metagRoot

F471246

General Info

Members	Datasets	Scaffolds	Average Seq Length
635	298	635	79

Family's Representative Sequence

Representative Sequence	3300006353\|Ga0075370_10729595\|Ga0075370_107295952
Length	78
Sequence	VKATVHVFLKPGVLDVQGKAIENALHGLGWADVNHVRVGRVLEFEVGGDKATAETEVKAMCDKLLANTVIESYRVEIA

Samples

	Sample ID	Description	Type	Environment
1	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
2	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
3	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
4	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
5	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
22	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
23	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
24	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
25	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
26	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
29	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
30	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
31	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
32	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
33	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
34	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
35	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
36	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
37	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
38	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
39	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
40	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
41	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
42	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
43	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
44	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
45	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
46	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
47	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
48	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
49	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
50	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
51	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
52	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
53	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
54	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
55	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
56	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
58	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
59	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
60	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
61	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
62	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
63	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
65	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
66	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
67	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
68	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
69	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
70	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
71	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
72	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
73	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
74	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
75	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
76	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
77	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
78	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
79	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
80	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
81	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
82	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
83	3300015684	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02	Metagenome	Unclassified
84	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
85	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
86	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
87	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
88	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
141	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
150	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
151	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
152	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
153	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
154	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
155	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
156	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
157	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
158	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
159	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
160	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
161	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
162	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
163	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
164	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
165	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
166	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
167	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
168	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
169	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
170	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
171	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
172	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
173	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
175	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
176	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
177	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
178	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
179	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
180	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
181	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
182	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
183	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
184	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
185	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
186	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
187	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
188	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
189	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
190	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
191	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
192	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
193	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
194	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
195	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
196	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
197	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
198	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
199	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
200	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
201	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
202	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
203	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
204	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
205	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
206	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
207	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
208	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
209	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
210	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
211	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
212	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
213	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
214	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
215	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
216	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
217	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
218	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
219	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
220	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
221	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
222	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
223	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
224	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
225	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
226	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
227	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
228	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
229	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
230	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
231	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
232	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
233	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
234	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
235	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
236	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
237	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
238	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
239	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
240	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
241	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
242	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
243	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
244	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
245	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
246	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
247	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
248	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
249	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
255	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
258	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
260	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
261	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
262	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
263	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
264	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
265	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
266	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
267	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
268	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
269	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
270	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
271	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
272	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
273	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
274	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
275	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
276	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
277	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
278	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
279	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
280	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
281	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
282	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
283	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
284	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
285	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
286	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
287	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
288	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
289	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
290	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
291	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
292	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
293	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
294	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
295	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
296	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
297	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
298	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.76
Nodule	0.31
Rhizoplane	3.46
Rhizosphere	78.9
Stem	0
Stem Tuber	0
Unclassified	4.57

