 3300006028 Bacteria 5248
160 Ga0070717_10143272 3300006028 Bacteria 2063
161 Ga0070717_10472680 3300006028 Unclassified 1131
162 Ga0070717_10620951 3300006028 Unclassified 981
163 Ga0070715_10003382 3300006163 Bacteria 5059
164 Ga0070716_100000138 3300006173 Bacteria 29465
165 Ga0070716_100005555 3300006173 Bacteria 6119
166 Ga0070716_100022019 3300006173 Bacteria 3365
167 Ga0070716_100028494 3300006173 Bacteria 3009
168 Ga0070716_100174340 3300006173 Bacteria 1406
169 Ga0070716_100450975 3300006173 Bacteria 938
170 Ga0070712_100000854 3300006175 Bacteria 18137
171 Ga0070712_100001206 3300006175 Bacteria 15640
172 Ga0070712_100015362 3300006175 Bacteria 4929
173 Ga0070712_100165104 3300006175 Bacteria 1713
174 Ga0097621_100000805 3300006237 Bacteria 22117
175 Ga0097621_100001391 3300006237 Bacteria 16653
176 Ga0097621_100085707 3300006237 Bacteria 2628
177 Ga0097621_100090806 3300006237 Unclassified 2556
178 Ga0097621_100137229 3300006237 Bacteria 2087
179 Ga0068871_100000803 3300006358 Bacteria 21113
180 Ga0068871_100028421 3300006358 Bacteria 4383
181 Ga0068871_100175524 3300006358 Unclassified 1839
182 Ga0068871_100766549 3300006358 Bacteria 888
183 Ga0075428_100735584 3300006844 Unclassified 1050
184 Ga0075431_101254123 3300006847 Bacteria 703
185 Ga0075433_10605088 3300006852 Unclassified 962
186 Ga0075434_100144274 3300006871 Unclassified 2401
187 Ga0075429_101000398 3300006880 Bacteria 731
188 Ga0068865_100004959 3300006881 Bacteria 8050
189 Ga0068865_100009927 3300006881 Bacteria 5916
190 Ga0068865_100022980 3300006881 Bacteria 4076
191 Ga0068865_100036240 3300006881 Bacteria 3324
192 Ga0075436_100121279 3300006914 Bacteria 1829
193 Ga0097620_100004113 3300006931 Bacteria 14836
194 Ga0097620_100132911 3300006931 Bacteria 2560
195 Ga0097620_101037637 3300006931 Bacteria 901
196 Ga0075435_100019604 3300007076 Bacteria 5170
197 Ga0075435_100557700 3300007076 Unclassified 992
198 Ga0105244_10036466 3300009036 Bacteria 2576
199 Ga0105240_10057938 3300009093 Bacteria 4837
200 Ga0105240_10082755 3300009093 Unclassified 3941
201 Ga0105240_10335856 3300009093 Unclassified 1718
202 Ga0111539_10021661 3300009094 Bacteria 7906
203 Ga0111539_10069045 3300009094 Bacteria 4172
204 Ga0111539_10754351 3300009094 Bacteria 1133
205 Ga0111539_11159947 3300009094 Unclassified 898
206 Ga0111539_11418152 3300009094 Bacteria 806
207 Ga0105245_10001141 3300009098 Bacteria 24022
208 Ga0105245_10005753 3300009098 Bacteria 10881
209 Ga0105245_10019131 3300009098 Bacteria 5996
210 Ga0105245_10721425 3300009098 Bacteria 1031
211 Ga0105247_10072287 3300009101 Bacteria 2159
212 Ga0114129_10834176 3300009147 Bacteria 1173
213 Ga0114129_11660514 3300009147 Bacteria 781
214 Ga0105243_12042307 3300009148 Bacteria 608
215 Ga0105241_10022255 3300009174 Bacteria 4693
216 Ga0105241_10045281 3300009174 Bacteria 3337
217 Ga0105241_10052655 3300009174 Unclassified 3109
218 Ga0105241_10657653 3300009174 Bacteria 952
219 Ga0105241_11199696 3300009174 Bacteria 719
220 Ga0105242_10007671 3300009176 Bacteria 8304
221 Ga0105242_10609766 3300009176 Bacteria 1055
222 Ga0105242_11395753 3300009176 Bacteria 728
223 Ga0105248_10001672 3300009177 Bacteria 24677
224 Ga0105248_10067166 3300009177 Bacteria 4025
225 Ga0105248_10070960 3300009177 Bacteria 3911
226 Ga0105237_10023243 3300009545 Bacteria 6354
227 Ga0105237_10045613 3300009545 Bacteria 4410
228 Ga0105237_10070395 3300009545 Unclassified 3494
229 Ga0105237_10105265 3300009545 Bacteria 2812
230 Ga0105237_10706801 3300009545 Bacteria 1014
231 Ga0105238_10000339 3300009551 Bacteria 51013
232 Ga0105238_10099777 3300009551 Unclassified 2886
233 Ga0105238_10140076 3300009551 Bacteria 2396
234 Ga0105238_10265341 3300009551 Bacteria 1697
235 Ga0105249_10011435 3300009553 Bacteria 7796
236 Ga0105249_10155975 3300009553 Bacteria 2202
237 Ga0105249_11088121 3300009553 Bacteria 869
238 Ga0105239_10024001 3300010375 Bacteria 6716
239 Ga0105239_10038911 3300010375 Bacteria 5210
240 Ga0105239_10039578 3300010375 Bacteria 5165
241 Ga0105239_10078560 3300010375 Bacteria 3632
242 Ga0105239_10146124 3300010375 Unclassified 2637
243 Ga0105239_10364274 3300010375 Bacteria 1633
244 Ga0105239_10372081 3300010375 Bacteria 1615
245 Ga0105246_10281543 3300011119 Bacteria 1334
246 Ga0157373_10002653 3300013100 Bacteria 13569
247 Ga0157373_10082741 3300013100 Unclassified 2262
248 Ga0157373_10173368 3300013100 Bacteria 1518
249 Ga0157371_10000027 3300013102 Bacteria 269243
250 Ga0157371_10178806 3300013102 Bacteria 1517
251 Ga0157370_10034394 3300013104 Bacteria 4936
252 Ga0157370_10189244 3300013104 Bacteria 1910
253 Ga0157370_10497644 3300013104 Bacteria 1119
254 Ga0157370_10665610 3300013104 Unclassified 951
255 Ga0157369_10000053 3300013105 Bacteria 162962
256 Ga0157369_10001152 3300013105 Bacteria 33000
257 Ga0157369_10057271 3300013105 Bacteria 4205
258 Ga0157369_10116778 3300013105 Bacteria 2833
259 Ga0157369_10146773 3300013105 Bacteria 2494
260 Ga0157369_10229084 3300013105 Bacteria 1943
261 Ga0157369_10875885 3300013105 Bacteria 921
262 Ga0157374_10000384 3300013296 Bacteria 40618
263 Ga0157374_10001410 3300013296 Bacteria 20395
264 Ga0157374_10018130 3300013296 Bacteria 6209
265 Ga0157374_10092195 3300013296 Bacteria 2890
266 Ga0157378_10000121 3300013297 Bacteria 75263
267 Ga0157378_10000188 3300013297 Bacteria 59526
268 Ga0157378_10001045 3300013297 Bacteria 25293
269 Ga0157378_10043993 3300013297 Bacteria 3964
270 Ga0157378_10071976 3300013297 Bacteria 3105
271 Ga0163162_10000078 3300013306 Bacteria 89842
272 Ga0163162_10221418 3300013306 Bacteria 2022
273 Ga0163162_10494549 3300013306 Bacteria 1354
274 Ga0157372_10002460 3300013307 Bacteria 20067
275 Ga0157372_10002767 3300013307 Bacteria 18959
276 Ga0157372_10008312 3300013307 Bacteria 11035
277 Ga0157372_10013774 3300013307 Bacteria 8641
278 Ga0157372_10017992 3300013307 Bacteria 7594
279 Ga0157372_10033586 3300013307 Bacteria 5637
280 Ga0157372_10056006 3300013307 Bacteria 4405
281 Ga0157372_10069578 3300013307 Bacteria 3958
282 Ga0157372_10116403 3300013307 Bacteria 3065
283 Ga0157372_10154085 3300013307 Unclassified 2654
284 Ga0157372_11127001 3300013307 Bacteria 907
285 Ga0157375_10005888 3300013308 Bacteria 10680
286 Ga0157375_10108020 3300013308 Bacteria 2877
287 Ga0157375_10370205 3300013308 Bacteria 1599
288 Ga0157375_10713036 3300013308 Bacteria 1156
289 Ga0157375_11997537 3300013308 Unclassified 689
290 Ga0163163_10000593 3300014325 Bacteria 31910
291 Ga0163163_11130300 3300014325 Bacteria 846
292 Ga0163163_12194915 3300014325 Bacteria 611
293 Ga0157380_10001491 3300014326 Bacteria 15326
294 Ga0157380_10813713 3300014326 Bacteria 952
295 Ga0157380_11485090 3300014326 Bacteria 730
296 Ga0182008_10000334 3300014497 Bacteria 37000
297 Ga0157377_10004015 3300014745 Bacteria 6711
298 Ga0157377_10262146 3300014745 Bacteria 1125
299 Ga0157379_10017143 3300014968 Bacteria 6378
300 Ga0157379_10023370 3300014968 Bacteria 5485
301 Ga0157379_10629160 3300014968 Bacteria 1003
302 Ga0157379_11467758 3300014968 Bacteria 663
303 Ga0157376_10005719 3300014969 Bacteria 8707
304 Ga0157376_10137091 3300014969 Bacteria 2191
305 Ga0157376_10153764 3300014969 Bacteria 2077
306 Ga0157376_10222717 3300014969 Bacteria 1748
307 Ga0157376_10335836 3300014969 Unclassified 1441
308 Ga0157376_10817788 3300014969 Unclassified 945
309 Ga0182006_1000755 3300015261 Bacteria 22108
310 Ga0182006_1000787 3300015261 Bacteria 21397
311 Ga0182007_10000005 3300015262 Bacteria 442702
312 Ga0183373_1007 3300015682 Bacteria 282776
313 Ga0163161_10010869 3300017792 Bacteria 6310
314 Ga0163161_10043332 3300017792 Bacteria 3240
315 Ga0213872_10148104 3300021361 Bacteria 1027
316 Ga0213875_10041285 3300021388 Bacteria 2171
317 Ga0213871_10021025 3300021441 Bacteria 1623
318 Ga0207425_1000003 3300025245 Bacteria 1145342