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24751J29686_10115751	3300002459	Bacteria	562
2	Ga0055530_10000085	3300003791	Bacteria	80382
3	Ga0055531_10014392	3300003794	Bacteria	3562
4	Ga0065165_1000414	3300005262	Bacteria	67711
5	Ga0065714_10199029	3300005288	Bacteria	901
6	Ga0070658_10055709	3300005327	Bacteria	3212
7	Ga0070658_10195977	3300005327	Bacteria	1703
8	Ga0070658_10209550	3300005327	Bacteria	1646
9	Ga0070658_10756955	3300005327	Bacteria	843
10	Ga0070658_11523774	3300005327	Bacteria	580
11	Ga0070683_100958960	3300005329	Bacteria	821
12	Ga0070683_101161489	3300005329	Bacteria	742
13	Ga0070670_100000269	3300005331	Bacteria	46231
14	Ga0070670_100017383	3300005331	Bacteria	6170
15	Ga0070670_100126673	3300005331	Bacteria	2204
16	Ga0070670_101776878	3300005331	Bacteria	568
17	Ga0070677_10196177	3300005333	Bacteria	971
18	Ga0068869_101078870	3300005334	Bacteria	702
19	Ga0070666_10204336	3300005335	Bacteria	1390
20	Ga0070680_100055506	3300005336	Bacteria	3237
21	Ga0070680_100171015	3300005336	Bacteria	1828
22	Ga0070680_100369507	3300005336	Bacteria	1220
23	Ga0068868_100939185	3300005338	Bacteria	788
24	Ga0068868_102127575	3300005338	Bacteria	534
25	Ga0070660_100023419	3300005339	Bacteria	4574
26	Ga0070660_100052235	3300005339	Bacteria	3150
27	Ga0070660_100112706	3300005339	Bacteria	2165
28	Ga0070660_100732740	3300005339	Bacteria	830
29	Ga0070660_101442153	3300005339	Bacteria	585
30	Ga0070691_10299895	3300005341	Bacteria	877
31	Ga0070687_101375546	3300005343	Bacteria	527
32	Ga0070661_101005574	3300005344	Bacteria	692
33	Ga0070668_100000972	3300005347	Bacteria	20064
34	Ga0070668_100005564	3300005347	Bacteria	9352
35	Ga0070668_100009955	3300005347	Bacteria	7042
36	Ga0070668_100023493	3300005347	Bacteria	4663
37	Ga0070668_100029059	3300005347	Bacteria	4197
38	Ga0070669_100012278	3300005353	Bacteria	6079
39	Ga0070671_100001866	3300005355	Bacteria	16097
40	Ga0070671_100898863	3300005355	Bacteria	773
41	Ga0070659_100000110	3300005366	Bacteria	60436
42	Ga0070659_100062282	3300005366	Bacteria	2948
43	Ga0070667_100000260	3300005367	Bacteria	60154
44	Ga0070667_100024934	3300005367	Bacteria	4968
45	Ga0070667_100201485	3300005367	Bacteria	1766
46	Ga0070667_100372735	3300005367	Bacteria	1295
47	Ga0070667_100802223	3300005367	Bacteria	874
48	Ga0070667_100910946	3300005367	Bacteria	819
49	Ga0070681_10072430	3300005458	Bacteria	3408
50	Ga0070681_10079032	3300005458	Bacteria	3246
51	Ga0070681_10137710	3300005458	Bacteria	2371
52	Ga0068867_102171647	3300005459	Bacteria	527
53	Ga0070698_100641739	3300005471	Bacteria	1003
54	Ga0070679_100013401	3300005530	Bacteria	7851
55	Ga0070679_100097803	3300005530	Bacteria	2922
56	Ga0070679_101260500	3300005530	Bacteria	685
57	Ga0070684_101267123	3300005535	Bacteria	694
58	Ga0068853_100223542	3300005539	Bacteria	1720
59	Ga0068853_100390705	3300005539	Bacteria	1301
60	Ga0068853_100953829	3300005539	Bacteria	825
61	Ga0068853_101393705	3300005539	Bacteria	678
62	Ga0068853_101477737	3300005539	Bacteria	658
63	Ga0070693_101526721	3300005547	Bacteria	523
64	Ga0070665_100000397	3300005548	Bacteria	64128
65	Ga0070665_100002230	3300005548	Bacteria	21591
66	Ga0070665_100010548	3300005548	Bacteria	9352
67	Ga0070665_100381027	3300005548	Bacteria	1418
68	Ga0070665_101047545	3300005548	Bacteria	828
69	Ga0070665_102234233	3300005548	Bacteria	551
70	Ga0070665_102621694	3300005548	Bacteria	505
71	Ga0068855_100017299	3300005563	Bacteria	8676
72	Ga0068855_100052253	3300005563	Bacteria	4811
73	Ga0068855_100084460	3300005563	Bacteria	3675
74	Ga0068855_100214350	3300005563	Bacteria	2162
75	Ga0068855_100706197	3300005563	Bacteria	1079
76	Ga0068855_100973513	3300005563	Bacteria	893
77	Ga0068855_101681374	3300005563	Bacteria	648
78	Ga0070664_100082604	3300005564	Bacteria	2771
79	Ga0068856_100211047	3300005614	Bacteria	1957
80	Ga0068856_100419854	3300005614	Bacteria	1358
81	Ga0068856_100441618	3300005614	Bacteria	1322
82	Ga0068856_101129729	3300005614	Bacteria	800
83	Ga0070702_100698545	3300005615	Bacteria	773
84	Ga0068852_100326917	3300005616	Bacteria	1491
85	Ga0068852_102640363	3300005616	Bacteria	522
86	Ga0068859_100000437	3300005617	Bacteria	41851
87	Ga0068859_100332465	3300005617	Bacteria	1614
88	Ga0068859_100476583	3300005617	Bacteria	1343
89	Ga0068864_100000292	3300005618	Bacteria	44496
90	Ga0068864_100000701	3300005618	Bacteria	28115
91	Ga0068864_100098135	3300005618	Bacteria	2594
92	Ga0068864_100351037	3300005618	Bacteria	1392
93	Ga0068864_101109499	3300005618	Bacteria	788
94	Ga0068864_102007092	3300005618	Bacteria	585
95	Ga0068861_100656055	3300005719	Bacteria	970
96	Ga0068861_102109032	3300005719	Bacteria	564
97	Ga0068870_11056313	3300005840	Bacteria	582
98	Ga0068863_100000864	3300005841	Bacteria	30310
99	Ga0068863_100001649	3300005841	Bacteria	22078
100	Ga0068863_100002531	3300005841	Bacteria	18136
101	Ga0068863_100185972	3300005841	Bacteria	1995
102	Ga0068863_100511862	3300005841	Bacteria	1183
103	Ga0068863_102269547	3300005841	Bacteria	552
104	Ga0068858_100000557	3300005842	Bacteria	38867
105	Ga0068858_100023551	3300005842	Bacteria	5735
106	Ga0068858_100351635	3300005842	Bacteria	1411
107	Ga0068860_100000309	3300005843	Bacteria	67252
108	Ga0068860_100001171	3300005843	Bacteria	28723
109	Ga0068860_100014375	3300005843	Bacteria	7757
110	Ga0068860_100838783	3300005843	Bacteria	933
111	Ga0068862_100001520	3300005844	Bacteria	21267
112	Ga0068862_100094791	3300005844	Bacteria	2603
113	Ga0068862_100753705	3300005844	Bacteria	947
114	Ga0081455_10990693	3300005937	Bacteria	520
115	Ga0070717_10096215	3300006028	Bacteria	2508
116	Ga0070717_10994750	3300006028	Bacteria	764
117	Ga0075365_10794299	3300006038	Bacteria	668
118	Ga0075368_10043878	3300006042	Bacteria	1763
119	Ga0075363_100019496	3300006048	Bacteria	3392
120	Ga0075363_100075324	3300006048	Bacteria	1839
121	Ga0075364_10000411	3300006051	Bacteria	21397
122	Ga0075362_10454951	3300006177	Bacteria	650
123	Ga0075367_10019300	3300006178	Bacteria	3779
124	Ga0075369_10099613	3300006186	Bacteria	1303
125	Ga0075366_10015743	3300006195	Bacteria	4341
126	Ga0075370_10471219	3300006353	Bacteria	756
127	Ga0075370_10729595	3300006353	Bacteria	603
128	Ga0068865_100000220	3300006881	Bacteria	31778
129	Ga0068865_100811857	3300006881	Bacteria	808
130	Ga0097620_100000437	3300006931	Bacteria	41851
131	Ga0097620_100332465	3300006931	Bacteria	1614
132	Ga0097620_100476560	3300006931	Bacteria	1343
133	Ga0079104_1064069	3300006946	Bacteria	785
134	Ga0105251_10277527	3300009011	Bacteria	757
135	Ga0105250_10007928	3300009092	Bacteria	4536
136	Ga0105240_10011242	3300009093	Bacteria	12482
137	Ga0105240_10140699	3300009093	Bacteria	2885
138	Ga0105240_10151331	3300009093	Bacteria	2763
139	Ga0105240_10188407	3300009093	Bacteria	2428
140	Ga0105240_10449291	3300009093	Bacteria	1443
141	Ga0105240_10562881	3300009093	Bacteria	1260
142	Ga0105240_10697233	3300009093	Bacteria	1109
143	Ga0105240_10820255	3300009093	Bacteria	1006
144	Ga0105240_10849385	3300009093	Bacteria	985
145	Ga0105245_10068449	3300009098	Bacteria	3217
146	Ga0105245_12428062	3300009098	Bacteria	578
147	Ga0105247_10084133	3300009101	Bacteria	2010
148	Ga0105247_11318309	3300009101	Bacteria	580
149	Ga0114129_13300058	3300009147	Bacteria	522
150	Ga0105241_11799050	3300009174	Bacteria	598
151	Ga0105241_12242571	3300009174	Bacteria	542
152	Ga0105242_10111600	3300009176	Bacteria	2332
153	Ga0105248_10001974	3300009177	Bacteria	22805
154	Ga0105248_10007729	3300009177	Bacteria	11806
155	Ga0105248_10008553	3300009177	Bacteria	11237
156	Ga0105248_10090101	3300009177	Bacteria	3453
157	Ga0105248_10138981	3300009177	Bacteria	2740
158	Ga0105248_10195628	3300009177	Bacteria	2278
159	Ga0105248_10233522	3300009177	Bacteria	2070
160	Ga0105248_10429532	3300009177	Bacteria	1488
161	Ga0105248_11052262	3300009177	Bacteria	919
162	Ga0105248_11514882	3300009177	Bacteria	759
163	Ga0105248_12181941	3300009177	Bacteria	630
164	Ga0105248_13372188	3300009177	Bacteria	508
165	Ga0105237_10307958	3300009545	Bacteria	1587
166	Ga0105237_10330236	3300009545	Bacteria	1529
167	Ga0105237_11830030	3300009545	Bacteria	615
168	Ga0105238_10010623	3300009551	Bacteria	9246
169	Ga0105238_10012057	3300009551	Bacteria	8708
170	Ga0105238_10053900	3300009551	Bacteria	4041
171	Ga0105238_10169895	3300009551	Bacteria	2156
172	Ga0105238_10291325	3300009551	Bacteria	1614
173	Ga0105238_11133140	3300009551	Bacteria	806
174	Ga0105238_11291171	3300009551	Bacteria	756
175	Ga0105238_11413898	3300009551	Bacteria	723
176	Ga0105238_11604141	3300009551	Bacteria	681
177	Ga0105249_10134316	3300009553	Bacteria	2366
178	Ga0105249_11390986	3300009553	Bacteria	774
179	Ga0105249_11969955	3300009553	Bacteria	657
180	Ga0105249_12819219	3300009553	Bacteria	557
181	Ga0105239_10926262	3300010375	Bacteria	1000
182	Ga0105239_11104339	3300010375	Bacteria	913
183	Ga0105239_12003151	3300010375	Bacteria	672
184	Ga0105246_11000834	3300011119	Bacteria	757
185	Ga0157371_10590317	3300013102	Bacteria	826
186	Ga0157370_10174170	3300013104	Bacteria	2000
187	Ga0157370_10416480	3300013104	Bacteria	1236
188	Ga0157370_11203610	3300013104	Bacteria	683
189	Ga0157370_11784168	3300013104	Bacteria	552
190	Ga0157369_10528718	3300013105	Bacteria	1220
191	Ga0157369_11224720	3300013105	Bacteria	766
192	Ga0157374_12342363	3300013296	Bacteria	561
193	Ga0157378_11170346	3300013297	Bacteria	808
194	Ga0157378_11963176	3300013297	Bacteria	635
195	Ga0163162_10016872	3300013306	Bacteria	7139
196	Ga0163162_10140125	3300013306	Bacteria	2531
197	Ga0163162_10347531	3300013306	Bacteria	1616
198	Ga0163162_10708266	3300013306	Bacteria	1128
199	Ga0157372_10157083	3300013307	Bacteria	2627
200	Ga0157372_10237060	3300013307	Bacteria	2116
201	Ga0157375_10810157	3300013308	Bacteria	1085
202	Ga0157375_11221437	3300013308	Bacteria	882
203	Ga0157375_11944499	3300013308	Bacteria	699
204	Ga0163163_10020803	3300014325	Bacteria	6186
205	Ga0163163_10124136	3300014325	Bacteria	2618
206	Ga0163163_10229724	3300014325	Bacteria	1904
207	Ga0163163_10419487	3300014325	Bacteria	1397
208	Ga0163163_10547255	3300014325	Bacteria	1220
209	Ga0163163_12937818	3300014325	Bacteria	532
210	Ga0157380_11708489	3300014326	Bacteria	687
211	Ga0157380_11728351	3300014326	Bacteria	684
212	Ga0157379_10000967	3300014968	Bacteria	23322
213	Ga0157379_10428327	3300014968	Bacteria	1219
214	Ga0157379_10430234	3300014968	Bacteria	1216
215	Ga0157379_12261181	3300014968	Bacteria	541
216	Ga0183365_10003	3300015684	Bacteria	414944
217	Ga0163161_11900195	3300017792	Bacteria	530
218	Ga0213872_10006135	3300021361	Bacteria	6075
219	Ga0213872_10009066	3300021361	Bacteria	4784
220	Ga0213872_10384588	3300021361	Bacteria	571
221	Ga0213876_10078197	3300021384	Bacteria	1748
222	Ga0209026_1009073	3300025250	Bacteria	1996
223	Ga0209148_1020472	3300025254	Bacteria	1087
224	Ga0209455_1044586	3300025272	Bacteria	653
225	Ga0209758_1000555	3300025297	Bacteria	59166
226	Ga0209050_1000034	3300025298	Bacteria	433906
227	Ga0209257_1000052	3300025304	Bacteria	430947
228	Ga0209257_1000100	3300025304	Bacteria	253399
229	Ga0209257_1000618	3300025304	Bacteria	57657
230	Ga0207697_10509432	3300025315	Bacteria	531
231	Ga0207696_1039970	3300025711	Bacteria	1376
232	Ga0207682_10148450	3300025893	Bacteria	1056
233	Ga0207710_10064012	3300025900	Bacteria	1674
234	Ga0207710_10092409	3300025900	Bacteria	1418
235	Ga0207680_10183678	3300025903	Bacteria	1416
236	Ga0207680_10284506	3300025903	Bacteria	1149