319 Ga0209129_1000022 3300025258 Bacteria 440876
320 Ga0209676_1000039 3300025292 Bacteria 443158
321 Ga0209025_1000007 3300025294 Bacteria 1145109
322 Ga0209758_1000012 3300025297 Bacteria 949866
323 Ga0209050_1000033 3300025298 Bacteria 442615
324 Ga0209050_1002956 3300025298 Bacteria 13286
325 Ga0207697_10003082 3300025315 Bacteria 8350
326 Ga0207656_10051872 3300025321 Unclassified 1775
327 Ga0207692_10015594 3300025898 Bacteria 3346
328 Ga0207692_10045754 3300025898 Unclassified 2191
329 Ga0207642_10001789 3300025899 Bacteria 6651
330 Ga0207688_10003396 3300025901 Bacteria 8680
331 Ga0207688_10122497 3300025901 Bacteria 1518
332 Ga0207647_10002192 3300025904 Bacteria 14895
333 Ga0207647_10006891 3300025904 Bacteria 8235
334 Ga0207647_10020875 3300025904 Bacteria 4384
335 Ga0207685_10020401 3300025905 Bacteria 2202
336 Ga0207685_10119552 3300025905 Bacteria 1154
337 Ga0207699_10004717 3300025906 Bacteria 6513
338 Ga0207699_10012372 3300025906 Bacteria 4341
339 Ga0207699_10017551 3300025906 Bacteria 3771
340 Ga0207699_10026207 3300025906 Bacteria 3210
341 Ga0207645_10000054 3300025907 Bacteria 83043
342 Ga0207643_10000357 3300025908 Bacteria 30643
343 Ga0207705_10047799 3300025909 Bacteria 3077
344 Ga0207705_10309307 3300025909 Bacteria 1213
345 Ga0207654_10032858 3300025911 Unclassified 2871
346 Ga0207654_10347732 3300025911 Bacteria 1020
347 Ga0207707_10002233 3300025912 Bacteria 17498
348 Ga0207707_10066332 3300025912 Bacteria 3143
349 Ga0207695_10014898 3300025913 Bacteria 9177
350 Ga0207695_10048448 3300025913 Bacteria 4487
351 Ga0207695_10836382 3300025913 Unclassified 800
352 Ga0207671_10106109 3300025914 Bacteria 2132
353 Ga0207693_10000453 3300025915 Bacteria 37587
354 Ga0207693_10001705 3300025915 Bacteria 19338
355 Ga0207693_10034013 3300025915 Bacteria 4021
356 Ga0207693_10041884 3300025915 Unclassified 3604
357 Ga0207693_10166787 3300025915 Bacteria 1734
358 Ga0207693_10565731 3300025915 Bacteria 886
359 Ga0207663_10015278 3300025916 Bacteria 4232
360 Ga0207663_10040025 3300025916 Bacteria 2845
361 Ga0207663_10053294 3300025916 Unclassified 2527
362 Ga0207663_10153221 3300025916 Bacteria 1619
363 Ga0207663_10157607 3300025916 Bacteria 1599
364 Ga0207663_10323603 3300025916 Bacteria 1159
365 Ga0207662_10000665 3300025918 Bacteria 15604
366 Ga0207662_10152322 3300025918 Unclassified 1471
367 Ga0207657_10000255 3300025919 Bacteria 56523
368 Ga0207657_11171496 3300025919 Bacteria 585
369 Ga0207649_10000195 3300025920 Bacteria 50018
370 Ga0207649_10007569 3300025920 Bacteria 5905
371 Ga0207649_10539946 3300025920 Unclassified 891
372 Ga0207681_10381368 3300025923 Bacteria 1135
373 Ga0207694_10001944 3300025924 Bacteria 17106
374 Ga0207694_10156415 3300025924 Bacteria 1839
375 Ga0207694_10181728 3300025924 Bacteria 1706
376 Ga0207694_10388955 3300025924 Bacteria 1158
377 Ga0207650_10000042 3300025925 Bacteria 191592
378 Ga0207650_10006009 3300025925 Bacteria 8283
379 Ga0207659_10058271 3300025926 Bacteria 2772
380 Ga0207687_10013423 3300025927 Bacteria 5347
381 Ga0207687_10014207 3300025927 Bacteria 5209
382 Ga0207687_10018575 3300025927 Bacteria 4593
383 Ga0207687_10636465 3300025927 Bacteria 901
384 Ga0207700_10004433 3300025928 Bacteria 8279
385 Ga0207700_10004738 3300025928 Bacteria 8068
386 Ga0207700_10029295 3300025928 Bacteria 3883
387 Ga0207700_10158677 3300025928 Bacteria 1876
388 Ga0207700_10234562 3300025928 Bacteria 1561
389 Ga0207664_10002243 3300025929 Bacteria 12723
390 Ga0207664_10028417 3300025929 Bacteria 4249
391 Ga0207664_10034311 3300025929 Bacteria 3907
392 Ga0207664_10065041 3300025929 Bacteria 2919
393 Ga0207664_10078188 3300025929 Bacteria 2683
394 Ga0207664_10287670 3300025929 Bacteria 1444
395 Ga0207664_10341865 3300025929 Bacteria 1323
396 Ga0207664_10477231 3300025929 Bacteria 1115
397 Ga0207644_10010266 3300025931 Bacteria 6170
398 Ga0207644_10091267 3300025931 Bacteria 2271
399 Ga0207644_10416940 3300025931 Bacteria 1099
400 Ga0207690_10229710 3300025932 Bacteria 1424
401 Ga0207690_10512009 3300025932 Bacteria 972
402 Ga0207706_10000945 3300025933 Bacteria 29679
403 Ga0207686_10167722 3300025934 Bacteria 1545
404 Ga0207686_10905940 3300025934 Bacteria 712
405 Ga0207670_10024052 3300025936 Bacteria 3802
406 Ga0207669_10010463 3300025937 Bacteria 4468
407 Ga0207669_10150494 3300025937 Bacteria 1629
408 Ga0207704_10002101 3300025938 Bacteria 8926
409 Ga0207704_10009335 3300025938 Bacteria 4728
410 Ga0207704_10029250 3300025938 Unclassified 3069
411 Ga0207704_10279901 3300025938 Bacteria 1267
412 Ga0207665_10000187 3300025939 Bacteria 41612
413 Ga0207665_10009538 3300025939 Bacteria 6375
414 Ga0207665_10017633 3300025939 Bacteria 4691
415 Ga0207691_10000051 3300025940 Bacteria 94390
416 Ga0207691_10006756 3300025940 Bacteria 11064
417 Ga0207691_10242578 3300025940 Bacteria 1558
418 Ga0207711_10002420 3300025941 Bacteria 16664
419 Ga0207711_10017040 3300025941 Bacteria 6035
420 Ga0207711_10029474 3300025941 Bacteria 4630
421 Ga0207711_10049454 3300025941 Bacteria 3600
422 Ga0207689_10000325 3300025942 Bacteria 44284
423 Ga0207689_10006870 3300025942 Bacteria 10005
424 Ga0207689_10041762 3300025942 Bacteria 3794
425 Ga0207661_10000084 3300025944 Bacteria 65203
426 Ga0207661_10100241 3300025944 Bacteria 2431
427 Ga0207661_10117955 3300025944 Bacteria 2255
428 Ga0207661_10354381 3300025944 Bacteria 1324
429 Ga0207661_10400231 3300025944 Bacteria 1245
430 Ga0207679_10000050 3300025945 Bacteria 112411
431 Ga0207679_10002335 3300025945 Bacteria 11667
432 Ga0207679_10271822 3300025945 Bacteria 1450
433 Ga0207667_10001412 3300025949 Bacteria 30075
434 Ga0207667_10038382 3300025949 Bacteria 5116
435 Ga0207667_10041026 3300025949 Bacteria 4924
436 Ga0207667_10224671 3300025949 Bacteria 1924
437 Ga0207667_10761572 3300025949 Bacteria 967
438 Ga0207651_10007772 3300025960 Bacteria 5732
439 Ga0207651_10059734 3300025960 Bacteria 2643
440 Ga0207651_10353375 3300025960 Unclassified 1238
441 Ga0207712_10095560 3300025961 Bacteria 2198
442 Ga0207668_10021597 3300025972 Bacteria 4107
443 Ga0207640_10206139 3300025981 Bacteria 1494
444 Ga0207640_10597674 3300025981 Bacteria 933
445 Ga0207658_10012280 3300025986 Bacteria 5846
446 Ga0207677_10001997 3300026023 Bacteria 10778
447 Ga0207677_10051364 3300026023 Bacteria 2795
448 Ga0207677_10161889 3300026023 Bacteria 1739
449 Ga0207677_10268022 3300026023 Bacteria 1395
450 Ga0207677_10270779 3300026023 Bacteria 1389
451 Ga0207703_10005593 3300026035 Bacteria 10089
452 Ga0207703_10032290 3300026035 Bacteria 4143
453 Ga0207703_10052693 3300026035 Bacteria 3305
454 Ga0207703_10102661 3300026035 Bacteria 2426
455 Ga0207703_10670737 3300026035 Bacteria 985
456 Ga0207703_11661683 3300026035 Bacteria 614
457 Ga0207639_10477597 3300026041 Bacteria 1136
458 Ga0207639_10746188 3300026041 Bacteria 910
459 Ga0207678_10000023 3300026067 Bacteria 126241
460 Ga0207702_10000714 3300026078 Bacteria 35703
461 Ga0207702_10001156 3300026078 Bacteria 26911
462 Ga0207702_10003644 3300026078 Bacteria 13957
463 Ga0207702_10858700 3300026078 Bacteria 898
464 Ga0207702_11143193 3300026078 Bacteria 773
465 Ga0207641_10000059 3300026088 Bacteria 164728
466 Ga0207641_10009583 3300026088 Bacteria 7980
467 Ga0207641_10044221 3300026088 Bacteria 3745
468 Ga0207641_10053949 3300026088 Bacteria 3409
469 Ga0207648_10000041 3300026089 Bacteria 115866
470 Ga0207648_10033463 3300026089 Bacteria 4533
471 Ga0207648_10462947 3300026089 Bacteria 1156
472 Ga0207648_10681091 3300026089 Bacteria 952
473 Ga0207676_10000080 3300026095 Bacteria 94513
474 Ga0207676_10008126 3300026095 Bacteria 7459
475 Ga0207676_10027950 3300026095 Unclassified 4208
476 Ga0207676_10558741 3300026095 Bacteria 1094
477 Ga0207674_10000047 3300026116 Bacteria 120929
478 Ga0207674_10001103 3300026116 Bacteria 35082