237	Ga0207680_10313500	3300025903	Bacteria	1096
238	Ga0207643_10256204	3300025908	Bacteria	1079
239	Ga0207705_10001713	3300025909	Bacteria	17393
240	Ga0207705_10080006	3300025909	Bacteria	2381
241	Ga0207705_10341756	3300025909	Bacteria	1152
242	Ga0207705_10974768	3300025909	Bacteria	655
243	Ga0207654_10516110	3300025911	Bacteria	845
244	Ga0207707_10039763	3300025912	Bacteria	4110
245	Ga0207707_11527484	3300025912	Bacteria	528
246	Ga0207695_10002720	3300025913	Bacteria	25817
247	Ga0207695_10020630	3300025913	Bacteria	7543
248	Ga0207695_10020683	3300025913	Bacteria	7531
249	Ga0207695_10026342	3300025913	Bacteria	6490
250	Ga0207695_10060209	3300025913	Bacteria	3931
251	Ga0207695_10503661	3300025913	Bacteria	1093
252	Ga0207695_10573462	3300025913	Bacteria	1010
253	Ga0207671_11234111	3300025914	Bacteria	584
254	Ga0207660_10002249	3300025917	Bacteria	12755
255	Ga0207660_10029223	3300025917	Bacteria	3778
256	Ga0207660_10383918	3300025917	Bacteria	1129
257	Ga0207657_10020343	3300025919	Bacteria	6274
258	Ga0207657_10039946	3300025919	Bacteria	4162
259	Ga0207657_10629744	3300025919	Bacteria	836
260	Ga0207657_10741153	3300025919	Bacteria	761
261	Ga0207649_10488543	3300025920	Bacteria	935
262	Ga0207649_10911053	3300025920	Bacteria	689
263	Ga0207652_10012726	3300025921	Bacteria	6803
264	Ga0207652_10024226	3300025921	Bacteria	5034
265	Ga0207652_11341976	3300025921	Bacteria	618
266	Ga0207681_10002433	3300025923	Bacteria	11804
267	Ga0207681_10130239	3300025923	Bacteria	1859
268	Ga0207694_10017775	3300025924	Bacteria	5373
269	Ga0207694_10044211	3300025924	Bacteria	3440
270	Ga0207694_10223986	3300025924	Bacteria	1535
271	Ga0207694_10718339	3300025924	Bacteria	843
272	Ga0207694_11356549	3300025924	Bacteria	601
273	Ga0207694_11706163	3300025924	Bacteria	530
274	Ga0207650_10001082	3300025925	Bacteria	20166
275	Ga0207650_10034347	3300025925	Bacteria	3677
276	Ga0207650_10127772	3300025925	Bacteria	1986
277	Ga0207659_11201457	3300025926	Bacteria	652
278	Ga0207687_10091822	3300025927	Bacteria	2215
279	Ga0207644_10001126	3300025931	Bacteria	17127
280	Ga0207644_10181387	3300025931	Bacteria	1650
281	Ga0207690_10000584	3300025932	Bacteria	23588
282	Ga0207690_10032517	3300025932	Bacteria	3348
283	Ga0207706_10512905	3300025933	Bacteria	1034
284	Ga0207686_10127411	3300025934	Bacteria	1742
285	Ga0207704_10001287	3300025938	Bacteria	11216
286	Ga0207704_10695533	3300025938	Bacteria	841
287	Ga0207691_10989701	3300025940	Bacteria	702
288	Ga0207711_10001161	3300025941	Bacteria	25066
289	Ga0207711_10002832	3300025941	Bacteria	15237
290	Ga0207711_10014921	3300025941	Bacteria	6454
291	Ga0207711_10036004	3300025941	Bacteria	4198
292	Ga0207711_10045345	3300025941	Bacteria	3757
293	Ga0207711_10108919	3300025941	Bacteria	2461
294	Ga0207711_10425795	3300025941	Bacteria	1235
295	Ga0207711_10456341	3300025941	Bacteria	1190
296	Ga0207711_11197208	3300025941	Bacteria	701
297	Ga0207689_10338802	3300025942	Bacteria	1249
298	Ga0207689_11202241	3300025942	Bacteria	638
299	Ga0207661_11309313	3300025944	Bacteria	666
300	Ga0207661_11679594	3300025944	Bacteria	580
301	Ga0207679_10943647	3300025945	Bacteria	790
302	Ga0207679_11221905	3300025945	Bacteria	690
303	Ga0207667_10022145	3300025949	Bacteria	7029
304	Ga0207667_10023707	3300025949	Bacteria	6756
305	Ga0207667_10378033	3300025949	Bacteria	1443
306	Ga0207667_10391784	3300025949	Bacteria	1415
307	Ga0207667_10505554	3300025949	Bacteria	1225
308	Ga0207667_10556250	3300025949	Bacteria	1160
309	Ga0207651_10107728	3300025960	Bacteria	2084
310	Ga0207651_10688746	3300025960	Bacteria	900
311	Ga0207712_10000569	3300025961	Bacteria	29784
312	Ga0207712_10379287	3300025961	Bacteria	1183
313	Ga0207712_10379310	3300025961	Bacteria	1183
314	Ga0207712_10743634	3300025961	Bacteria	859
315	Ga0207712_11665186	3300025961	Bacteria	572
316	Ga0207668_10000003	3300025972	Bacteria	206959
317	Ga0207668_10000678	3300025972	Bacteria	20916
318	Ga0207668_10003216	3300025972	Bacteria	9571
319	Ga0207668_10025540	3300025972	Bacteria	3824
320	Ga0207668_10059324	3300025972	Bacteria	2680
321	Ga0207640_11017741	3300025981	Bacteria	729
322	Ga0207640_11877389	3300025981	Bacteria	542
323	Ga0207658_10001842	3300025986	Bacteria	15879
324	Ga0207658_10028893	3300025986	Bacteria	3908
325	Ga0207658_10035086	3300025986	Bacteria	3590
326	Ga0207658_10097732	3300025986	Bacteria	2293
327	Ga0207658_10289800	3300025986	Bacteria	1406
328	Ga0207658_12044026	3300025986	Bacteria	521
329	Ga0207677_11383991	3300026023	Bacteria	648
330	Ga0207703_10001508	3300026035	Bacteria	21233
331	Ga0207703_10008480	3300026035	Bacteria	8122
332	Ga0207703_10324362	3300026035	Bacteria	1411
333	Ga0207639_10070826	3300026041	Bacteria	2725
334	Ga0207639_10819983	3300026041	Bacteria	867
335	Ga0207639_11013478	3300026041	Bacteria	778
336	Ga0207639_11078924	3300026041	Bacteria	753
337	Ga0207678_10486934	3300026067	Bacteria	1074
338	Ga0207678_11274729	3300026067	Bacteria	650
339	Ga0207702_10200335	3300026078	Bacteria	1850
340	Ga0207702_10332149	3300026078	Bacteria	1450
341	Ga0207702_11517374	3300026078	Bacteria	663
342	Ga0207641_10000067	3300026088	Bacteria	155379
343	Ga0207641_10002338	3300026088	Bacteria	17553
344	Ga0207641_10002399	3300026088	Bacteria	17295
345	Ga0207641_10168238	3300026088	Bacteria	1998
346	Ga0207641_10753704	3300026088	Bacteria	961
347	Ga0207641_11393936	3300026088	Bacteria	702
348	Ga0207641_12071417	3300026088	Bacteria	570
349	Ga0207641_12196238	3300026088	Bacteria	552
350	Ga0207648_11661511	3300026089	Bacteria	600
351	Ga0207676_10000285	3300026095	Bacteria	43703
352	Ga0207676_10001669	3300026095	Bacteria	16357
353	Ga0207676_10034914	3300026095	Bacteria	3811
354	Ga0207676_10075226	3300026095	Bacteria	2723
355	Ga0207676_10365791	3300026095	Bacteria	1338
356	Ga0207676_11268812	3300026095	Bacteria	731
357	Ga0207676_12293422	3300026095	Bacteria	537
358	Ga0207674_12233029	3300026116	Bacteria	510
359	Ga0207675_100101568	3300026118	Bacteria	2710
360	Ga0207675_102739905	3300026118	Bacteria	501
361	Ga0207698_10333105	3300026142	Bacteria	1426
362	Ga0207698_12067678	3300026142	Bacteria	583
363	Ga0207698_12677843	3300026142	Bacteria	508
364	Ga0209281_1043232	3300027111	Bacteria	748
365	Ga0209981_1000496	3300027378	Bacteria	5012
366	Ga0209996_1012548	3300027395	Bacteria	1139
367	Ga0210000_1014014	3300027462	Bacteria	1199
368	Ga0209983_1006201	3300027665	Bacteria	2462
369	Ga0209813_10000832	3300027866	Bacteria	6966
370	Ga0268266_10000062	3300028379	Bacteria	253490
371	Ga0268266_10001802	3300028379	Bacteria	24277
372	Ga0268266_10027274	3300028379	Bacteria	4857
373	Ga0268265_10007726	3300028380	Bacteria	7257
374	Ga0268265_10024304	3300028380	Bacteria	4285
375	Ga0268265_10268181	3300028380	Bacteria	1521
376	Ga0268265_10399192	3300028380	Bacteria	1270
377	Ga0268265_10934295	3300028380	Bacteria	853
378	Ga0268264_10000029	3300028381	Bacteria	419246
379	Ga0268264_10000118	3300028381	Bacteria	193487
380	Ga0268264_10012713	3300028381	Bacteria	6926
381	Ga0268264_10130162	3300028381	Bacteria	2229
382	Ga0265319_1285557	3300028563	Bacteria	502
383	Ga0307517_10008037	3300028786	Bacteria	15213
384	Ga0307517_10318573	3300028786	Bacteria	862
385	Ga0307517_10496843	3300028786	Bacteria	622
386	Ga0307517_10632504	3300028786	Bacteria	523
387	Ga0307515_10776867	3300028794	Bacteria	579
388	Ga0265338_10045115	3300028800	Bacteria	4058
389	Ga0265338_10180050	3300028800	Bacteria	1612
390	Ga0265338_10220048	3300028800	Bacteria	1419
391	Ga0265338_10327086	3300028800	Bacteria	1108
392	Ga0265338_10639922	3300028800	Bacteria	738
393	Ga0307511_10007505	3300030521	Bacteria	10961
394	Ga0265320_10041528	3300031240	Bacteria	2286
395	Ga0265340_10188897	3300031247	Bacteria	929
396	Ga0265327_10000334	3300031251	Bacteria	89444
397	Ga0265327_10003351	3300031251	Bacteria	15437
398	Ga0265327_10003793	3300031251	Bacteria	13998
399	Ga0265327_10218574	3300031251	Bacteria	857
400	Ga0265327_10345246	3300031251	Bacteria	651
401	Ga0265327_10464171	3300031251	Bacteria	547
402	Ga0307513_10000414	3300031456	Bacteria	61908
403	Ga0307513_10000431	3300031456	Bacteria	60478
404	Ga0307513_10004565	3300031456	Bacteria	18461
405	Ga0307513_10013540	3300031456	Bacteria	10004
406	Ga0307408_101035633	3300031548	Bacteria	758
407	Ga0307408_101367794	3300031548	Bacteria	665
408	Ga0307408_102143961	3300031548	Bacteria	539
409	Ga0265314_10408952	3300031711	Bacteria	732
410	Ga0265314_10487982	3300031711	Bacteria	650
411	Ga0307516_10000084	3300031730	Bacteria	104156
412	Ga0307413_10052501	3300031824	Bacteria	2462
413	Ga0307413_10105642	3300031824	Bacteria	1872
414	Ga0307413_10822283	3300031824	Bacteria	783
415	Ga0307410_10656612	3300031852	Bacteria	880
416	Ga0307410_11987610	3300031852	Bacteria	519
417	Ga0307412_11405643	3300031911	Bacteria	632
418	Ga0307412_12282959	3300031911	Bacteria	505
419	Ga0307414_10205762	3300032004	Bacteria	1605
420	Ga0307411_11566667	3300032005	Bacteria	607
421	Ga0307415_102426076	3300032126	Bacteria	516
422	Ga0307510_10012897	3300033180	Bacteria	9920
423	Ga0307510_10065924	3300033180	Bacteria	3661
424	Ga0373944_0077699	3300035089	Bacteria	1091
425	Ga0373951_0293447	3300035091	Bacteria	500
426	Ga0373936_0007882	3300035113	Bacteria	4001
427	Ga0373927_0010387	3300035695	Bacteria	6213
428	Ga0373947_0602014	3300035725	Bacteria	749
429	Ga0373925_0000335	3300037068	Bacteria	48779
430	Ga0373925_0565154	3300037068	Bacteria	936
431	Ga0395899_0000895	3300037312	Bacteria	28156
432	Ga0395899_0088757	3300037312	Bacteria	2243
433	Ga0395899_0105875	3300037312	Bacteria	2025
434	Ga0395899_0280450	3300037312	Bacteria	1134
435	Ga0395899_0362191	3300037312	Bacteria	967
436	Ga0395900_0000004	3300037418	Bacteria	564908
437	Ga0395900_0165938	3300037418	Bacteria	2250
438	Ga0395900_0317706	3300037418	Bacteria	1538
439	Ga0395900_0363084	3300037418	Bacteria	1419
440	Ga0395900_0565463	3300037418	Bacteria	1080
441	Ga0395900_1230764	3300037418	Bacteria	664
442	Ga0395898_0022116	3300037466	Bacteria	6442
443	Ga0395898_0032821	3300037466	Bacteria	5183
444	Ga0395898_0157201	3300037466	Bacteria	2174
445	Ga0395898_0244721	3300037466	Bacteria	1710
446	Ga0395898_0972958	3300037466	Bacteria	785
447	Ga0395905_0000741	3300037471	Bacteria	42960
448	Ga0395905_0001873	3300037471	Bacteria	24218
449	Ga0395905_0002293	3300037471	Bacteria	21470
450	Ga0395905_0084433	3300037471	Bacteria	2975
451	Ga0395905_0099176	3300037471	Bacteria	2736
452	Ga0395905_0256749	3300037471	Bacteria	1632
453	Ga0395905_0456292	3300037471	Bacteria	1176
454	Ga0436364_0748094	3300037853	Bacteria	597
455	Ga0436364_0846216	3300037853	Bacteria	1736
456	Ga0395901_0000005	3300038443	Bacteria	544998
457	Ga0395901_0187383	3300038443	Bacteria	2170
458	Ga0395901_0576326	3300038443	Bacteria	1137
459	Ga0395901_2080168	3300038443	Bacteria	513
460	Ga0237816_04243	3300039145	Bacteria	1004
461	Ga0436365_0286511	3300039437	Bacteria	5976
462	Ga0436365_0481007	3300039437	Bacteria	539
463	Ga0436360_0522747	3300039438	Bacteria	519
464	Ga0436361_0211898	3300039447	Bacteria	20898
465	Ga0436361_0310224	3300039447	Bacteria	2903
466	Ga0436361_0322295	3300039447	Bacteria	1355
467	Ga0436361_1000218	3300039447	Bacteria	4395
468	Ga0436361_1115153	3300039447	Bacteria	1422
469	Ga0436363_1478581	3300039450	Bacteria	650
470	Ga0436362_0401145	3300039453	Bacteria	1324
471	Ga0451797_0813586	3300041453	Bacteria	718
472	Ga0451798_0727701	3300041458	Bacteria	544
473	Ga0451807_2441666	3300041486	Bacteria	798
474	Ga0451855_1944746	3300041511	Bacteria	572
475	Ga0451853_0274023	3300041512	Bacteria	667
476	Ga0439434_0209747	3300042435	Bacteria	659
477	Ga0466969_0000296	3300044656	Bacteria	27238
478	Ga0466969_0111985	3300044656	Bacteria	1277
479	Ga0466972_0475103	3300044658	Bacteria	588
480	Ga0466966_0000163	3300044684	Bacteria	43388
481	Ga0466961_0009024	3300044693	Bacteria	6360
482	Ga0466961_0292156	3300044693	Bacteria	997
483	Ga0466961_0835112	3300044693	Bacteria	549
484	Ga0466963_0066983	3300044694	Bacteria	2409
485	Ga0466964_0824478	3300044706	Bacteria	526
486	Ga0453684_0882718	3300044712	Bacteria	959
487	Ga0466971_0002014	3300044719	Bacteria	8595
488	Ga0466968_0173920	3300044735	Bacteria	999
489	Ga0466970_0007969	3300044765	Bacteria	5319
490	Ga0466957_0059577	3300044842	Bacteria	2340
491	Ga0466957_1030356	3300044842	Bacteria	592
492	Ga0466959_0000071	3300045049	Bacteria	68513
493	Ga0466959_0223741	3300045049	Bacteria	1304
494	Ga0466959_1168702	3300045049	Bacteria	511
495	Ga0466958_0000501	3300045836	Bacteria	16450
496	Ga0495629_0044601	3300046459	Bacteria	3112
497	Ga0495594_0103703	3300046499	Bacteria	1601
498	Ga0495583_0365611	3300046506	Bacteria	568
499	Ga0495606_0189726	3300046507	Bacteria	1179
500	Ga0495620_0009858	3300046515	Bacteria	5061
501	Ga0495628_0456889	3300046516	Bacteria	927
502	Ga0495643_0017514	3300046522	Bacteria	4187
503	Ga0495643_0059011	3300046522	Bacteria	2040
504	Ga0495644_0187520	3300046523	Bacteria	796
505	Ga0495644_0297015	3300046523	Bacteria	632
506	Ga0495609_0096956	3300046538	Bacteria	1279
507	Ga0495597_0002249	3300046542	Bacteria	12585
508	Ga0495645_0273221	3300046543	Bacteria	1115
509	Ga0495622_0020497	3300046557	Bacteria	3078
510	Ga0495668_0030658	3300046616	Bacteria	3035
511	Ga0495668_0060258	3300046616	Bacteria	2094
512	Ga0495611_0030731	3300046648	Bacteria	2363
513	Ga0495611_0451588	3300046648	Bacteria	586
514	Ga0495625_0082761	3300046660	Bacteria	2231
515	Ga0495625_0335197	3300046660	Bacteria	960
516	Ga0495635_1018312	3300046663	Bacteria	527
517	Ga0495659_0288720	3300046664	Bacteria	691
518	Ga0495588_0166246	3300046674	Bacteria	1167
519	Ga0495623_0476282	3300046679	Bacteria	662
520	Ga0495669_0009513	3300046684	Bacteria	4099
521	Ga0495669_0018641	3300046684	Bacteria	2986
522	Ga0495669_0037381	3300046684	Bacteria	2149
523	Ga0495669_0060153	3300046684	Bacteria	1717
524	Ga0495674_0887642	3300047319	Bacteria	689
525	Ga0495672_0090149	3300047320	Bacteria	1686
526	Ga0495687_165145	3300047443	Bacteria	740
527	Ga0495677_0188917	3300047445	Bacteria	799
528	Ga0495681_0167263	3300047470	Bacteria	912
529	Ga0495686_0011624	3300047472	Bacteria	6197
530	Ga0495686_0189327	3300047472	Bacteria	1187
531	Ga0495686_0310316	3300047472	Bacteria	868
532	Ga0495593_0040462	3300047673	Bacteria	2510
533	Ga0495602_0622518	3300048088	Bacteria	740
534	Ga0496100_1129691	3300048903	Bacteria	618
535	Ga0496101_1146245	3300048904	Bacteria	610
536	Ga0496102_0082676	3300048905	Bacteria	2962
537	Ga0496102_0278484	3300048905	Bacteria	1577
538	Ga0496103_0195372	3300048906	Bacteria	1301
539	Ga0496105_0419512	3300048908	Bacteria	1060
540	Ga0496106_0134931	3300048909	Bacteria	1938
541	Ga0496106_0659323	3300048909	Bacteria	836
542	Ga0496106_1156835	3300048909	Bacteria	605
543	Ga0496109_0014673	3300048912	Bacteria	6819
544	Ga0496112_0083255	3300048915	Bacteria	3164
545	Ga0496112_0091898	3300048915	Bacteria	3004
546	Ga0496112_0266435	3300048915	Bacteria	1662
547	Ga0496113_0804474	3300048916	Bacteria	747
548	Ga0496114_0673519	3300048917	Bacteria	909
549	Ga0496115_0006140	3300048918	Bacteria	8784
550	Ga0496115_0018955	3300048918	Bacteria	5293
551	Ga0496115_0127496	3300048918	Bacteria	2097
552	Ga0496115_0313975	3300048918	Bacteria	1283
553	Ga0496116_0107994	3300048919	Bacteria	1644
554	Ga0496117_0016145	3300048920	Bacteria	6316
555	Ga0496118_0015716	3300048921	Bacteria	6988
556	Ga0496121_0000053	3300048924	Bacteria	312611
557	Ga0496125_0130188	3300048928	Bacteria	1773
558	Ga0501032_0013853	3300049569	Bacteria	5722
559	Ga0501033_0334194	3300049570	Bacteria	1063
560	Ga0501033_0427250	3300049570	Bacteria	922
561	Ga0501034_0045533	3300049571	Bacteria	4433
562	Ga0501034_1234270	3300049571	Bacteria	626
563	Ga0501034_1713986	3300049571	Bacteria	501
564	Ga0501043_0461961	3300049579	Bacteria	952
565	Ga0501043_0970078	3300049579	Bacteria	606
566	Ga0501046_0262303	3300049580	Bacteria	1269
567	Ga0501047_0000584	3300049581	Bacteria	38737
568	Ga0501047_0112105	3300049581	Bacteria	2610
569	Ga0501047_0228141	3300049581	Bacteria	1717
570	Ga0501048_0535612	3300049582	Bacteria	840
571	Ga0501074_0748988	3300049590	Bacteria	689
572	Ga0501257_002439	3300049686	Bacteria	3919
573	Ga0501044_0002720	3300049823	Bacteria	20109
574	Ga0501044_0190460	3300049823	Bacteria	2014
575	nmdc:mga03683_110517_c1	3300050489	Bacteria	1215
576	nmdc:mga03n38_118046_c1	3300050490	Bacteria	1300
577	nmdc:mga03n38_5664_c1	3300050490	Bacteria	4274
578	nmdc:mga03n38_699934_c1	3300050490	Bacteria	584
579	nmdc:mga00v17_528_c1	3300050491	Bacteria	21420
580	nmdc:mga0k408_107595_c1	3300050493	Bacteria	1647
581	nmdc:mga0k408_27199_c1	3300050493	Bacteria	3247
582	nmdc:mga0k408_77315_c1	3300050493	Bacteria	1442
583	nmdc:mga06z11_13093_c1	3300050494	Bacteria	3631
584	nmdc:mga04h51_1988_c1	3300050495	Bacteria	4777
585	nmdc:mga07m45_179071_c1	3300050496	Bacteria	1233
586	nmdc:mga07m45_23319_c1	3300050496	Bacteria	3383
587	nmdc:mga07m45_517119_c1	3300050496	Bacteria	691
588	nmdc:mga0sz30_90039_c1	3300050516	Bacteria	1334
589	Ga0500635_0000253	3300053080	Bacteria	22197
590	Ga0500635_0000624	3300053080	Bacteria	9237
591	Ga0495655_0193001	3300053083	Bacteria	662
592	Ga0500578_0660350	3300053086	Bacteria	567
593	Ga0500643_000966	3300053087	Bacteria	17836
594	Ga0500643_020603	3300053087	Bacteria	2151
595	Ga0500647_0065112	3300053091	Bacteria	1753
596	Ga0500647_0127866	3300053091	Bacteria	1199
597	Ga0500583_0250749	3300053092	Bacteria	874
598	Ga0500651_0254924	3300053093	Bacteria	1019
599	Ga0500566_0253889	3300053094	Bacteria	853
600	Ga0500641_0025993	3300053096	Bacteria	2269
601	Ga0500641_0213740	3300053096	Bacteria	820
602	Ga0500555_057131	3300053103	Bacteria	1056
603	Ga0500555_142345	3300053103	Bacteria	590
604	Ga0500556_0036325	3300053104	Bacteria	1708
605	Ga0500562_000374	3300053108	Bacteria	10829
606	Ga0500562_015641	3300053108	Bacteria	1947
607	Ga0500572_114110	3300053111	Bacteria	871
608	Ga0500594_0090111	3300053118	Bacteria	930
609	Ga0500595_006224	3300053119	Bacteria	5096
610	Ga0500595_010331	3300053119	Bacteria	3716
611	Ga0500595_021191	3300053119	Bacteria	2324
612	Ga0500595_215599	3300053119	Bacteria	528
613	Ga0500607_181340	3300053121	Bacteria	933
614	Ga0500608_000192	3300053122	Bacteria	24509
615	Ga0500608_003747	3300053122	Bacteria	5762
616	Ga0500608_140318	3300053122	Bacteria	1072
617	Ga0500614_007444	3300053123	Bacteria	2309
618	Ga0500642_0384636	3300053130	Bacteria	616
619	Ga0500658_0223227	3300053134	Bacteria	864
620	Ga0500559_0009083	3300053136	Bacteria	4318
621	Ga0500559_0185471	3300053136	Bacteria	980
622	Ga0500590_061433	3300053148	Bacteria	1886
623	Ga0500619_011874	3300053154	Bacteria	2256
624	Ga0500620_069210	3300053155	Bacteria	1212
625	Ga0500638_145838	3300053162	Bacteria	1058
626	Ga0500638_229544	3300053162	Bacteria	763
627	Ga0500639_186896	3300053163	Bacteria	908
628	Ga0500636_0015023	3300053177	Bacteria	4558
629	Ga0500636_0106885	3300053177	Bacteria	1585
630	Ga0500637_0230343	3300053178	Bacteria	1043
631	Ga0500645_006057	3300053730	Bacteria	4365
632	Ga0500645_009219	3300053730	Bacteria	3325
633	Ga0500596_003741	3300053735	Bacteria	2853
634	Ga0500601_021953	3300053737	Bacteria	738
635	Ga0466962_0000476	3300061719	Bacteria	17393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031251	Ga0265327_10003351	Ga0265327_1000335112	68
2	3300053162	Ga0500638_145838	Ga0500638_145838_429_668	72
3	3300014325	Ga0163163_10229724	Ga0163163_102297243	73
4	3300037312	Ga0395899_0280450	Ga0395899_0280450_153_374	73
5	3300037418	Ga0395900_0363084	Ga0395900_0363084_414_635	73
6	3300044735	Ga0466968_0173920	Ga0466968_0173920_619_840	73
7	3300044842	Ga0466957_1030356	Ga0466957_1030356_340_561	73
8	3300045049	Ga0466959_1168702	Ga0466959_1168702_267_488	73
9	3300046684	Ga0495669_0018641	Ga0495669_0018641_117_338	73
10	3300047445	Ga0495677_0188917	Ga0495677_0188917_14_235	73
11	3300049582	Ga0501048_0535612	Ga0501048_0535612_607_828	73
12	3300053104	Ga0500556_0036325	Ga0500556_0036325_1380_1601	73
13	3300053730	Ga0500645_009219	Ga0500645_009219_2649_2879	75
14	3300005937	Ga0081455_10990693	Ga0081455_109906931	77
15	3300009174	Ga0105241_12242571	Ga0105241_122425712	77
16	3300031852	Ga0307410_11987610	Ga0307410_119876102	77
17	3300039437	Ga0436365_0481007	Ga0436365_0481007_242_475	77
18	3300039450	Ga0436363_1478581	Ga0436363_1478581_14_250	77
19	3300049571	Ga0501034_1713986	Ga0501034_1713986_85_318	77
20	3300006353	Ga0075370_10729595	Ga0075370_107295952	78
21	3300039145	Ga0237816_04243	Ga0237816_04243_702_938	78
22	3300053096	Ga0500641_0213740	Ga0500641_0213740_543_779	78
23	3300002459	JGI24751J29686_10115751	JGI24751J29686_101157511	79
24	3300003791	Ga0055530_10000085	Ga0055530_1000008528	79
25	3300003794	Ga0055531_10014392	Ga0055531_100143924	79
26	3300005262	Ga0065165_1000414	Ga0065165_10004145	79
27	3300005288	Ga0065714_10199029	Ga0065714_101990291	79
28	3300005327	Ga0070658_10055709	Ga0070658_100557094	79
29	3300005327	Ga0070658_10195977	Ga0070658_101959772	79
30	3300005327	Ga0070658_10209550	Ga0070658_102095502	79
31	3300005327	Ga0070658_10756955	Ga0070658_107569552	79
32	3300005327	Ga0070658_11523774	Ga0070658_115237742	79
33	3300005329	Ga0070683_100958960	Ga0070683_1009589602	79
34	3300005329	Ga0070683_101161489	Ga0070683_1011614892	79
35	3300005331	Ga0070670_100000269	Ga0070670_1000002697	79
36	3300005331	Ga0070670_100017383	Ga0070670_1000173838	79
37	3300005331	Ga0070670_100126673	Ga0070670_1001266733	79
38	3300005331	Ga0070670_101776878	Ga0070670_1017768781	79
39	3300005333	Ga0070677_10196177	Ga0070677_101961772	79
40	3300005334	Ga0068869_101078870	Ga0068869_1010788702	79
41	3300005335	Ga0070666_10204336	Ga0070666_102043361	79
42	3300005336	Ga0070680_100055506	Ga0070680_1000555064	79
43	3300005336	Ga0070680_100171015	Ga0070680_1001710152	79
44	3300005336	Ga0070680_100369507	Ga0070680_1003695072	79
45	3300005338	Ga0068868_100939185	Ga0068868_1009391852	79
46	3300005338	Ga0068868_102127575	Ga0068868_1021275751	79
47	3300005339	Ga0070660_100023419	Ga0070660_1000234195	79
48	3300005339	Ga0070660_100052235	Ga0070660_1000522354	79
49	3300005339	Ga0070660_100112706	Ga0070660_1001127063	79
50	3300005339	Ga0070660_100732740	Ga0070660_1007327402	79
51	3300005339	Ga0070660_101442153	Ga0070660_1014421532	79
52	3300005341	Ga0070691_10299895	Ga0070691_102998952	79
53	3300005343	Ga0070687_101375546	Ga0070687_1013755462	79
54	3300005344	Ga0070661_101005574	Ga0070661_1010055741	79
55	3300005347	Ga0070668_100000972	Ga0070668_1000009722	79
56	3300005347	Ga0070668_100005564	Ga0070668_1000055642	79
57	3300005347	Ga0070668_100009955	Ga0070668_1000099557	79
58	3300005347	Ga0070668_100023493	Ga0070668_1000234932	79
59	3300005347	Ga0070668_100029059	Ga0070668_1000290595	79
60	3300005353	Ga0070669_100012278	Ga0070669_1000122783	79
61	3300005355	Ga0070671_100001866	Ga0070671_10000186618	79
62	3300005355	Ga0070671_100898863	Ga0070671_1008988632	79
63	3300005366	Ga0070659_100000110	Ga0070659_1000001102	79
64	3300005366	Ga0070659_100062282	Ga0070659_1000622825	79