479 Ga0207674_10001717 3300026116 Bacteria 28034
480 Ga0207674_10017454 3300026116 Bacteria 7832
481 Ga0207675_100007292 3300026118 Bacteria 10452
482 Ga0207675_100291470 3300026118 Unclassified 1587
483 Ga0207683_10000017 3300026121 Bacteria 123119
484 Ga0207683_10056544 3300026121 Bacteria 3442
485 Ga0207683_10061644 3300026121 Bacteria 3302
486 Ga0207683_10223919 3300026121 Bacteria 1714
487 Ga0207698_10176934 3300026142 Bacteria 1885
488 Ga0207698_10676997 3300026142 Bacteria 1024
489 Ga0207428_10260282 3300027907 Bacteria 1292
490 Ga0207428_10359752 3300027907 Unclassified 1070
491 Ga0268266_10002321 3300028379 Bacteria 20620
492 Ga0268266_10273725 3300028379 Bacteria 1568
493 Ga0268265_10008423 3300028380 Bacteria 6962
494 Ga0268265_10525337 3300028380 Bacteria 1119
495 Ga0268265_11054161 3300028380 Bacteria 805
496 Ga0268264_10010763 3300028381 Bacteria 7557
497 Ga0268264_10018155 3300028381 Bacteria 5753
498 Ga0268264_10039245 3300028381 Bacteria 3912
499 Ga0268264_10358872 3300028381 Bacteria 1389
500 Ga0265338_10204237 3300028800 Bacteria 1488
501 Ga0307513_10074122 3300031456 Bacteria 3541
502 Ga0265313_10068357 3300031595 Unclassified 1642
503 Ga0307405_10000009 3300031731 Bacteria 259388
504 Ga0307413_10157596 3300031824 Bacteria 1591
505 Ga0307407_10000001 3300031903 Bacteria 570048
506 Ga0307412_10185167 3300031911 Bacteria 1570
507 Ga0307409_100034309 3300031995 Bacteria 3704
508 Ga0307409_100086880 3300031995 Bacteria 2547
509 Ga0307416_100000008 3300032002 Bacteria 401343
510 Ga0307416_101996178 3300032002 Bacteria 683
511 Ga0307414_10188021 3300032004 Bacteria 1668
512 Ga0307414_10215768 3300032004 Bacteria 1572
513 Ga0307411_10037272 3300032005 Bacteria 3056
514 Ga0373926_0075975 3300035083 Bacteria 1238
515 Ga0373926_0221778 3300035083 Bacteria 730
516 Ga0373936_0089531 3300035113 Unclassified 1289
517 Ga0373946_0268737 3300035171 Bacteria 836
518 Ga0373935_0345880 3300035692 Bacteria 1059
519 Ga0373935_0476212 3300035692 Bacteria 904
520 Ga0373935_0493896 3300035692 Bacteria 888
521 Ga0373947_0008139 3300035725 Bacteria 6045
522 Ga0373947_0149734 3300035725 Bacteria 1502
523 Ga0373937_0027871 3300036401 Bacteria 5110
524 Ga0373925_0009291 3300037068 Bacteria 7156
525 Ga0373925_0036133 3300037068 Bacteria 3647
526 Ga0373925_0458443 3300037068 Unclassified 1044
527 Ga0395898_0217237 3300037466 Bacteria 1824
528 Ga0436364_0687620 3300037853 Bacteria 770
529 Ga0436364_0751971 3300037853 Bacteria 718
530 Ga0436364_0752377 3300037853 Bacteria 5743
531 Ga0395901_0404620 3300038443 Unclassified 1402
532 Ga0395901_0516985 3300038443 Bacteria 1213
533 Ga0436365_1400891 3300039437 Bacteria 845
534 Ga0436361_0705453 3300039447 Bacteria 895
535 Ga0436361_0720369 3300039447 Bacteria 4244
536 Ga0436363_0215964 3300039450 Bacteria 801
537 Ga0436363_1146649 3300039450 Unclassified 2835
538 Ga0436362_1292569 3300039453 Bacteria 2264
539 Ga0451835_0382775 3300041492 Bacteria 664
540 Ga0453684_0185874 3300044712 Bacteria 2435
541 Ga0451576_0163768 3300045051 Unclassified 2321
542 Ga0451576_0230572 3300045051 Bacteria 1934
543 Ga0495629_0646771 3300046459 Bacteria 705
544 Ga0495638_0000003 3300046460 Bacteria 888792
545 Ga0495651_0894177 3300046462 Unclassified 543
546 Ga0495653_0451034 3300046463 Bacteria 809
547 Ga0495580_0001485 3300046472 Bacteria 20582
548 Ga0495580_0010703 3300046472 Bacteria 7125
549 Ga0495580_0018662 3300046472 Bacteria 5161
550 Ga0495580_0049522 3300046472 Bacteria 2973
551 Ga0495582_0239099 3300046473 Bacteria 1041
552 Ga0495582_0270407 3300046473 Bacteria 975
553 Ga0495664_0148143 3300046477 Bacteria 1424
554 Ga0495606_0032528 3300046507 Bacteria 3612
555 Ga0495610_0000129 3300046512 Bacteria 83051
556 Ga0495618_0309070 3300046514 Unclassified 981
557 Ga0495630_0005812 3300046517 Bacteria 8718
558 Ga0495630_0783335 3300046517 Unclassified 728
559 Ga0495637_0005395 3300046520 Bacteria 6531
560 Ga0495652_0884403 3300046529 Bacteria 590
561 Ga0495588_0234441 3300046674 Bacteria 968
562 Ga0495669_0172841 3300046684 Bacteria 1028
563 Ga0495613_0222418 3300046689 Bacteria 1325
564 Ga0495674_0032150 3300047319 Bacteria 4762
565 Ga0495674_0263125 3300047319 Bacteria 1417
566 Ga0495674_0672515 3300047319 Bacteria 815
567 Ga0495681_0149756 3300047470 Bacteria 980
568 Ga0495602_0023682 3300048088 Bacteria 5977
569 Ga0496102_0028242 3300048905 Bacteria 5010
570 Ga0496102_0028521 3300048905 Bacteria 4987
571 Ga0496102_0314734 3300048905 Bacteria 1475
572 Ga0496102_0374412 3300048905 Bacteria 1340
573 Ga0496104_0444877 3300048907 Bacteria 1208
574 Ga0496104_1071811 3300048907 Bacteria 709
575 Ga0496105_0062549 3300048908 Bacteria 3072
576 Ga0496105_0065836 3300048908 Bacteria 2991
577 Ga0496106_0492577 3300048909 Bacteria 985
578 Ga0496106_0656772 3300048909 Bacteria 838
579 Ga0496107_0241591 3300048910 Bacteria 1344
580 Ga0496108_0007842 3300048911 Bacteria 8653
581 Ga0496109_0000122 3300048912 Bacteria 80310
582 Ga0496109_1000366 3300048912 Bacteria 774
583 Ga0496110_0004464 3300048913 Bacteria 10847
584 Ga0496110_0224667 3300048913 Bacteria 1708
585 Ga0496110_0486459 3300048913 Bacteria 1124
586 Ga0496111_0005613 3300048914 Bacteria 8068
587 Ga0496112_0000027 3300048915 Bacteria 139514
588 Ga0496112_0000572 3300048915 Bacteria 25337
589 Ga0496112_0039024 3300048915 Bacteria 4638
590 Ga0496112_0059711 3300048915 Bacteria 3758
591 Ga0496113_0003205 3300048916 Bacteria 9752
592 Ga0496113_0614955 3300048916 Bacteria 870
593 Ga0496114_0353963 3300048917 Bacteria 1299
594 Ga0496114_0666614 3300048917 Bacteria 914
595 Ga0501291_088672 3300049514 Bacteria 628
596 Ga0501298_019163 3300049521 Bacteria 1266
597 Ga0501032_0099369 3300049569 Bacteria 1928
598 Ga0501034_0014078 3300049571 Bacteria 8241
599 Ga0501047_0006360 3300049581 Bacteria 11108
600 Ga0501047_0205898 3300049581 Bacteria 1827
601 Ga0501067_0385123 3300049583 Bacteria 782
602 Ga0501070_0250360 3300049586 Bacteria 1449
603 Ga0501080_0002571 3300049742 Bacteria 15889
604 Ga0501083_0082223 3300049744 Bacteria 2134
605 Ga0501083_0140562 3300049744 Bacteria 1581
606 Ga0501044_0001865 3300049823 Bacteria 24437
607 nmdc:mga03n38_432848_c1 3300050490 Bacteria 729
608 nmdc:mga09592_283908_c1 3300050508 Bacteria 1435
609 nmdc:mga0qj67_767106_c1 3300050509 Bacteria 765
610 nmdc:mga08y16_120423_c1 3300050511 Unclassified 2731
611 nmdc:mga08y16_540962_c1 3300050511 Bacteria 1180
612 nmdc:mga0n895_9096_c1 3300050512 Bacteria 8667
613 nmdc:mga0rr50_1537_c2 3300050513 Bacteria 8773
614 nmdc:mga0rr50_98449_c1 3300050513 Unclassified 2292
615 nmdc:mga08x19_145153_c1 3300050514 Bacteria 1605
616 nmdc:mga0a205_546156_c1 3300050515 Unclassified 1014
617 nmdc:mga0a205_987839_c1 3300050515 Bacteria 689
618 Ga0500557_020248 3300053105 Bacteria 1889
619 Ga0500616_0000007 3300053153 Bacteria 836875
620 Ga0587079_081840 3300059647 Bacteria 740
621 Ga0501082_0471968 3300060353 Bacteria 1096

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1400891 Ga0436365_1400891_92_559 155
2 3300039450 Ga0436363_0215964 Ga0436363_0215964_13_480 155
3 3300049514 Ga0501291_088672 Ga0501291_088672_93_578 161
4 3300005547 Ga0070693_100037406 Ga0070693_1000374062 163
5 3300025927 Ga0207687_10014207 Ga0207687_100142072 163
6 3300035725 Ga0373947_0149734 Ga0373947_0149734_811_1302 163
7 3300049744 Ga0501083_0140562 Ga0501083_0140562_651_1199 163
8 3300009553 Ga0105249_10155975 Ga0105249_101559753 164
9 3300046462 Ga0495651_0894177 Ga0495651_0894177_22_516 164
10 3300026121 Ga0207683_10056544 Ga0207683_100565445 169
11 3300038443 Ga0395901_0404620 Ga0395901_0404620_858_1388 176
12 iso_pu_bacteria 2896344016 2896346811 176
13 3300003322 rootL2_10147111 rootL2_101471113 177
14 3300006844 Ga0075428_100735584 Ga0075428_1007355842 177
15 3300009094 Ga0111539_10021661 Ga0111539_100216618 177
16 3300014326 Ga0157380_10001491 Ga0157380_100014913 177
17 3300014326 Ga0157380_11485090 Ga0157380_114850901 177
18 3300025298 Ga0209050_1002956 Ga0209050_100295610 177
19 3300027907 Ga0207428_10359752 Ga0207428_103597522 177
20 3300031456 Ga0307513_10074122 Ga0307513_100741223 177
21 3300046460 Ga0495638_0000003 Ga0495638_0000003_730026_730610 177
22 3300050511 nmdc:mga08y16_120423_c1 nmdc:mga08y16_120423_c1_674_1210 177
23 3300053105 Ga0500557_020248 Ga0500557_020248_1148_1732 177
24 3300053153 Ga0500616_0000007 Ga0500616_0000007_36838_37422 177
25 iso_pu_bacteria 2585427687 2586206973 177
26 iso_pu_bacteria 2738541302 2738854602 177
27 iso_pu_bacteria 2739367651 2739587113 177
28 iso_pu_bacteria 2739367656 2739615212 177
29 iso_pu_bacteria 2739367663 2739645663 177
30 iso_pu_bacteria 2818991437 2819547578 177
31 iso_pu_bacteria 2842722452 2842726592 177
32 iso_pu_bacteria 2842909656 2842911436 177
33 iso_pu_bacteria 2849281842 2849284218 177
34 iso_pu_bacteria 2857627736 2857627823 177
35 iso_pu_bacteria 2904445276 2904449015 177
36 iso_pu_bacteria 2945997725 2946003106 177
37 iso_pu_bacteria 2954016120 2954019965 177
38 3300006847 Ga0075431_101254123 Ga0075431_1012541231 178
39 3300009094 Ga0111539_10069045 Ga0111539_100690455 178
40 3300009147 Ga0114129_11660514 Ga0114129_116605142 178
41 3300027907 Ga0207428_10260282 Ga0207428_102602822 178
42 3300031824 Ga0307413_10157596 Ga0307413_101575962 178
43 3300031911 Ga0307412_10185167 Ga0307412_101851672 178
44 3300032004 Ga0307414_10188021 Ga0307414_101880212 178
45 3300032005 Ga0307411_10037272 Ga0307411_100372722 178
46 3300050511 nmdc:mga08y16_540962_c1 nmdc:mga08y16_540962_c1_615_1154 178
47 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004139 179
48 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002486 179
49 3300003215 JGI25153J46596_10000037 JGI25153J46596_10000037142 179
50 3300003791 Ga0055530_10000821 Ga0055530_1000082116 179
51 3300005563 Ga0068855_100878719 Ga0068855_1008787192 179
52 3300009036 Ga0105244_10036466 Ga0105244_100364663 179
53 3300009174 Ga0105241_11199696 Ga0105241_111996961 179
54 3300013100 Ga0157373_10173368 Ga0157373_101733682 179
55 3300013102 Ga0157371_10000027 Ga0157371_1000002720 179
56 3300013104 Ga0157370_10034394 Ga0157370_100343945 179
57 3300013104 Ga0157370_10497644 Ga0157370_104976442 179
58 3300013105 Ga0157369_10000053 Ga0157369_10000053139 179
59 3300013306 Ga0163162_10000078 Ga0163162_1000007833 179
60 3300013308 Ga0157375_10713036 Ga0157375_107130362 179
61 3300013308 Ga0157375_11997537 Ga0157375_119975371 179
62 3300014497 Ga0182008_10000334 Ga0182008_100003348 179
63 3300015261 Ga0182006_1000755 Ga0182006_100075513 179
64 3300015261 Ga0182006_1000787 Ga0182006_100078711 179
65 3300015262 Ga0182007_10000005 Ga0182007_10000005276 179
66 3300015682 Ga0183373_1007 Ga0183373_1007202 179
67 3300017792 Ga0163161_10043332 Ga0163161_100433323 179
68 3300025245 Ga0207425_1000003 Ga0207425_1000003361 179
69 3300025258 Ga0209129_1000022 Ga0209129_1000022361 179
70 3300025292 Ga0209676_1000039 Ga0209676_1000039161 179
71 3300025294 Ga0209025_1000007 Ga0209025_1000007360 179
72 3300025297 Ga0209758_1000012 Ga0209758_1000012361 179
73 3300025298 Ga0209050_1000033 Ga0209050_1000033288 179
74 3300025923 Ga0207681_10381368 Ga0207681_103813681 179
75 3300025949 Ga0207667_10761572 Ga0207667_107615722 179
76 3300026089 Ga0207648_10462947 Ga0207648_104629471 179
77 3300031731 Ga0307405_10000009 Ga0307405_1000000910 179
78 3300031903 Ga0307407_10000001 Ga0307407_10000001191 179
79 3300031995 Ga0307409_100034309 Ga0307409_1000343092 179
80 3300032002 Ga0307416_100000008 Ga0307416_100000008198 179
81 3300041492 Ga0451835_0382775 Ga0451835_0382775_78_629 179
82 3300046507 Ga0495606_0032528 Ga0495606_0032528_807_1358 179
83 3300046512 Ga0495610_0000129 Ga0495610_0000129_65512_66063 179
84 3300046520 Ga0495637_0005395 Ga0495637_0005395_4941_5492 179
85 3300047470 Ga0495681_0149756 Ga0495681_0149756_356_907 179
86 3300005329 Ga0070683_100316229 Ga0070683_1003162291 180
87 3300005329 Ga0070683_100380014 Ga0070683_1003800142 180
88 3300005331 Ga0070670_100260357 Ga0070670_1002603573 180
89 3300005354 Ga0070675_100168493 Ga0070675_1001684932 180
90 3300005354 Ga0070675_100985457 Ga0070675_1009854572 180
91 3300005355 Ga0070671_100021299 Ga0070671_1000212992 180
92 3300005356 Ga0070674_100072261 Ga0070674_1000722612 180
93 3300005356 Ga0070674_101012338 Ga0070674_1010123381 180
94 3300005364 Ga0070673_100096308 Ga0070673_1000963082 180
95 3300005543 Ga0070672_100076519 Ga0070672_1000765192 180
96 3300005548 Ga0070665_100203971 Ga0070665_1002039712 180
97 3300005564 Ga0070664_100284808 Ga0070664_1002848082 180
98 3300005617 Ga0068859_101037588 Ga0068859_1010375882 180
99 3300005618 Ga0068864_100433679 Ga0068864_1004336792 180
100 3300006931 Ga0097620_101037637 Ga0097620_1010376371 180
101 3300013105 Ga0157369_10057271 Ga0157369_100572711 180
102 3300013308 Ga0157375_10370205 Ga0157375_103702052 180
103 3300014325 Ga0163163_12194915 Ga0163163_121949151 180
104 3300014968 Ga0157379_11467758 Ga0157379_114677581 180
105 3300021361 Ga0213872_10148104 Ga0213872_101481041 180
106 3300021441 Ga0213871_10021025 Ga0213871_100210252 180
107 3300025924 Ga0207694_10388955 Ga0207694_103889552 180
108 3300025937 Ga0207669_10150494 Ga0207669_101504942 180
109 3300025940 Ga0207691_10006756 Ga0207691_100067565 180
110 3300025944 Ga0207661_10100241 Ga0207661_101002413 180
111 3300025945 Ga0207679_10271822 Ga0207679_102718222 180
112 3300025960 Ga0207651_10059734 Ga0207651_100597342 180
113 3300026041 Ga0207639_10746188 Ga0207639_107461882 180
114 3300026089 Ga0207648_10681091 Ga0207648_106810911 180
115 3300026095 Ga0207676_10558741 Ga0207676_105587412 180
116 3300026121 Ga0207683_10061644 Ga0207683_100616443 180
117 3300028380 Ga0268265_11054161 Ga0268265_110541611 180
118 3300031595 Ga0265313_10068357 Ga0265313_100683572 180
119 3300031995 Ga0307409_100086880 Ga0307409_1000868802 180
120 3300032002 Ga0307416_101996178 Ga0307416_1019961781 180
121 3300032004 Ga0307414_10215768 Ga0307414_102157682 180
122 3300037853 Ga0436364_0687620 Ga0436364_0687620_96_638 180
123 3300037853 Ga0436364_0751971 Ga0436364_0751971_76_618 180
124 3300039447 Ga0436361_0705453 Ga0436361_0705453_164_706 180
125 3300039447 Ga0436361_0720369 Ga0436361_0720369_1833_2375 180
126 3300039453 Ga0436362_1292569 Ga0436362_1292569_233_775 180
127 3300044712 Ga0453684_0185874 Ga0453684_0185874_148_690 180
128 3300046473 Ga0495582_0239099 Ga0495582_0239099_289_831 180
129 3300046529 Ga0495652_0884403 Ga0495652_0884403_24_566 180
130 3300047319 Ga0495674_0263125 Ga0495674_0263125_211_753 180
131 3300049521 Ga0501298_019163 Ga0501298_019163_561_1103 180
132 3300049569 Ga0501032_0099369 Ga0501032_0099369_756_1298 180
133 3300049571 Ga0501034_0014078 Ga0501034_0014078_5880_6422 180
134 3300049581 Ga0501047_0006360 Ga0501047_0006360_1195_1737 180
135 3300049586 Ga0501070_0250360 Ga0501070_0250360_467_1009 180
136 3300049742 Ga0501080_0002571 Ga0501080_0002571_4565_5107 180
137 3300049823 Ga0501044_0001865 Ga0501044_0001865_6943_7485 180
138 3300060353 Ga0501082_0471968 Ga0501082_0471968_76_618 180
139 3300005344 Ga0070661_100278810 Ga0070661_1002788102 181
140 3300005530 Ga0070679_101051070 Ga0070679_1010510701 181
141 3300005842 Ga0068858_100706494 Ga0068858_1007064941 181
142 3300009098 Ga0105245_10005753 Ga0105245_100057533 181
143 3300009148 Ga0105243_12042307 Ga0105243_120423071 181
144 3300013296 Ga0157374_10092195 Ga0157374_100921953 181
145 3300013307 Ga0157372_11127001 Ga0157372_111270012 181
146 3300025920 Ga0207649_10539946 Ga0207649_105399462 181
147 3300025927 Ga0207687_10013423 Ga0207687_100134234 181
148 3300026035 Ga0207703_10670737 Ga0207703_106707371 181