65	3300005367	Ga0070667_100000260	Ga0070667_1000002602	79
66	3300005367	Ga0070667_100024934	Ga0070667_1000249344	79
67	3300005367	Ga0070667_100201485	Ga0070667_1002014852	79
68	3300005367	Ga0070667_100372735	Ga0070667_1003727353	79
69	3300005367	Ga0070667_100802223	Ga0070667_1008022231	79
70	3300005367	Ga0070667_100910946	Ga0070667_1009109462	79
71	3300005458	Ga0070681_10072430	Ga0070681_100724303	79
72	3300005458	Ga0070681_10079032	Ga0070681_100790325	79
73	3300005458	Ga0070681_10137710	Ga0070681_101377103	79
74	3300005459	Ga0068867_102171647	Ga0068867_1021716472	79
75	3300005471	Ga0070698_100641739	Ga0070698_1006417391	79
76	3300005530	Ga0070679_100013401	Ga0070679_1000134014	79
77	3300005530	Ga0070679_100097803	Ga0070679_1000978034	79
78	3300005530	Ga0070679_101260500	Ga0070679_1012605002	79
79	3300005535	Ga0070684_101267123	Ga0070684_1012671232	79
80	3300005539	Ga0068853_100223542	Ga0068853_1002235421	79
81	3300005539	Ga0068853_100390705	Ga0068853_1003907052	79
82	3300005539	Ga0068853_100953829	Ga0068853_1009538292	79
83	3300005539	Ga0068853_101393705	Ga0068853_1013937052	79
84	3300005539	Ga0068853_101477737	Ga0068853_1014777372	79
85	3300005547	Ga0070693_101526721	Ga0070693_1015267212	79
86	3300005548	Ga0070665_100000397	Ga0070665_10000039745	79
87	3300005548	Ga0070665_100002230	Ga0070665_10000223025	79
88	3300005548	Ga0070665_100010548	Ga0070665_10001054812	79
89	3300005548	Ga0070665_100381027	Ga0070665_1003810273	79
90	3300005548	Ga0070665_101047545	Ga0070665_1010475451	79
91	3300005548	Ga0070665_102234233	Ga0070665_1022342332	79
92	3300005548	Ga0070665_102621694	Ga0070665_1026216942	79
93	3300005563	Ga0068855_100017299	Ga0068855_10001729910	79
94	3300005563	Ga0068855_100052253	Ga0068855_1000522532	79
95	3300005563	Ga0068855_100084460	Ga0068855_1000844603	79
96	3300005563	Ga0068855_100214350	Ga0068855_1002143503	79
97	3300005563	Ga0068855_100706197	Ga0068855_1007061973	79
98	3300005563	Ga0068855_100973513	Ga0068855_1009735132	79
99	3300005563	Ga0068855_101681374	Ga0068855_1016813742	79
100	3300005564	Ga0070664_100082604	Ga0070664_1000826042	79
101	3300005614	Ga0068856_100211047	Ga0068856_1002110474	79
102	3300005614	Ga0068856_100419854	Ga0068856_1004198542	79
103	3300005614	Ga0068856_100441618	Ga0068856_1004416182	79
104	3300005614	Ga0068856_101129729	Ga0068856_1011297292	79
105	3300005615	Ga0070702_100698545	Ga0070702_1006985452	79
106	3300005616	Ga0068852_100326917	Ga0068852_1003269171	79
107	3300005616	Ga0068852_102640363	Ga0068852_1026403632	79
108	3300005617	Ga0068859_100000437	Ga0068859_10000043718	79
109	3300005617	Ga0068859_100332465	Ga0068859_1003324654	79
110	3300005617	Ga0068859_100476583	Ga0068859_1004765832	79
111	3300005618	Ga0068864_100000292	Ga0068864_10000029246	79
112	3300005618	Ga0068864_100000701	Ga0068864_1000007013	79
113	3300005618	Ga0068864_100098135	Ga0068864_1000981353	79
114	3300005618	Ga0068864_100351037	Ga0068864_1003510372	79
115	3300005618	Ga0068864_101109499	Ga0068864_1011094992	79
116	3300005618	Ga0068864_102007092	Ga0068864_1020070921	79
117	3300005719	Ga0068861_100656055	Ga0068861_1006560552	79
118	3300005719	Ga0068861_102109032	Ga0068861_1021090322	79
119	3300005840	Ga0068870_11056313	Ga0068870_110563131	79
120	3300005841	Ga0068863_100000864	Ga0068863_1000008648	79
121	3300005841	Ga0068863_100001649	Ga0068863_10000164924	79
122	3300005841	Ga0068863_100002531	Ga0068863_1000025316	79
123	3300005841	Ga0068863_100185972	Ga0068863_1001859725	79
124	3300005841	Ga0068863_100511862	Ga0068863_1005118622	79
125	3300005841	Ga0068863_102269547	Ga0068863_1022695472	79
126	3300005842	Ga0068858_100000557	Ga0068858_1000005577	79
127	3300005842	Ga0068858_100023551	Ga0068858_1000235512	79
128	3300005842	Ga0068858_100351635	Ga0068858_1003516353	79
129	3300005843	Ga0068860_100000309	Ga0068860_10000030962	79
130	3300005843	Ga0068860_100001171	Ga0068860_1000011715	79
131	3300005843	Ga0068860_100014375	Ga0068860_1000143754	79
132	3300005843	Ga0068860_100838783	Ga0068860_1008387832	79
133	3300005844	Ga0068862_100001520	Ga0068862_10000152025	79
134	3300005844	Ga0068862_100094791	Ga0068862_1000947914	79
135	3300005844	Ga0068862_100753705	Ga0068862_1007537051	79
136	3300006028	Ga0070717_10096215	Ga0070717_100962154	79
137	3300006028	Ga0070717_10994750	Ga0070717_109947502	79
138	3300006038	Ga0075365_10794299	Ga0075365_107942992	79
139	3300006042	Ga0075368_10043878	Ga0075368_100438782	79
140	3300006048	Ga0075363_100019496	Ga0075363_1000194964	79
141	3300006048	Ga0075363_100075324	Ga0075363_1000753243	79
142	3300006051	Ga0075364_10000411	Ga0075364_1000041125	79
143	3300006177	Ga0075362_10454951	Ga0075362_104549512	79
144	3300006178	Ga0075367_10019300	Ga0075367_100193004	79
145	3300006186	Ga0075369_10099613	Ga0075369_100996133	79
146	3300006195	Ga0075366_10015743	Ga0075366_100157436	79
147	3300006353	Ga0075370_10471219	Ga0075370_104712192	79
148	3300006881	Ga0068865_100000220	Ga0068865_10000022016	79
149	3300006881	Ga0068865_100811857	Ga0068865_1008118572	79
150	3300006931	Ga0097620_100000437	Ga0097620_10000043718	79
151	3300006931	Ga0097620_100332465	Ga0097620_1003324654	79
152	3300006931	Ga0097620_100476560	Ga0097620_1004765602	79
153	3300006946	Ga0079104_1064069	Ga0079104_10640691	79
154	3300009011	Ga0105251_10277527	Ga0105251_102775271	79
155	3300009092	Ga0105250_10007928	Ga0105250_100079284	79
156	3300009093	Ga0105240_10011242	Ga0105240_1001124210	79
157	3300009093	Ga0105240_10140699	Ga0105240_101406993	79
158	3300009093	Ga0105240_10151331	Ga0105240_101513312	79
159	3300009093	Ga0105240_10188407	Ga0105240_101884072	79
160	3300009093	Ga0105240_10449291	Ga0105240_104492912	79
161	3300009093	Ga0105240_10562881	Ga0105240_105628813	79
162	3300009093	Ga0105240_10697233	Ga0105240_106972331	79
163	3300009093	Ga0105240_10820255	Ga0105240_108202552	79
164	3300009093	Ga0105240_10849385	Ga0105240_108493852	79
165	3300009098	Ga0105245_10068449	Ga0105245_100684495	79
166	3300009098	Ga0105245_12428062	Ga0105245_124280622	79
167	3300009101	Ga0105247_10084133	Ga0105247_100841331	79
168	3300009101	Ga0105247_11318309	Ga0105247_113183091	79
169	3300009147	Ga0114129_13300058	Ga0114129_133000582	79
170	3300009174	Ga0105241_11799050	Ga0105241_117990502	79
171	3300009176	Ga0105242_10111600	Ga0105242_101116002	79
172	3300009177	Ga0105248_10001974	Ga0105248_1000197418	79
173	3300009177	Ga0105248_10007729	Ga0105248_1000772914	79
174	3300009177	Ga0105248_10008553	Ga0105248_100085532	79
175	3300009177	Ga0105248_10090101	Ga0105248_100901012	79
176	3300009177	Ga0105248_10138981	Ga0105248_101389814	79
177	3300009177	Ga0105248_10195628	Ga0105248_101956283	79
178	3300009177	Ga0105248_10233522	Ga0105248_102335223	79
179	3300009177	Ga0105248_10429532	Ga0105248_104295324	79
180	3300009177	Ga0105248_11052262	Ga0105248_110522622	79
181	3300009177	Ga0105248_11514882	Ga0105248_115148822	79
182	3300009177	Ga0105248_12181941	Ga0105248_121819412	79
183	3300009177	Ga0105248_13372188	Ga0105248_133721882	79
184	3300009545	Ga0105237_10307958	Ga0105237_103079584	79
185	3300009545	Ga0105237_10330236	Ga0105237_103302361	79
186	3300009545	Ga0105237_11830030	Ga0105237_118300302	79
187	3300009551	Ga0105238_10010623	Ga0105238_100106234	79
188	3300009551	Ga0105238_10012057	Ga0105238_100120576	79
189	3300009551	Ga0105238_10053900	Ga0105238_100539005	79
190	3300009551	Ga0105238_10169895	Ga0105238_101698954	79
191	3300009551	Ga0105238_10291325	Ga0105238_102913252	79
192	3300009551	Ga0105238_11133140	Ga0105238_111331402	79
193	3300009551	Ga0105238_11291171	Ga0105238_112911712	79
194	3300009551	Ga0105238_11413898	Ga0105238_114138982	79
195	3300009551	Ga0105238_11604141	Ga0105238_116041412	79
196	3300009553	Ga0105249_10134316	Ga0105249_101343165	79
197	3300009553	Ga0105249_11390986	Ga0105249_113909862	79
198	3300009553	Ga0105249_11969955	Ga0105249_119699552	79
199	3300009553	Ga0105249_12819219	Ga0105249_128192191	79
200	3300010375	Ga0105239_10926262	Ga0105239_109262622	79
201	3300010375	Ga0105239_11104339	Ga0105239_111043393	79
202	3300010375	Ga0105239_12003151	Ga0105239_120031512	79
203	3300011119	Ga0105246_11000834	Ga0105246_110008342	79
204	3300013102	Ga0157371_10590317	Ga0157371_105903171	79
205	3300013104	Ga0157370_10174170	Ga0157370_101741703	79
206	3300013104	Ga0157370_10416480	Ga0157370_104164801	79
207	3300013104	Ga0157370_11203610	Ga0157370_112036102	79
208	3300013104	Ga0157370_11784168	Ga0157370_117841682	79
209	3300013105	Ga0157369_10528718	Ga0157369_105287182	79
210	3300013105	Ga0157369_11224720	Ga0157369_112247202	79
211	3300013296	Ga0157374_12342363	Ga0157374_123423631	79
212	3300013297	Ga0157378_11170346	Ga0157378_111703462	79
213	3300013297	Ga0157378_11963176	Ga0157378_119631762	79
214	3300013306	Ga0163162_10016872	Ga0163162_100168725	79
215	3300013306	Ga0163162_10140125	Ga0163162_101401252	79
216	3300013306	Ga0163162_10347531	Ga0163162_103475311	79
217	3300013306	Ga0163162_10708266	Ga0163162_107082662	79
218	3300013307	Ga0157372_10157083	Ga0157372_101570832	79
219	3300013307	Ga0157372_10237060	Ga0157372_102370602	79
220	3300013308	Ga0157375_10810157	Ga0157375_108101573	79
221	3300013308	Ga0157375_11221437	Ga0157375_112214372	79
222	3300013308	Ga0157375_11944499	Ga0157375_119444992	79
223	3300014325	Ga0163163_10020803	Ga0163163_100208032	79
224	3300014325	Ga0163163_10124136	Ga0163163_101241362	79
225	3300014325	Ga0163163_10419487	Ga0163163_104194872	79
226	3300014325	Ga0163163_10547255	Ga0163163_105472552	79
227	3300014325	Ga0163163_12937818	Ga0163163_129378182	79
228	3300014326	Ga0157380_11708489	Ga0157380_117084892	79
229	3300014326	Ga0157380_11728351	Ga0157380_117283512	79
230	3300014968	Ga0157379_10000967	Ga0157379_100009672	79
231	3300014968	Ga0157379_10428327	Ga0157379_104283272	79
232	3300014968	Ga0157379_10430234	Ga0157379_104302342	79
233	3300014968	Ga0157379_12261181	Ga0157379_122611812	79
234	3300015684	Ga0183365_10003	Ga0183365_10003195	79
235	3300017792	Ga0163161_11900195	Ga0163161_119001952	79
236	3300021361	Ga0213872_10006135	Ga0213872_100061354	79
237	3300021361	Ga0213872_10009066	Ga0213872_100090663	79
238	3300021361	Ga0213872_10384588	Ga0213872_103845881	79
239	3300021384	Ga0213876_10078197	Ga0213876_100781972	79
240	3300025250	Ga0209026_1009073	Ga0209026_10090732	79
241	3300025254	Ga0209148_1020472	Ga0209148_10204723	79
242	3300025272	Ga0209455_1044586	Ga0209455_10445862	79
243	3300025297	Ga0209758_1000555	Ga0209758_100055511	79
244	3300025298	Ga0209050_1000034	Ga0209050_1000034201	79
245	3300025304	Ga0209257_1000052	Ga0209257_1000052209	79
246	3300025304	Ga0209257_1000100	Ga0209257_100010074	79
247	3300025304	Ga0209257_1000618	Ga0209257_100061850	79
248	3300025315	Ga0207697_10509432	Ga0207697_105094322	79
249	3300025711	Ga0207696_1039970	Ga0207696_10399702	79
250	3300025893	Ga0207682_10148450	Ga0207682_101484502	79
251	3300025900	Ga0207710_10064012	Ga0207710_100640123	79
252	3300025900	Ga0207710_10092409	Ga0207710_100924092	79
253	3300025903	Ga0207680_10183678	Ga0207680_101836782	79
254	3300025903	Ga0207680_10284506	Ga0207680_102845062	79
255	3300025903	Ga0207680_10313500	Ga0207680_103135001	79
256	3300025908	Ga0207643_10256204	Ga0207643_102562043	79
257	3300025909	Ga0207705_10001713	Ga0207705_1000171319	79
258	3300025909	Ga0207705_10080006	Ga0207705_100800064	79
259	3300025909	Ga0207705_10341756	Ga0207705_103417562	79
260	3300025909	Ga0207705_10974768	Ga0207705_109747682	79
261	3300025911	Ga0207654_10516110	Ga0207654_105161102	79
262	3300025912	Ga0207707_10039763	Ga0207707_100397634	79
263	3300025912	Ga0207707_11527484	Ga0207707_115274841	79
264	3300025913	Ga0207695_10002720	Ga0207695_1000272010	79
265	3300025913	Ga0207695_10020630	Ga0207695_100206305	79
266	3300025913	Ga0207695_10020683	Ga0207695_100206831	79
267	3300025913	Ga0207695_10026342	Ga0207695_100263424	79
268	3300025913	Ga0207695_10060209	Ga0207695_100602094	79
269	3300025913	Ga0207695_10503661	Ga0207695_105036613	79
270	3300025913	Ga0207695_10573462	Ga0207695_105734622	79
271	3300025914	Ga0207671_11234111	Ga0207671_112341112	79
272	3300025917	Ga0207660_10002249	Ga0207660_100022496	79
273	3300025917	Ga0207660_10029223	Ga0207660_100292233	79
274	3300025917	Ga0207660_10383918	Ga0207660_103839181	79
275	3300025919	Ga0207657_10020343	Ga0207657_100203436	79
276	3300025919	Ga0207657_10039946	Ga0207657_100399466	79
277	3300025919	Ga0207657_10629744	Ga0207657_106297442	79
278	3300025919	Ga0207657_10741153	Ga0207657_107411532	79
279	3300025920	Ga0207649_10488543	Ga0207649_104885432	79
280	3300025920	Ga0207649_10911053	Ga0207649_109110531	79
281	3300025921	Ga0207652_10012726	Ga0207652_100127264	79
282	3300025921	Ga0207652_10024226	Ga0207652_100242262	79
283	3300025921	Ga0207652_11341976	Ga0207652_113419762	79
284	3300025923	Ga0207681_10002433	Ga0207681_100024333	79
285	3300025923	Ga0207681_10130239	Ga0207681_101302393	79
286	3300025924	Ga0207694_10017775	Ga0207694_100177752	79
287	3300025924	Ga0207694_10044211	Ga0207694_100442114	79
288	3300025924	Ga0207694_10223986	Ga0207694_102239863	79
289	3300025924	Ga0207694_10718339	Ga0207694_107183392	79
290	3300025924	Ga0207694_11356549	Ga0207694_113565492	79
291	3300025924	Ga0207694_11706163	Ga0207694_117061632	79
292	3300025925	Ga0207650_10001082	Ga0207650_1000108214	79
293	3300025925	Ga0207650_10034347	Ga0207650_100343473	79
294	3300025925	Ga0207650_10127772	Ga0207650_101277722	79
295	3300025926	Ga0207659_11201457	Ga0207659_112014572	79
296	3300025927	Ga0207687_10091822	Ga0207687_100918222	79
297	3300025931	Ga0207644_10001126	Ga0207644_1000112618	79
298	3300025931	Ga0207644_10181387	Ga0207644_101813873	79
299	3300025932	Ga0207690_10000584	Ga0207690_100005841	79
300	3300025932	Ga0207690_10032517	Ga0207690_100325172	79
301	3300025933	Ga0207706_10512905	Ga0207706_105129051	79
302	3300025934	Ga0207686_10127411	Ga0207686_101274114	79
303	3300025938	Ga0207704_10001287	Ga0207704_100012876	79
304	3300025938	Ga0207704_10695533	Ga0207704_106955331	79
305	3300025940	Ga0207691_10989701	Ga0207691_109897012	79
306	3300025941	Ga0207711_10001161	Ga0207711_1000116110	79
307	3300025941	Ga0207711_10002832	Ga0207711_1000283212	79
308	3300025941	Ga0207711_10014921	Ga0207711_100149213	79
309	3300025941	Ga0207711_10036004	Ga0207711_100360045	79
310	3300025941	Ga0207711_10045345	Ga0207711_100453455	79
311	3300025941	Ga0207711_10108919	Ga0207711_101089192	79
312	3300025941	Ga0207711_10425795	Ga0207711_104257952	79
313	3300025941	Ga0207711_10456341	Ga0207711_104563412	79
314	3300025941	Ga0207711_11197208	Ga0207711_111972081	79
315	3300025942	Ga0207689_10338802	Ga0207689_103388023	79
316	3300025942	Ga0207689_11202241	Ga0207689_112022412	79
317	3300025944	Ga0207661_11309313	Ga0207661_113093132	79
318	3300025944	Ga0207661_11679594	Ga0207661_116795942	79
319	3300025945	Ga0207679_10943647	Ga0207679_109436471	79
320	3300025945	Ga0207679_11221905	Ga0207679_112219051	79
321	3300025949	Ga0207667_10022145	Ga0207667_100221453	79
322	3300025949	Ga0207667_10023707	Ga0207667_100237072	79
323	3300025949	Ga0207667_10378033	Ga0207667_103780334	79
324	3300025949	Ga0207667_10391784	Ga0207667_103917842	79
325	3300025949	Ga0207667_10505554	Ga0207667_105055542	79
326	3300025949	Ga0207667_10556250	Ga0207667_105562502	79
327	3300025960	Ga0207651_10107728	Ga0207651_101077281	79
328	3300025960	Ga0207651_10688746	Ga0207651_106887462	79
329	3300025961	Ga0207712_10000569	Ga0207712_1000056917	79
330	3300025961	Ga0207712_10379287	Ga0207712_103792873	79
331	3300025961	Ga0207712_10379310	Ga0207712_103793102	79
332	3300025961	Ga0207712_10743634	Ga0207712_107436342	79
333	3300025961	Ga0207712_11665186	Ga0207712_116651862	79
334	3300025972	Ga0207668_10000003	Ga0207668_1000000373	79
335	3300025972	Ga0207668_10000678	Ga0207668_1000067823	79
336	3300025972	Ga0207668_10003216	Ga0207668_1000321611	79
337	3300025972	Ga0207668_10025540	Ga0207668_100255402	79
338	3300025972	Ga0207668_10059324	Ga0207668_100593242	79
339	3300025981	Ga0207640_11017741	Ga0207640_110177412	79
340	3300025981	Ga0207640_11877389	Ga0207640_118773891	79
341	3300025986	Ga0207658_10001842	Ga0207658_100018426	79
342	3300025986	Ga0207658_10028893	Ga0207658_100288932	79
343	3300025986	Ga0207658_10035086	Ga0207658_100350864	79
344	3300025986	Ga0207658_10097732	Ga0207658_100977322	79
345	3300025986	Ga0207658_10289800	Ga0207658_102898002	79
346	3300025986	Ga0207658_12044026	Ga0207658_120440262	79
347	3300026023	Ga0207677_11383991	Ga0207677_113839912	79
348	3300026035	Ga0207703_10001508	Ga0207703_100015088	79
349	3300026035	Ga0207703_10008480	Ga0207703_100084803	79
350	3300026035	Ga0207703_10324362	Ga0207703_103243623	79
351	3300026041	Ga0207639_10070826	Ga0207639_100708262	79
352	3300026041	Ga0207639_10819983	Ga0207639_108199832	79
353	3300026041	Ga0207639_11013478	Ga0207639_110134782	79
354	3300026041	Ga0207639_11078924	Ga0207639_110789242	79
355	3300026067	Ga0207678_10486934	Ga0207678_104869342	79
356	3300026067	Ga0207678_11274729	Ga0207678_112747292	79
357	3300026078	Ga0207702_10200335	Ga0207702_102003352	79
358	3300026078	Ga0207702_10332149	Ga0207702_103321493	79
359	3300026078	Ga0207702_11517374	Ga0207702_115173742	79
360	3300026088	Ga0207641_10000067	Ga0207641_1000006726	79
361	3300026088	Ga0207641_10002338	Ga0207641_1000233819	79
362	3300026088	Ga0207641_10002399	Ga0207641_100023994	79
363	3300026088	Ga0207641_10168238	Ga0207641_101682382	79
364	3300026088	Ga0207641_10753704	Ga0207641_107537042	79
365	3300026088	Ga0207641_11393936	Ga0207641_113939362	79
366	3300026088	Ga0207641_12071417	Ga0207641_120714172	79
367	3300026088	Ga0207641_12196238	Ga0207641_121962382	79
368	3300026089	Ga0207648_11661511	Ga0207648_116615112	79
369	3300026095	Ga0207676_10000285	Ga0207676_1000028539	79
370	3300026095	Ga0207676_10001669	Ga0207676_1000166915	79
371	3300026095	Ga0207676_10034914	Ga0207676_100349146	79
372	3300026095	Ga0207676_10075226	Ga0207676_100752263	79
373	3300026095	Ga0207676_10365791	Ga0207676_103657912	79
374	3300026095	Ga0207676_11268812	Ga0207676_112688122	79
375	3300026095	Ga0207676_12293422	Ga0207676_122934221	79
376	3300026116	Ga0207674_12233029	Ga0207674_122330292	79
377	3300026118	Ga0207675_100101568	Ga0207675_1001015684	79
378	3300026118	Ga0207675_102739905	Ga0207675_1027399052	79
379	3300026142	Ga0207698_10333105	Ga0207698_103331051	79
380	3300026142	Ga0207698_12067678	Ga0207698_120676782	79
381	3300026142	Ga0207698_12677843	Ga0207698_126778432	79
382	3300027111	Ga0209281_1043232	Ga0209281_10432321	79
383	3300027378	Ga0209981_1000496	Ga0209981_10004967	79
384	3300027395	Ga0209996_1012548	Ga0209996_10125482	79
385	3300027462	Ga0210000_1014014	Ga0210000_10140142	79
386	3300027665	Ga0209983_1006201	Ga0209983_10062012	79
387	3300027866	Ga0209813_10000832	Ga0209813_100008327	79
388	3300028379	Ga0268266_10000062	Ga0268266_10000062118	79
389	3300028379	Ga0268266_10001802	Ga0268266_1000180228	79
390	3300028379	Ga0268266_10027274	Ga0268266_100272742	79
391	3300028380	Ga0268265_10007726	Ga0268265_1000772611	79
392	3300028380	Ga0268265_10024304	Ga0268265_100243043	79
393	3300028380	Ga0268265_10268181	Ga0268265_102681814	79
394	3300028380	Ga0268265_10399192	Ga0268265_103991922	79
395	3300028380	Ga0268265_10934295	Ga0268265_109342951	79
396	3300028381	Ga0268264_10000029	Ga0268264_1000002924	79
397	3300028381	Ga0268264_10000118	Ga0268264_1000011877	79
398	3300028381	Ga0268264_10012713	Ga0268264_100127138	79
399	3300028381	Ga0268264_10130162	Ga0268264_101301624	79
400	3300028563	Ga0265319_1285557	Ga0265319_12855572	79
401	3300028786	Ga0307517_10008037	Ga0307517_100080374	79
402	3300028786	Ga0307517_10318573	Ga0307517_103185732	79
403	3300028786	Ga0307517_10496843	Ga0307517_104968432	79
404	3300028786	Ga0307517_10632504	Ga0307517_106325042	79
405	3300028794	Ga0307515_10776867	Ga0307515_107768672	79
406	3300028800	Ga0265338_10045115	Ga0265338_100451155	79
407	3300028800	Ga0265338_10180050	Ga0265338_101800502	79
408	3300028800	Ga0265338_10220048	Ga0265338_102200482	79
409	3300028800	Ga0265338_10327086	Ga0265338_103270862	79
410	3300028800	Ga0265338_10639922	Ga0265338_106399222	79
411	3300030521	Ga0307511_10007505	Ga0307511_1000750511	79
412	3300031240	Ga0265320_10041528	Ga0265320_100415282	79
413	3300031247	Ga0265340_10188897	Ga0265340_101888972	79
414	3300031251	Ga0265327_10000334	Ga0265327_100003348	79
415	3300031251	Ga0265327_10003793	Ga0265327_1000379311	79
416	3300031251	Ga0265327_10218574	Ga0265327_102185742	79
417	3300031251	Ga0265327_10345246	Ga0265327_103452462	79
418	3300031251	Ga0265327_10464171	Ga0265327_104641712	79
419	3300031456	Ga0307513_10000414	Ga0307513_1000041424	79
420	3300031456	Ga0307513_10000431	Ga0307513_1000043133	79
421	3300031456	Ga0307513_10004565	Ga0307513_100045657	79
422	3300031456	Ga0307513_10013540	Ga0307513_100135406	79
423	3300031548	Ga0307408_101035633	Ga0307408_1010356332	79
424	3300031548	Ga0307408_101367794	Ga0307408_1013677941	79
425	3300031548	Ga0307408_102143961	Ga0307408_1021439612	79
426	3300031711	Ga0265314_10408952	Ga0265314_104089521	79
427	3300031711	Ga0265314_10487982	Ga0265314_104879822	79
428	3300031730	Ga0307516_10000084	Ga0307516_10000084102	79
429	3300031824	Ga0307413_10052501	Ga0307413_100525012	79
430	3300031824	Ga0307413_10105642	Ga0307413_101056422	79
431	3300031824	Ga0307413_10822283	Ga0307413_108222832	79
432	3300031852	Ga0307410_10656612	Ga0307410_106566122	79
433	3300031911	Ga0307412_11405643	Ga0307412_114056431	79
434	3300031911	Ga0307412_12282959	Ga0307412_122829591	79
435	3300032004	Ga0307414_10205762	Ga0307414_102057622	79
436	3300032005	Ga0307411_11566667	Ga0307411_115666671	79
437	3300032126	Ga0307415_102426076	Ga0307415_1024260761	79
438	3300033180	Ga0307510_10012897	Ga0307510_100128975	79
439	3300033180	Ga0307510_10065924	Ga0307510_100659245	79
440	3300035089	Ga0373944_0077699	Ga0373944_0077699_154_393	79
441	3300035091	Ga0373951_0293447	Ga0373951_0293447_23_262	79
442	3300035113	Ga0373936_0007882	Ga0373936_0007882_3388_3627	79
443	3300035695	Ga0373927_0010387	Ga0373927_0010387_753_992	79
444	3300035725	Ga0373947_0602014	Ga0373947_0602014_262_501	79
445	3300037068	Ga0373925_0000335	Ga0373925_0000335_47317_47556	79
446	3300037068	Ga0373925_0565154	Ga0373925_0565154_485_724	79
447	3300037312	Ga0395899_0000895	Ga0395899_0000895_9435_9674	79
448	3300037312	Ga0395899_0088757	Ga0395899_0088757_1539_1778	79
449	3300037312	Ga0395899_0105875	Ga0395899_0105875_415_654	79
450	3300037312	Ga0395899_0362191	Ga0395899_0362191_30_269	79
451	3300037418	Ga0395900_0000004	Ga0395900_0000004_429722_429961	79
452	3300037418	Ga0395900_0165938	Ga0395900_0165938_32_271	79
453	3300037418	Ga0395900_0317706	Ga0395900_0317706_233_472	79
454	3300037418	Ga0395900_0565463	Ga0395900_0565463_711_950	79
455	3300037418	Ga0395900_1230764	Ga0395900_1230764_52_291	79
456	3300037466	Ga0395898_0022116	Ga0395898_0022116_4155_4394	79
457	3300037466	Ga0395898_0032821	Ga0395898_0032821_248_487	79