149 3300026035 Ga0207703_11661683 Ga0207703_116616831 181
150 3300045051 Ga0451576_0230572 Ga0451576_0230572_1319_1867 181
151 3300050508 nmdc:mga09592_283908_c1 nmdc:mga09592_283908_c1_280_825 181
152 3300050509 nmdc:mga0qj67_767106_c1 nmdc:mga0qj67_767106_c1_171_716 181
153 3300005327 Ga0070658_10025188 Ga0070658_100251885 182
154 3300005355 Ga0070671_100042095 Ga0070671_1000420953 182
155 3300005434 Ga0070709_10007779 Ga0070709_100077792 182
156 3300005434 Ga0070709_10128175 Ga0070709_101281752 182
157 3300005435 Ga0070714_100061534 Ga0070714_1000615342 182
158 3300005435 Ga0070714_100137789 Ga0070714_1001377891 182
159 3300005435 Ga0070714_100705905 Ga0070714_1007059051 182
160 3300005436 Ga0070713_100006935 Ga0070713_1000069359 182
161 3300005437 Ga0070710_10016059 Ga0070710_100160592 182
162 3300005439 Ga0070711_100010563 Ga0070711_1000105637 182
163 3300005439 Ga0070711_100414670 Ga0070711_1004146701 182
164 3300005445 Ga0070708_100007922 Ga0070708_1000079228 182
165 3300005467 Ga0070706_100697755 Ga0070706_1006977551 182
166 3300005539 Ga0068853_100351130 Ga0068853_1003511301 182
167 3300005539 Ga0068853_100464952 Ga0068853_1004649522 182
168 3300005563 Ga0068855_100045071 Ga0068855_1000450712 182
169 3300005563 Ga0068855_100142479 Ga0068855_1001424793 182
170 3300005577 Ga0068857_100009899 Ga0068857_1000098996 182
171 3300006028 Ga0070717_10015758 Ga0070717_100157583 182
172 3300006028 Ga0070717_10020100 Ga0070717_100201008 182
173 3300006173 Ga0070716_100022019 Ga0070716_1000220194 182
174 3300006173 Ga0070716_100028494 Ga0070716_1000284944 182
175 3300006175 Ga0070712_100015362 Ga0070712_1000153624 182
176 3300009174 Ga0105241_10045281 Ga0105241_100452812 182
177 3300009551 Ga0105238_10140076 Ga0105238_101400762 182
178 3300010375 Ga0105239_10024001 Ga0105239_100240014 182
179 3300010375 Ga0105239_10364274 Ga0105239_103642741 182
180 3300013105 Ga0157369_10229084 Ga0157369_102290842 182
181 3300013105 Ga0157369_10875885 Ga0157369_108758851 182
182 3300013307 Ga0157372_10056006 Ga0157372_100560063 182
183 3300013307 Ga0157372_10069578 Ga0157372_100695782 182
184 3300025898 Ga0207692_10045754 Ga0207692_100457542 182
185 3300025906 Ga0207699_10004717 Ga0207699_100047172 182
186 3300025906 Ga0207699_10026207 Ga0207699_100262073 182
187 3300025909 Ga0207705_10047799 Ga0207705_100477993 182
188 3300025909 Ga0207705_10309307 Ga0207705_103093071 182
189 3300025915 Ga0207693_10000453 Ga0207693_1000045322 182
190 3300025916 Ga0207663_10323603 Ga0207663_103236031 182
191 3300025919 Ga0207657_11171496 Ga0207657_111714961 182
192 3300025924 Ga0207694_10181728 Ga0207694_101817282 182
193 3300025928 Ga0207700_10004738 Ga0207700_100047384 182
194 3300025928 Ga0207700_10158677 Ga0207700_101586772 182
195 3300025929 Ga0207664_10078188 Ga0207664_100781882 182
196 3300025929 Ga0207664_10287670 Ga0207664_102876701 182
197 3300025929 Ga0207664_10341865 Ga0207664_103418652 182
198 3300025929 Ga0207664_10477231 Ga0207664_104772311 182
199 3300025931 Ga0207644_10091267 Ga0207644_100912671 182
200 3300025932 Ga0207690_10229710 Ga0207690_102297102 182
201 3300025939 Ga0207665_10009538 Ga0207665_100095387 182
202 3300025949 Ga0207667_10041026 Ga0207667_100410262 182
203 3300025949 Ga0207667_10224671 Ga0207667_102246711 182
204 3300026078 Ga0207702_11143193 Ga0207702_111431931 182
205 3300026116 Ga0207674_10001103 Ga0207674_100011039 182
206 3300026118 Ga0207675_100291470 Ga0207675_1002914704 182
207 3300037466 Ga0395898_0217237 Ga0395898_0217237_627_1175 182
208 3300038443 Ga0395901_0516985 Ga0395901_0516985_313_861 182
209 3300046514 Ga0495618_0309070 Ga0495618_0309070_301_852 182
210 3300048905 Ga0496102_0314734 Ga0496102_0314734_16_570 182
211 3300048907 Ga0496104_1071811 Ga0496104_1071811_96_650 182
212 3300049581 Ga0501047_0205898 Ga0501047_0205898_231_779 182
213 3300049583 Ga0501067_0385123 Ga0501067_0385123_90_638 182
214 3300059647 Ga0587079_081840 Ga0587079_081840_182_730 182
215 3300003323 rootH1_10286969 rootH1_102869692 183
216 3300005295 Ga0065707_10096444 Ga0065707_100964443 183
217 3300005329 Ga0070683_100033131 Ga0070683_1000331318 183
218 3300005329 Ga0070683_100160096 Ga0070683_1001600963 183
219 3300005331 Ga0070670_100003099 Ga0070670_1000030999 183
220 3300005334 Ga0068869_100022398 Ga0068869_1000223983 183
221 3300005337 Ga0070682_101033622 Ga0070682_1010336221 183
222 3300005338 Ga0068868_100006594 Ga0068868_1000065949 183
223 3300005338 Ga0068868_100069462 Ga0068868_1000694622 183
224 3300005338 Ga0068868_100612732 Ga0068868_1006127321 183
225 3300005344 Ga0070661_100010101 Ga0070661_1000101012 183
226 3300005355 Ga0070671_100190928 Ga0070671_1001909282 183
227 3300005364 Ga0070673_100032379 Ga0070673_1000323792 183
228 3300005364 Ga0070673_100990811 Ga0070673_1009908112 183
229 3300005435 Ga0070714_100020154 Ga0070714_1000201542 183
230 3300005435 Ga0070714_100047876 Ga0070714_1000478762 183
231 3300005436 Ga0070713_100021071 Ga0070713_1000210713 183
232 3300005436 Ga0070713_100085430 Ga0070713_1000854302 183
233 3300005436 Ga0070713_100622596 Ga0070713_1006225962 183
234 3300005437 Ga0070710_10028225 Ga0070710_100282252 183
235 3300005439 Ga0070711_100187225 Ga0070711_1001872252 183
236 3300005439 Ga0070711_100346771 Ga0070711_1003467712 183
237 3300005458 Ga0070681_10000672 Ga0070681_1000067213 183
238 3300005458 Ga0070681_10002267 Ga0070681_100022675 183
239 3300005471 Ga0070698_100700604 Ga0070698_1007006041 183
240 3300005530 Ga0070679_100007996 Ga0070679_1000079969 183
241 3300005535 Ga0070684_100433637 Ga0070684_1004336372 183
242 3300005539 Ga0068853_100041435 Ga0068853_1000414355 183
243 3300005539 Ga0068853_100163119 Ga0068853_1001631192 183
244 3300005539 Ga0068853_100242010 Ga0068853_1002420102 183
245 3300005547 Ga0070693_100030761 Ga0070693_1000307613 183
246 3300005547 Ga0070693_100043191 Ga0070693_1000431912 183
247 3300005563 Ga0068855_100003709 Ga0068855_1000037092 183
248 3300005563 Ga0068855_100008412 Ga0068855_10000841212 183
249 3300005564 Ga0070664_100005991 Ga0070664_10000599111 183
250 3300005577 Ga0068857_100000154 Ga0068857_10000015416 183
251 3300005577 Ga0068857_100021773 Ga0068857_1000217732 183
252 3300005578 Ga0068854_100029316 Ga0068854_1000293165 183
253 3300005614 Ga0068856_100000612 Ga0068856_10000061214 183
254 3300005614 Ga0068856_100035661 Ga0068856_1000356612 183
255 3300005617 Ga0068859_100004113 Ga0068859_10000411310 183
256 3300005618 Ga0068864_100009624 Ga0068864_1000096243 183
257 3300005618 Ga0068864_100046472 Ga0068864_1000464725 183
258 3300005719 Ga0068861_100368463 Ga0068861_1003684633 183
259 3300005834 Ga0068851_10022057 Ga0068851_100220572 183
260 3300005841 Ga0068863_100016101 Ga0068863_1000161015 183
261 3300005841 Ga0068863_100017029 Ga0068863_1000170293 183
262 3300005842 Ga0068858_100000491 Ga0068858_10000049115 183
263 3300005842 Ga0068858_100110342 Ga0068858_1001103422 183
264 3300005842 Ga0068858_100878343 Ga0068858_1008783431 183
265 3300005843 Ga0068860_100027170 Ga0068860_1000271703 183
266 3300005843 Ga0068860_100517227 Ga0068860_1005172272 183
267 3300006028 Ga0070717_10008365 Ga0070717_100083655 183
268 3300006028 Ga0070717_10143272 Ga0070717_101432723 183
269 3300006028 Ga0070717_10620951 Ga0070717_106209512 183
270 3300006173 Ga0070716_100005555 Ga0070716_1000055552 183
271 3300006173 Ga0070716_100450975 Ga0070716_1004509752 183
272 3300006175 Ga0070712_100165104 Ga0070712_1001651042 183
273 3300006237 Ga0097621_100000805 Ga0097621_1000008053 183
274 3300006237 Ga0097621_100001391 Ga0097621_1000013919 183
275 3300006237 Ga0097621_100085707 Ga0097621_1000857072 183
276 3300006237 Ga0097621_100090806 Ga0097621_1000908062 183
277 3300006237 Ga0097621_100137229 Ga0097621_1001372292 183
278 3300006358 Ga0068871_100000803 Ga0068871_1000008032 183