458	3300037466	Ga0395898_0157201	Ga0395898_0157201_1650_1889	79
459	3300037466	Ga0395898_0244721	Ga0395898_0244721_845_1084	79
460	3300037466	Ga0395898_0972958	Ga0395898_0972958_462_704	79
461	3300037471	Ga0395905_0000741	Ga0395905_0000741_36420_36659	79
462	3300037471	Ga0395905_0001873	Ga0395905_0001873_12604_12843	79
463	3300037471	Ga0395905_0002293	Ga0395905_0002293_9527_9766	79
464	3300037471	Ga0395905_0084433	Ga0395905_0084433_1590_1829	79
465	3300037471	Ga0395905_0099176	Ga0395905_0099176_699_938	79
466	3300037471	Ga0395905_0256749	Ga0395905_0256749_561_800	79
467	3300037471	Ga0395905_0456292	Ga0395905_0456292_120_359	79
468	3300037853	Ga0436364_0748094	Ga0436364_0748094_77_319	79
469	3300037853	Ga0436364_0846216	Ga0436364_0846216_1073_1312	79
470	3300038443	Ga0395901_0000005	Ga0395901_0000005_135605_135844	79
471	3300038443	Ga0395901_0187383	Ga0395901_0187383_955_1194	79
472	3300038443	Ga0395901_0576326	Ga0395901_0576326_33_272	79
473	3300038443	Ga0395901_2080168	Ga0395901_2080168_255_494	79
474	3300039437	Ga0436365_0286511	Ga0436365_0286511_5203_5442	79
475	3300039438	Ga0436360_0522747	Ga0436360_0522747_219_461	79
476	3300039447	Ga0436361_0211898	Ga0436361_0211898_6990_7241	79
477	3300039447	Ga0436361_0310224	Ga0436361_0310224_2044_2286	79
478	3300039447	Ga0436361_0322295	Ga0436361_0322295_178_420	79
479	3300039447	Ga0436361_1000218	Ga0436361_1000218_260_502	79
480	3300039447	Ga0436361_1115153	Ga0436361_1115153_272_511	79
481	3300039453	Ga0436362_0401145	Ga0436362_0401145_588_827	79
482	3300041453	Ga0451797_0813586	Ga0451797_0813586_196_435	79
483	3300041458	Ga0451798_0727701	Ga0451798_0727701_44_283	79
484	3300041486	Ga0451807_2441666	Ga0451807_2441666_14_253	79
485	3300041511	Ga0451855_1944746	Ga0451855_1944746_62_301	79
486	3300041512	Ga0451853_0274023	Ga0451853_0274023_158_400	79
487	3300042435	Ga0439434_0209747	Ga0439434_0209747_251_490	79
488	3300044656	Ga0466969_0000296	Ga0466969_0000296_12382_12624	79
489	3300044656	Ga0466969_0111985	Ga0466969_0111985_282_524	79
490	3300044658	Ga0466972_0475103	Ga0466972_0475103_183_422	79
491	3300044684	Ga0466966_0000163	Ga0466966_0000163_10178_10420	79
492	3300044693	Ga0466961_0009024	Ga0466961_0009024_3330_3572	79
493	3300044693	Ga0466961_0292156	Ga0466961_0292156_536_775	79
494	3300044693	Ga0466961_0835112	Ga0466961_0835112_72_311	79
495	3300044694	Ga0466963_0066983	Ga0466963_0066983_1016_1258	79
496	3300044706	Ga0466964_0824478	Ga0466964_0824478_61_300	79
497	3300044712	Ga0453684_0882718	Ga0453684_0882718_533_772	79
498	3300044719	Ga0466971_0002014	Ga0466971_0002014_5331_5573	79
499	3300044765	Ga0466970_0007969	Ga0466970_0007969_3864_4106	79
500	3300044842	Ga0466957_0059577	Ga0466957_0059577_32_274	79
501	3300045049	Ga0466959_0000071	Ga0466959_0000071_24633_24875	79
502	3300045049	Ga0466959_0223741	Ga0466959_0223741_998_1237	79
503	3300045836	Ga0466958_0000501	Ga0466958_0000501_14598_14840	79
504	3300046459	Ga0495629_0044601	Ga0495629_0044601_2002_2271	79
505	3300046499	Ga0495594_0103703	Ga0495594_0103703_278_517	79
506	3300046506	Ga0495583_0365611	Ga0495583_0365611_90_329	79
507	3300046507	Ga0495606_0189726	Ga0495606_0189726_404_643	79
508	3300046515	Ga0495620_0009858	Ga0495620_0009858_2024_2293	79
509	3300046516	Ga0495628_0456889	Ga0495628_0456889_520_759	79
510	3300046522	Ga0495643_0017514	Ga0495643_0017514_3833_4102	79
511	3300046522	Ga0495643_0059011	Ga0495643_0059011_1765_2004	79
512	3300046523	Ga0495644_0187520	Ga0495644_0187520_438_677	79
513	3300046523	Ga0495644_0297015	Ga0495644_0297015_114_353	79
514	3300046538	Ga0495609_0096956	Ga0495609_0096956_431_700	79
515	3300046542	Ga0495597_0002249	Ga0495597_0002249_10500_10769	79
516	3300046543	Ga0495645_0273221	Ga0495645_0273221_263_502	79
517	3300046557	Ga0495622_0020497	Ga0495622_0020497_2229_2498	79
518	3300046616	Ga0495668_0030658	Ga0495668_0030658_2026_2265	79
519	3300046616	Ga0495668_0060258	Ga0495668_0060258_151_390	79
520	3300046648	Ga0495611_0030731	Ga0495611_0030731_320_559	79
521	3300046648	Ga0495611_0451588	Ga0495611_0451588_52_321	79
522	3300046660	Ga0495625_0082761	Ga0495625_0082761_245_484	79
523	3300046660	Ga0495625_0335197	Ga0495625_0335197_378_647	79
524	3300046663	Ga0495635_1018312	Ga0495635_1018312_217_456	79
525	3300046664	Ga0495659_0288720	Ga0495659_0288720_62_301	79
526	3300046674	Ga0495588_0166246	Ga0495588_0166246_878_1147	79
527	3300046679	Ga0495623_0476282	Ga0495623_0476282_190_429	79
528	3300046684	Ga0495669_0009513	Ga0495669_0009513_2856_3095	79
529	3300046684	Ga0495669_0037381	Ga0495669_0037381_1542_1781	79
530	3300046684	Ga0495669_0060153	Ga0495669_0060153_422_661	79
531	3300047319	Ga0495674_0887642	Ga0495674_0887642_273_512	79
532	3300047320	Ga0495672_0090149	Ga0495672_0090149_1073_1312	79
533	3300047443	Ga0495687_165145	Ga0495687_165145_362_601	79
534	3300047470	Ga0495681_0167263	Ga0495681_0167263_392_631	79
535	3300047472	Ga0495686_0011624	Ga0495686_0011624_5094_5333	79
536	3300047472	Ga0495686_0189327	Ga0495686_0189327_445_684	79
537	3300047472	Ga0495686_0310316	Ga0495686_0310316_530_769	79
538	3300047673	Ga0495593_0040462	Ga0495593_0040462_1702_1971	79
539	3300048088	Ga0495602_0622518	Ga0495602_0622518_397_666	79
540	3300048903	Ga0496100_1129691	Ga0496100_1129691_274_513	79
541	3300048904	Ga0496101_1146245	Ga0496101_1146245_228_467	79
542	3300048905	Ga0496102_0082676	Ga0496102_0082676_1614_1853	79
543	3300048905	Ga0496102_0278484	Ga0496102_0278484_36_275	79
544	3300048906	Ga0496103_0195372	Ga0496103_0195372_43_282	79
545	3300048908	Ga0496105_0419512	Ga0496105_0419512_91_330	79
546	3300048909	Ga0496106_0134931	Ga0496106_0134931_1203_1442	79
547	3300048909	Ga0496106_0659323	Ga0496106_0659323_409_648	79
548	3300048909	Ga0496106_1156835	Ga0496106_1156835_136_375	79
549	3300048912	Ga0496109_0014673	Ga0496109_0014673_1788_2027	79
550	3300048915	Ga0496112_0083255	Ga0496112_0083255_797_1036	79
551	3300048915	Ga0496112_0091898	Ga0496112_0091898_2215_2454	79
552	3300048915	Ga0496112_0266435	Ga0496112_0266435_639_878	79
553	3300048916	Ga0496113_0804474	Ga0496113_0804474_52_291	79
554	3300048917	Ga0496114_0673519	Ga0496114_0673519_427_666	79
555	3300048918	Ga0496115_0006140	Ga0496115_0006140_8195_8434	79
556	3300048918	Ga0496115_0018955	Ga0496115_0018955_393_632	79
557	3300048918	Ga0496115_0127496	Ga0496115_0127496_1066_1311	79
558	3300048918	Ga0496115_0313975	Ga0496115_0313975_520_759	79
559	3300048919	Ga0496116_0107994	Ga0496116_0107994_1353_1592	79
560	3300048920	Ga0496117_0016145	Ga0496117_0016145_2415_2654	79
561	3300048921	Ga0496118_0015716	Ga0496118_0015716_6395_6634	79
562	3300048924	Ga0496121_0000053	Ga0496121_0000053_64432_64671	79
563	3300048928	Ga0496125_0130188	Ga0496125_0130188_596_838	79
564	3300049569	Ga0501032_0013853	Ga0501032_0013853_3575_3814	79
565	3300049570	Ga0501033_0334194	Ga0501033_0334194_704_943	79
566	3300049570	Ga0501033_0427250	Ga0501033_0427250_237_476	79
567	3300049571	Ga0501034_0045533	Ga0501034_0045533_659_898	79
568	3300049571	Ga0501034_1234270	Ga0501034_1234270_224_463	79
569	3300049579	Ga0501043_0461961	Ga0501043_0461961_313_552	79
570	3300049579	Ga0501043_0970078	Ga0501043_0970078_65_304	79
571	3300049580	Ga0501046_0262303	Ga0501046_0262303_801_1040	79
572	3300049581	Ga0501047_0000584	Ga0501047_0000584_37243_37482	79
573	3300049581	Ga0501047_0112105	Ga0501047_0112105_608_847	79
574	3300049581	Ga0501047_0228141	Ga0501047_0228141_1128_1367	79
575	3300049590	Ga0501074_0748988	Ga0501074_0748988_391_630	79
576	3300049686	Ga0501257_002439	Ga0501257_002439_1077_1316	79
577	3300049823	Ga0501044_0002720	Ga0501044_0002720_383_622	79
578	3300049823	Ga0501044_0190460	Ga0501044_0190460_925_1164	79
579	3300050489	nmdc:mga03683_110517_c1	nmdc:mga03683_110517_c1_911_1150	79
580	3300050490	nmdc:mga03n38_118046_c1	nmdc:mga03n38_118046_c1_414_653	79
581	3300050490	nmdc:mga03n38_5664_c1	nmdc:mga03n38_5664_c1_3449_3688	79
582	3300050490	nmdc:mga03n38_699934_c1	nmdc:mga03n38_699934_c1_153_395	79
583	3300050491	nmdc:mga00v17_528_c1	nmdc:mga00v17_528_c1_3952_4191	79
584	3300050493	nmdc:mga0k408_107595_c1	nmdc:mga0k408_107595_c1_1309_1548	79
585	3300050493	nmdc:mga0k408_27199_c1	nmdc:mga0k408_27199_c1_531_770	79
586	3300050493	nmdc:mga0k408_77315_c1	nmdc:mga0k408_77315_c1_49_288	79
587	3300050494	nmdc:mga06z11_13093_c1	nmdc:mga06z11_13093_c1_3074_3313	79
588	3300050495	nmdc:mga04h51_1988_c1	nmdc:mga04h51_1988_c1_23_262	79
589	3300050496	nmdc:mga07m45_179071_c1	nmdc:mga07m45_179071_c1_78_317	79
590	3300050496	nmdc:mga07m45_23319_c1	nmdc:mga07m45_23319_c1_2817_3056	79
591	3300050496	nmdc:mga07m45_517119_c1	nmdc:mga07m45_517119_c1_86_325	79
592	3300050516	nmdc:mga0sz30_90039_c1	nmdc:mga0sz30_90039_c1_495_734	79
593	3300053080	Ga0500635_0000253	Ga0500635_0000253_16802_17041	79
594	3300053080	Ga0500635_0000624	Ga0500635_0000624_2419_2658	79
595	3300053083	Ga0495655_0193001	Ga0495655_0193001_320_559	79
596	3300053086	Ga0500578_0660350	Ga0500578_0660350_34_273	79
597	3300053087	Ga0500643_000966	Ga0500643_000966_16222_16461	79
598	3300053087	Ga0500643_020603	Ga0500643_020603_220_459	79
599	3300053091	Ga0500647_0065112	Ga0500647_0065112_845_1084	79
600	3300053091	Ga0500647_0127866	Ga0500647_0127866_457_696	79
601	3300053092	Ga0500583_0250749	Ga0500583_0250749_371_640	79
602	3300053093	Ga0500651_0254924	Ga0500651_0254924_508_777	79
603	3300053094	Ga0500566_0253889	Ga0500566_0253889_56_325	79
604	3300053096	Ga0500641_0025993	Ga0500641_0025993_1477_1716	79
605	3300053103	Ga0500555_057131	Ga0500555_057131_456_695	79
606	3300053103	Ga0500555_142345	Ga0500555_142345_169_408	79
607	3300053108	Ga0500562_000374	Ga0500562_000374_481_720	79
608	3300053108	Ga0500562_015641	Ga0500562_015641_786_1025	79
609	3300053111	Ga0500572_114110	Ga0500572_114110_227_496	79
610	3300053118	Ga0500594_0090111	Ga0500594_0090111_428_667	79
611	3300053119	Ga0500595_006224	Ga0500595_006224_2684_2929	79
612	3300053119	Ga0500595_010331	Ga0500595_010331_2858_3127	79
613	3300053119	Ga0500595_021191	Ga0500595_021191_252_491	79
614	3300053119	Ga0500595_215599	Ga0500595_215599_202_441	79
615	3300053121	Ga0500607_181340	Ga0500607_181340_86_325	79
616	3300053122	Ga0500608_000192	Ga0500608_000192_8187_8426	79
617	3300053122	Ga0500608_003747	Ga0500608_003747_4724_4993	79
618	3300053122	Ga0500608_140318	Ga0500608_140318_796_1035	79
619	3300053123	Ga0500614_007444	Ga0500614_007444_56_325	79
620	3300053130	Ga0500642_0384636	Ga0500642_0384636_212_481	79
621	3300053134	Ga0500658_0223227	Ga0500658_0223227_507_776	79
622	3300053136	Ga0500559_0009083	Ga0500559_0009083_3202_3471	79
623	3300053136	Ga0500559_0185471	Ga0500559_0185471_540_779	79
624	3300053148	Ga0500590_061433	Ga0500590_061433_169_438	79
625	3300053154	Ga0500619_011874	Ga0500619_011874_569_838	79
626	3300053155	Ga0500620_069210	Ga0500620_069210_765_1034	79
627	3300053162	Ga0500638_229544	Ga0500638_229544_253_492	79
628	3300053163	Ga0500639_186896	Ga0500639_186896_650_889	79
629	3300053177	Ga0500636_0015023	Ga0500636_0015023_2081_2320	79
630	3300053177	Ga0500636_0106885	Ga0500636_0106885_764_1003	79
631	3300053178	Ga0500637_0230343	Ga0500637_0230343_359_598	79
632	3300053730	Ga0500645_006057	Ga0500645_006057_1142_1381	79
633	3300053735	Ga0500596_003741	Ga0500596_003741_2128_2397	79
634	3300053737	Ga0500601_021953	Ga0500601_021953_454_693	79
635	3300061719	Ga0466962_0000476	Ga0466962_0000476_15008_15250	79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