279 3300006358 Ga0068871_100028421 Ga0068871_1000284212 183
280 3300006358 Ga0068871_100175524 Ga0068871_1001755242 183
281 3300006852 Ga0075433_10605088 Ga0075433_106050881 183
282 3300006871 Ga0075434_100144274 Ga0075434_1001442743 183
283 3300006881 Ga0068865_100004959 Ga0068865_1000049593 183
284 3300006881 Ga0068865_100009927 Ga0068865_1000099273 183
285 3300006914 Ga0075436_100121279 Ga0075436_1001212793 183
286 3300006931 Ga0097620_100004113 Ga0097620_10000411310 183
287 3300007076 Ga0075435_100019604 Ga0075435_1000196045 183
288 3300007076 Ga0075435_100557700 Ga0075435_1005577002 183
289 3300009093 Ga0105240_10057938 Ga0105240_100579383 183
290 3300009093 Ga0105240_10082755 Ga0105240_100827555 183
291 3300009093 Ga0105240_10335856 Ga0105240_103358563 183
292 3300009094 Ga0111539_10754351 Ga0111539_107543512 183
293 3300009098 Ga0105245_10001141 Ga0105245_100011413 183
294 3300009147 Ga0114129_10834176 Ga0114129_108341761 183
295 3300009174 Ga0105241_10052655 Ga0105241_100526555 183
296 3300009174 Ga0105241_10657653 Ga0105241_106576531 183
297 3300009176 Ga0105242_11395753 Ga0105242_113957531 183
298 3300009177 Ga0105248_10001672 Ga0105248_100016721 183
299 3300009177 Ga0105248_10070960 Ga0105248_100709605 183
300 3300009545 Ga0105237_10045613 Ga0105237_100456134 183
301 3300009545 Ga0105237_10070395 Ga0105237_100703955 183
302 3300009545 Ga0105237_10706801 Ga0105237_107068011 183
303 3300009551 Ga0105238_10000339 Ga0105238_1000033917 183
304 3300009551 Ga0105238_10099777 Ga0105238_100997775 183
305 3300010375 Ga0105239_10038911 Ga0105239_100389118 183
306 3300010375 Ga0105239_10146124 Ga0105239_101461243 183
307 3300010375 Ga0105239_10372081 Ga0105239_103720812 183
308 3300013100 Ga0157373_10082741 Ga0157373_100827412 183
309 3300013102 Ga0157371_10178806 Ga0157371_101788062 183
310 3300013104 Ga0157370_10189244 Ga0157370_101892441 183
311 3300013104 Ga0157370_10665610 Ga0157370_106656101 183
312 3300013105 Ga0157369_10001152 Ga0157369_100011529 183
313 3300013105 Ga0157369_10116778 Ga0157369_101167783 183
314 3300013296 Ga0157374_10000384 Ga0157374_1000038423 183
315 3300013296 Ga0157374_10001410 Ga0157374_1000141013 183
316 3300013296 Ga0157374_10018130 Ga0157374_100181309 183
317 3300013297 Ga0157378_10000121 Ga0157378_1000012116 183
318 3300013297 Ga0157378_10000188 Ga0157378_100001882 183
319 3300013297 Ga0157378_10001045 Ga0157378_1000104512 183
320 3300013297 Ga0157378_10043993 Ga0157378_100439931 183
321 3300013306 Ga0163162_10494549 Ga0163162_104945491 183
322 3300013307 Ga0157372_10002460 Ga0157372_1000246015 183
323 3300013307 Ga0157372_10002767 Ga0157372_1000276720 183
324 3300013307 Ga0157372_10008312 Ga0157372_1000831211 183
325 3300013307 Ga0157372_10013774 Ga0157372_100137749 183
326 3300013307 Ga0157372_10017992 Ga0157372_100179923 183
327 3300013307 Ga0157372_10116403 Ga0157372_101164033 183
328 3300013307 Ga0157372_10154085 Ga0157372_101540852 183
329 3300014969 Ga0157376_10153764 Ga0157376_101537642 183
330 3300014969 Ga0157376_10335836 Ga0157376_103358362 183
331 3300014969 Ga0157376_10817788 Ga0157376_108177882 183
332 3300021388 Ga0213875_10041285 Ga0213875_100412853 183
333 3300025321 Ga0207656_10051872 Ga0207656_100518722 183
334 3300025904 Ga0207647_10020875 Ga0207647_100208753 183
335 3300025905 Ga0207685_10119552 Ga0207685_101195522 183
336 3300025906 Ga0207699_10012372 Ga0207699_100123722 183
337 3300025911 Ga0207654_10032858 Ga0207654_100328582 183
338 3300025911 Ga0207654_10347732 Ga0207654_103477322 183
339 3300025912 Ga0207707_10002233 Ga0207707_1000223316 183
340 3300025912 Ga0207707_10066332 Ga0207707_100663323 183
341 3300025913 Ga0207695_10014898 Ga0207695_100148985 183
342 3300025913 Ga0207695_10048448 Ga0207695_100484485 183
343 3300025913 Ga0207695_10836382 Ga0207695_108363822 183
344 3300025914 Ga0207671_10106109 Ga0207671_101061093 183
345 3300025915 Ga0207693_10041884 Ga0207693_100418842 183
346 3300025915 Ga0207693_10166787 Ga0207693_101667872 183
347 3300025916 Ga0207663_10153221 Ga0207663_101532212 183
348 3300025916 Ga0207663_10157607 Ga0207663_101576071 183
349 3300025918 Ga0207662_10152322 Ga0207662_101523222 183
350 3300025920 Ga0207649_10007569 Ga0207649_100075692 183
351 3300025924 Ga0207694_10001944 Ga0207694_1000194414 183
352 3300025924 Ga0207694_10156415 Ga0207694_101564153 183
353 3300025925 Ga0207650_10006009 Ga0207650_100060097 183
354 3300025928 Ga0207700_10004433 Ga0207700_100044335 183
355 3300025928 Ga0207700_10234562 Ga0207700_102345623 183
356 3300025929 Ga0207664_10002243 Ga0207664_100022432 183
357 3300025929 Ga0207664_10028417 Ga0207664_100284172 183
358 3300025929 Ga0207664_10034311 Ga0207664_100343113 183
359 3300025931 Ga0207644_10416940 Ga0207644_104169402 183
360 3300025932 Ga0207690_10512009 Ga0207690_105120092 183
361 3300025938 Ga0207704_10002101 Ga0207704_100021013 183
362 3300025938 Ga0207704_10029250 Ga0207704_100292503 183
363 3300025938 Ga0207704_10279901 Ga0207704_102799012 183
364 3300025939 Ga0207665_10017633 Ga0207665_100176333 183
365 3300025941 Ga0207711_10002420 Ga0207711_100024201 183
366 3300025941 Ga0207711_10017040 Ga0207711_100170404 183
367 3300025942 Ga0207689_10041762 Ga0207689_100417624 183
368 3300025944 Ga0207661_10117955 Ga0207661_101179554 183
369 3300025944 Ga0207661_10354381 Ga0207661_103543812 183
370 3300025944 Ga0207661_10400231 Ga0207661_104002312 183
371 3300025945 Ga0207679_10002335 Ga0207679_100023353 183
372 3300025949 Ga0207667_10001412 Ga0207667_1000141219 183
373 3300025949 Ga0207667_10038382 Ga0207667_100383828 183
374 3300025960 Ga0207651_10353375 Ga0207651_103533751 183
375 3300025981 Ga0207640_10597674 Ga0207640_105976741 183
376 3300026023 Ga0207677_10001997 Ga0207677_100019973 183
377 3300026023 Ga0207677_10051364 Ga0207677_100513643 183
378 3300026023 Ga0207677_10268022 Ga0207677_102680221 183
379 3300026035 Ga0207703_10032290 Ga0207703_100322903 183
380 3300026035 Ga0207703_10102661 Ga0207703_101026613 183
381 3300026041 Ga0207639_10477597 Ga0207639_104775971 183
382 3300026078 Ga0207702_10000714 Ga0207702_100007143 183
383 3300026078 Ga0207702_10001156 Ga0207702_1000115619 183
384 3300026078 Ga0207702_10003644 Ga0207702_100036449 183
385 3300026088 Ga0207641_10009583 Ga0207641_100095836 183
386 3300026088 Ga0207641_10044221 Ga0207641_100442213 183
387 3300026095 Ga0207676_10008126 Ga0207676_100081263 183
388 3300026095 Ga0207676_10027950 Ga0207676_100279505 183
389 3300026116 Ga0207674_10001717 Ga0207674_1000171716 183
390 3300026116 Ga0207674_10017454 Ga0207674_100174544 183
391 3300026121 Ga0207683_10223919 Ga0207683_102239191 183
392 3300028381 Ga0268264_10010763 Ga0268264_100107634 183
393 3300028381 Ga0268264_10358872 Ga0268264_103588722 183
394 3300035083 Ga0373926_0075975 Ga0373926_0075975_614_1165 183
395 3300035113 Ga0373936_0089531 Ga0373936_0089531_63_614 183
396 3300035171 Ga0373946_0268737 Ga0373946_0268737_107_658 183
397 3300035692 Ga0373935_0345880 Ga0373935_0345880_180_731 183
398 3300035692 Ga0373935_0493896 Ga0373935_0493896_165_716 183
399 3300035725 Ga0373947_0008139 Ga0373947_0008139_4406_4957 183
400 3300036401 Ga0373937_0027871 Ga0373937_0027871_1831_2382 183
401 3300037068 Ga0373925_0009291 Ga0373925_0009291_1677_2228 183
402 3300037068 Ga0373925_0458443 Ga0373925_0458443_268_819 183
403 3300037853 Ga0436364_0752377 Ga0436364_0752377_2128_2679 183
404 3300039450 Ga0436363_1146649 Ga0436363_1146649_1413_1964 183
405 3300045051 Ga0451576_0163768 Ga0451576_0163768_1316_1867 183
406 3300046459 Ga0495629_0646771 Ga0495629_0646771_63_614 183
407 3300046463 Ga0495653_0451034 Ga0495653_0451034_172_723 183
408 3300046472 Ga0495580_0010703 Ga0495580_0010703_2727_3278 183
409 3300046472 Ga0495580_0018662 Ga0495580_0018662_3448_3999 183
410 3300046473 Ga0495582_0270407 Ga0495582_0270407_329_880 183
411 3300046477 Ga0495664_0148143 Ga0495664_0148143_819_1370 183
412 3300046517 Ga0495630_0005812 Ga0495630_0005812_7957_8508 183
413 3300046517 Ga0495630_0783335 Ga0495630_0783335_55_606 183
414 3300046674 Ga0495588_0234441 Ga0495588_0234441_368_919 183
415 3300046689 Ga0495613_0222418 Ga0495613_0222418_568_1119 183
416 3300047319 Ga0495674_0032150 Ga0495674_0032150_399_950 183
417 3300047319 Ga0495674_0672515 Ga0495674_0672515_106_657 183
418 3300048088 Ga0495602_0023682 Ga0495602_0023682_4702_5253 183
419 3300048905 Ga0496102_0028242 Ga0496102_0028242_287_838 183
420 3300048907 Ga0496104_0444877 Ga0496104_0444877_569_1120 183
421 3300048908 Ga0496105_0062549 Ga0496105_0062549_67_618 183
422 3300048909 Ga0496106_0656772 Ga0496106_0656772_120_671 183
423 3300048912 Ga0496109_1000366 Ga0496109_1000366_198_749 183
424 3300048913 Ga0496110_0486459 Ga0496110_0486459_27_578 183
425 3300048915 Ga0496112_0039024 Ga0496112_0039024_1849_2400 183
426 3300048915 Ga0496112_0059711 Ga0496112_0059711_2484_3035 183
427 3300048916 Ga0496113_0614955 Ga0496113_0614955_178_729 183
428 3300048917 Ga0496114_0666614 Ga0496114_0666614_165_716 183
429 3300050490 nmdc:mga03n38_432848_c1 nmdc:mga03n38_432848_c1_14_568 183
430 3300050512 nmdc:mga0n895_9096_c1 nmdc:mga0n895_9096_c1_7271_7822 183
431 3300050513 nmdc:mga0rr50_1537_c2 nmdc:mga0rr50_1537_c2_1689_2240 183
432 3300050513 nmdc:mga0rr50_98449_c1 nmdc:mga0rr50_98449_c1_143_694 183
433 3300050514 nmdc:mga08x19_145153_c1 nmdc:mga08x19_145153_c1_13_564 183
434 3300050515 nmdc:mga0a205_546156_c1 nmdc:mga0a205_546156_c1_90_641 183
435 3300050515 nmdc:mga0a205_987839_c1 nmdc:mga0a205_987839_c1_37_588 183
436 3300005330 Ga0070690_100334252 Ga0070690_1003342522 184
437 3300005334 Ga0068869_100004390 Ga0068869_1000043905 184
438 3300005338 Ga0068868_100016727 Ga0068868_1000167272 184
439 3300005340 Ga0070689_100243635 Ga0070689_1002436353 184
440 3300005365 Ga0070688_100229152 Ga0070688_1002291522 184
441 3300005466 Ga0070685_10130440 Ga0070685_101304401 184
442 3300005539 Ga0068853_100100252 Ga0068853_1001002522 184
443 3300005543 Ga0070672_100115267 Ga0070672_1001152672 184
444 3300005544 Ga0070686_100191471 Ga0070686_1001914711 184
445 3300005548 Ga0070665_100189978 Ga0070665_1001899782 184
446 3300005578 Ga0068854_100390366 Ga0068854_1003903661 184
447 3300005616 Ga0068852_100699227 Ga0068852_1006992272 184
448 3300005841 Ga0068863_100889674 Ga0068863_1008896741 184
449 3300005842 Ga0068858_100000401 Ga0068858_10000040128 184
450 3300005843 Ga0068860_100017308 Ga0068860_1000173085 184
451 3300006358 Ga0068871_100766549 Ga0068871_1007665491 184
452 3300006881 Ga0068865_100036240 Ga0068865_1000362402 184
453 3300009098 Ga0105245_10721425 Ga0105245_107214252 184
454 3300009176 Ga0105242_10609766 Ga0105242_106097661 184
455 3300009177 Ga0105248_10067166 Ga0105248_100671662 184
456 3300009545 Ga0105237_10023243 Ga0105237_100232432 184
457 3300010375 Ga0105239_10039578 Ga0105239_100395781 184
458 3300013306 Ga0163162_10221418 Ga0163162_102214182 184
459 3300013308 Ga0157375_10108020 Ga0157375_101080202 184
460 3300014326 Ga0157380_10813713 Ga0157380_108137131 184
461 3300014745 Ga0157377_10262146 Ga0157377_102621462 184
462 3300014968 Ga0157379_10017143 Ga0157379_100171435 184
463 3300014969 Ga0157376_10137091 Ga0157376_101370912 184
464 3300025901 Ga0207688_10122497 Ga0207688_101224971 184
465 3300025904 Ga0207647_10002192 Ga0207647_100021927 184
466 3300025916 Ga0207663_10040025 Ga0207663_100400253 184
467 3300025927 Ga0207687_10636465 Ga0207687_106364652 184
468 3300025934 Ga0207686_10905940 Ga0207686_109059401 184
469 3300025938 Ga0207704_10009335 Ga0207704_100093352 184
470 3300025940 Ga0207691_10242578 Ga0207691_102425781 184
471 3300025941 Ga0207711_10049454 Ga0207711_100494544 184
472 3300025942 Ga0207689_10006870 Ga0207689_100068706 184
473 3300025981 Ga0207640_10206139 Ga0207640_102061391 184
474 3300026023 Ga0207677_10161889 Ga0207677_101618892 184
475 3300026035 Ga0207703_10005593 Ga0207703_100055939 184
476 3300026089 Ga0207648_10033463 Ga0207648_100334634 184
477 3300026142 Ga0207698_10676997 Ga0207698_106769972 184
478 3300028379 Ga0268266_10273725 Ga0268266_102737252 184
479 3300028380 Ga0268265_10525337 Ga0268265_105253372 184
480 3300028381 Ga0268264_10039245 Ga0268264_100392452 184
481 3300028800 Ga0265338_10204237 Ga0265338_102042371 184
482 3300035083 Ga0373926_0221778 Ga0373926_0221778_43_597 184
483 3300035692 Ga0373935_0476212 Ga0373935_0476212_92_646 184
484 3300037068 Ga0373925_0036133 Ga0373925_0036133_1300_1854 184
485 3300046472 Ga0495580_0049522 Ga0495580_0049522_604_1158 184
486 3300048905 Ga0496102_0374412 Ga0496102_0374412_222_776 184
487 3300048913 Ga0496110_0224667 Ga0496110_0224667_425_979 184
488 3300048915 Ga0496112_0000572 Ga0496112_0000572_4134_4688 184
489 3300005439 Ga0070711_100003906 Ga0070711_1000039062 185
490 3300006163 Ga0070715_10003382 Ga0070715_100033826 185
491 3300006173 Ga0070716_100000138 Ga0070716_10000013814 185
492 3300006175 Ga0070712_100000854 Ga0070712_10000085416 185
493 3300006175 Ga0070712_100001206 Ga0070712_1000012062 185
494 3300025898 Ga0207692_10015594 Ga0207692_100155941 185
495 3300025905 Ga0207685_10020401 Ga0207685_100204012 185
496 3300025906 Ga0207699_10017551 Ga0207699_100175512 185
497 3300025915 Ga0207693_10001705 Ga0207693_100017052 185
498 3300025915 Ga0207693_10034013 Ga0207693_100340135 185
499 3300025916 Ga0207663_10015278 Ga0207663_100152786 185
500 3300025916 Ga0207663_10053294 Ga0207663_100532941 185
501 3300025939 Ga0207665_10000187 Ga0207665_1000018723 185
502 3300046472 Ga0495580_0001485 Ga0495580_0001485_10149_10706 185
503 3300049744 Ga0501083_0082223 Ga0501083_0082223_1532_2089 185
504 3300002076 JGI24749J21850_1031188 JGI24749J21850_10311882 186
505 3300002459 JGI24751J29686_10000639 JGI24751J29686_100006392 186
506 3300005293 Ga0065715_10101024 Ga0065715_101010242 186
507 3300005295 Ga0065707_10317398 Ga0065707_103173981 186
508 3300005327 Ga0070658_10083116 Ga0070658_100831162 186
509 3300005328 Ga0070676_10025162 Ga0070676_100251623 186
510 3300005329 Ga0070683_100049423 Ga0070683_1000494233 186
511 3300005330 Ga0070690_100077086 Ga0070690_1000770862 186
512 3300005331 Ga0070670_100021244 Ga0070670_1000212443 186
513 3300005334 Ga0068869_100071961 Ga0068869_1000719613 186
514 3300005337 Ga0070682_100025959 Ga0070682_1000259594 186
515 3300005339 Ga0070660_100180944 Ga0070660_1001809442 186
516 3300005340 Ga0070689_100046712 Ga0070689_1000467123 186
517 3300005343 Ga0070687_100037647 Ga0070687_1000376472 186
518 3300005344 Ga0070661_100005344 Ga0070661_1000053443 186
519 3300005347 Ga0070668_100003459 Ga0070668_1000034598 186
520 3300005353 Ga0070669_100163854 Ga0070669_1001638541 186
521 3300005356 Ga0070674_100011032 Ga0070674_1000110327 186
522 3300005365 Ga0070688_100020259 Ga0070688_1000202594 186
523 3300005366 Ga0070659_100001874 Ga0070659_1000018745 186
524 3300005367 Ga0070667_100118694 Ga0070667_1001186941 186
525 3300005435 Ga0070714_100190622 Ga0070714_1001906221 186
526 3300005436 Ga0070713_100843497 Ga0070713_1008434971 186
527 3300005438 Ga0070701_10421555 Ga0070701_104215551 186
528 3300005455 Ga0070663_100015826 Ga0070663_1000158262 186
529 3300005456 Ga0070678_100017852 Ga0070678_1000178524 186
530 3300005459 Ga0068867_100029969 Ga0068867_1000299691 186
531 3300005466 Ga0070685_10000700 Ga0070685_1000070014 186
532 3300005535 Ga0070684_100050608 Ga0070684_1000506082 186
533 3300005539 Ga0068853_100003881 Ga0068853_1000038819 186
534 3300005543 Ga0070672_100012268 Ga0070672_1000122683 186
535 3300005544 Ga0070686_100003013 Ga0070686_1000030135 186
536 3300005564 Ga0070664_100950410 Ga0070664_1009504102 186
537 3300005577 Ga0068857_100003038 Ga0068857_10000303814 186