77

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4usw-assembly1.cif.gz_A	crystal structure of human soluble adenylyl cyclase with atp	0.7027	2	76
5iv4-assembly1.cif.gz_A	crystal structure of the human soluble adenylyl cyclase in complex with the allosteric inhibitor lre1	0.7012	2	76
2zny-assembly2.cif.gz_C	crystal structure of the ffrp	0.7001	2	79
1vr6-assembly1.cif.gz_B	crystal structure of phospho-2-dehydro-3-deoxyheptonate aldolase (dahp synthase) (tm0343) from thermotoga maritima at 1.92 a resolution	0.694	1	78
5d0r-assembly1.cif.gz_A	crystal structure of human soluble adenylyl cyclase with the inhibitor bithionol	0.6933	2	76

ID	Description	Score	Start	End	Superfamily
4uswA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain	0.7027	2	76	3.30.70.1230
af_P10869_349_504_3.30.2130.10	Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like	0.7024	2	77	3.30.2130.10
af_Q9FFF4_74_151_3.30.70.260	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain	0.6986	1	76	3.30.70.260
2dbbB02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain	0.692	2	79	3.30.70.920
af_Q57921_1_156_3.30.70.1150	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2	0.6895	1	79	3.30.70.1150

ID	Description	Score	Start	End	GO Terms
AF-H5WU16-F1-model_v4	Uncharacterized protein	0.737	2	77
AF-A0A7S1DA40-F1-model_v4	ABC transporter domain-containing protein	0.7227	2	79	GO:0005319 GO:0005524 GO:0016020 GO:0016887 GO:0043231 GO:0140359
AF-A0A7R9I8J7-F1-model_v4	Uncharacterized protein	0.722	3	77	GO:0005319 GO:0016020 GO:0043231 GO:0140359
AF-A0A0A2ZC21-F1-model_v4	deleted	0.722	2	77
AF-A0A7S1VG15-F1-model_v4	ABC transporter domain-containing protein	0.7162	2	79	GO:0005319 GO:0005524 GO:0016020 GO:0016887 GO:0043231 GO:0140359

Feature Viewer

pLDDT	pTM	Quality
76.17	0.59	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F471246

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

77

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map