538 3300005614 Ga0068856_100009151 Ga0068856_1000091514 186
539 3300005616 Ga0068852_100032793 Ga0068852_1000327934 186
540 3300005617 Ga0068859_100132900 Ga0068859_1001329003 186
541 3300005618 Ga0068864_100067466 Ga0068864_1000674663 186
542 3300005718 Ga0068866_10000452 Ga0068866_1000045213 186
543 3300005719 Ga0068861_100031294 Ga0068861_1000312943 186
544 3300005840 Ga0068870_10002694 Ga0068870_100026948 186
545 3300005842 Ga0068858_100018183 Ga0068858_1000181832 186
546 3300005843 Ga0068860_100119468 Ga0068860_1001194682 186
547 3300005843 Ga0068860_100192819 Ga0068860_1001928192 186
548 3300005844 Ga0068862_100099717 Ga0068862_1000997174 186
549 3300005983 Ga0081540_1118985 Ga0081540_11189852 186
550 3300006028 Ga0070717_10472680 Ga0070717_104726801 186
551 3300006173 Ga0070716_100174340 Ga0070716_1001743402 186
552 3300006880 Ga0075429_101000398 Ga0075429_1010003981 186
553 3300006881 Ga0068865_100022980 Ga0068865_1000229802 186
554 3300006931 Ga0097620_100132911 Ga0097620_1001329113 186
555 3300009094 Ga0111539_11159947 Ga0111539_111599471 186
556 3300009094 Ga0111539_11418152 Ga0111539_114181521 186
557 3300009098 Ga0105245_10019131 Ga0105245_100191311 186
558 3300009101 Ga0105247_10072287 Ga0105247_100722872 186
559 3300009174 Ga0105241_10022255 Ga0105241_100222554 186
560 3300009176 Ga0105242_10007671 Ga0105242_100076716 186
561 3300009545 Ga0105237_10105265 Ga0105237_101052653 186
562 3300009551 Ga0105238_10265341 Ga0105238_102653413 186
563 3300009553 Ga0105249_10011435 Ga0105249_100114355 186
564 3300009553 Ga0105249_11088121 Ga0105249_110881211 186
565 3300010375 Ga0105239_10078560 Ga0105239_100785604 186
566 3300011119 Ga0105246_10281543 Ga0105246_102815431 186
567 3300013100 Ga0157373_10002653 Ga0157373_100026535 186
568 3300013105 Ga0157369_10146773 Ga0157369_101467731 186
569 3300013297 Ga0157378_10071976 Ga0157378_100719762 186
570 3300013307 Ga0157372_10033586 Ga0157372_100335865 186
571 3300013308 Ga0157375_10005888 Ga0157375_100058889 186
572 3300014325 Ga0163163_10000593 Ga0163163_1000059326 186
573 3300014325 Ga0163163_11130300 Ga0163163_111303001 186
574 3300014745 Ga0157377_10004015 Ga0157377_100040155 186
575 3300014968 Ga0157379_10023370 Ga0157379_100233702 186
576 3300014968 Ga0157379_10629160 Ga0157379_106291601 186
577 3300014969 Ga0157376_10005719 Ga0157376_100057192 186
578 3300014969 Ga0157376_10222717 Ga0157376_102227172 186
579 3300017792 Ga0163161_10010869 Ga0163161_100108695 186
580 3300025315 Ga0207697_10003082 Ga0207697_100030824 186
581 3300025899 Ga0207642_10001789 Ga0207642_100017892 186
582 3300025901 Ga0207688_10003396 Ga0207688_100033962 186
583 3300025904 Ga0207647_10006891 Ga0207647_100068915 186
584 3300025907 Ga0207645_10000054 Ga0207645_1000005444 186
585 3300025908 Ga0207643_10000357 Ga0207643_100003574 186
586 3300025915 Ga0207693_10565731 Ga0207693_105657312 186
587 3300025918 Ga0207662_10000665 Ga0207662_1000066512 186
588 3300025919 Ga0207657_10000255 Ga0207657_1000025545 186
589 3300025920 Ga0207649_10000195 Ga0207649_1000019536 186
590 3300025925 Ga0207650_10000042 Ga0207650_10000042106 186
591 3300025926 Ga0207659_10058271 Ga0207659_100582711 186
592 3300025927 Ga0207687_10018575 Ga0207687_100185752 186
593 3300025928 Ga0207700_10029295 Ga0207700_100292953 186
594 3300025929 Ga0207664_10065041 Ga0207664_100650414 186
595 3300025931 Ga0207644_10010266 Ga0207644_100102663 186
596 3300025933 Ga0207706_10000945 Ga0207706_1000094527 186
597 3300025934 Ga0207686_10167722 Ga0207686_101677222 186
598 3300025936 Ga0207670_10024052 Ga0207670_100240522 186
599 3300025937 Ga0207669_10010463 Ga0207669_100104634 186
600 3300025940 Ga0207691_10000051 Ga0207691_1000005131 186
601 3300025941 Ga0207711_10029474 Ga0207711_100294744 186
602 3300025942 Ga0207689_10000325 Ga0207689_100003259 186
603 3300025944 Ga0207661_10000084 Ga0207661_1000008412 186
604 3300025945 Ga0207679_10000050 Ga0207679_1000005013 186
605 3300025960 Ga0207651_10007772 Ga0207651_100077724 186
606 3300025961 Ga0207712_10095560 Ga0207712_100955602 186
607 3300025972 Ga0207668_10021597 Ga0207668_100215973 186
608 3300025986 Ga0207658_10012280 Ga0207658_100122804 186
609 3300026023 Ga0207677_10270779 Ga0207677_102707792 186
610 3300026035 Ga0207703_10052693 Ga0207703_100526933 186
611 3300026067 Ga0207678_10000023 Ga0207678_1000002326 186
612 3300026078 Ga0207702_10858700 Ga0207702_108587001 186
613 3300026088 Ga0207641_10000059 Ga0207641_1000005964 186
614 3300026088 Ga0207641_10053949 Ga0207641_100539492 186
615 3300026089 Ga0207648_10000041 Ga0207648_1000004116 186
616 3300026095 Ga0207676_10000080 Ga0207676_1000008064 186
617 3300026116 Ga0207674_10000047 Ga0207674_1000004737 186
618 3300026118 Ga0207675_100007292 Ga0207675_1000072925 186
619 3300026121 Ga0207683_10000017 Ga0207683_1000001731 186
620 3300026142 Ga0207698_10176934 Ga0207698_101769341 186
621 3300028379 Ga0268266_10002321 Ga0268266_100023219 186
622 3300028380 Ga0268265_10008423 Ga0268265_100084233 186
623 3300028381 Ga0268264_10018155 Ga0268264_100181553 186
624 3300046684 Ga0495669_0172841 Ga0495669_0172841_68_628 186
625 3300048905 Ga0496102_0028521 Ga0496102_0028521_3316_3876 186
626 3300048908 Ga0496105_0065836 Ga0496105_0065836_427_987 186
627 3300048909 Ga0496106_0492577 Ga0496106_0492577_293_853 186
628 3300048910 Ga0496107_0241591 Ga0496107_0241591_643_1203 186
629 3300048911 Ga0496108_0007842 Ga0496108_0007842_5164_5724 186
630 3300048912 Ga0496109_0000122 Ga0496109_0000122_4635_5195 186
631 3300048913 Ga0496110_0004464 Ga0496110_0004464_3108_3668 186
632 3300048914 Ga0496111_0005613 Ga0496111_0005613_2961_3521 186
633 3300048915 Ga0496112_0000027 Ga0496112_0000027_42537_43097 186
634 3300048916 Ga0496113_0003205 Ga0496113_0003205_3639_4199 186
635 3300048917 Ga0496114_0353963 Ga0496114_0353963_505_1065 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

37

189

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mt2-assembly1.cif.gz_B crystal structure of inorganic pyrophosphatase from medicago truncatula (i23 crystal form) 0.9238 1 177
5ls0-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase ppa1 from arabidopsis thaliana 0.9198 1 173
1ude-assembly1.cif.gz_C-2 crystal structure of the inorganic pyrophosphatase from the hyperthermophilic archaeon pyrococcus horikoshii ot3 0.9193 6 171
1twl-assembly1.cif.gz_A inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 0.919 4 174
6mt2-assembly2.cif.gz_D crystal structure of inorganic pyrophosphatase from medicago truncatula (i23 crystal form) 0.9163 2 177
ID Description Score Start End Superfamily
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9358 17 176 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9193 17 176 3.90.80.10
af_A0A0R0EZ04_29_196_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.914 1 166 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9086 2 175 3.90.80.10
2prdA00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9086 5 172 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A7J7NR96-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9547 79 166 GO:0000287
GO:0003700
GO:0004427
GO:0005634
GO:0005737
GO:0006796
GO:0016740
GO:0043565
AF-A0A5J5A4I9-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9463 73 177 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A834GV20-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9445 3 178 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A803LWU5-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9435 3 177 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A078H1Z4-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9424 3 177 GO:0000287
GO:0004427
GO:0005829
GO:0006796

Feature Viewer

pLDDT pTM Quality
85.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map