F471149

General Info

Members Datasets Scaffolds Average Seq Length
634 283 1268 287

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100119386|Ga0068862_1001193863
Length 329
Sequence VAGLPSDRPLFFRRDARLSLETYSPVRTVINMNPNMKTTAFFLAMVLTVFLSGVVSGQQKPTTGYAPVGGLKMYYEIHGSGEPVVLLHGAFMAITDDWRVWISELSKTRKVIAVEMQGHGRTADIKRDITYENLSDDVAGLLDYLKIPNADIIGYSLGGGVAIQCAIRHPEKVRKVVSISAVIRRDGWVKEANDFWPTFTWEVFKGTPMEAEYKRLSPTPDKFPDFVNHIKATALRPYDFGADKLGATKAPMFFIHGDADGVRLDHIAEMYRLKGGDLHGDMRPHPESRLAILPDTTHVTLMNRMTTIVPMVNDFLDAKPPKQQNARAW

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
255 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.32
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 0
Rhizoplane 1.1
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100119386 3300005844 Bacteria 2323
2 JGI24739J22299_10005069 3300001989 Bacteria 5015
3 JGI25153J46596_10021585 3300003215 Unclassified 2396
4 rootH2_10044432 3300003320 Bacteria 6587
5 rootL2_10004956 3300003322 Bacteria 13305
6 rootH1_10051591 3300003323 Bacteria 7313
7 JGI25160J50197_1000735 3300003354 Bacteria 17879
8 Ga0055526_1005165 3300003771 Bacteria 7597
9 Ga0055528_1001241 3300003790 Bacteria 16212
10 Ga0055530_10001539 3300003791 Bacteria 16575
11 Ga0055543_1010855 3300004625 Bacteria 1891
12 Ga0065165_1000525 3300005262 Bacteria 58607
13 Ga0065704_10123260 3300005289 Bacteria 1736
14 Ga0065712_10000599 3300005290 Bacteria 9859
15 Ga0065712_10001080 3300005290 Bacteria 6947
16 Ga0065712_10074185 3300005290 Unclassified 4161
17 Ga0065715_10094969 3300005293 Bacteria 4199
18 Ga0065715_10268286 3300005293 Bacteria 1118
19 Ga0065707_10083023 3300005295 Bacteria 10803
20 Ga0065707_10092132 3300005295 Bacteria 3820
21 Ga0070676_10010770 3300005328 Bacteria 4962
22 Ga0070690_100000538 3300005330 Bacteria 18981
23 Ga0070690_100023068 3300005330 Bacteria 3813
24 Ga0070670_100069370 3300005331 Bacteria 3026
25 Ga0070670_100211031 3300005331 Bacteria 1688
26 Ga0070670_100269740 3300005331 Bacteria 1485
27 Ga0070677_10129325 3300005333 Bacteria 1151
28 Ga0068869_100023108 3300005334 Bacteria 4290
29 Ga0068869_100112755 3300005334 Bacteria 2070
30 Ga0070666_10227434 3300005335 Bacteria 1317
31 Ga0070680_100000255 3300005336 Bacteria 35103
32 Ga0070680_100376601 3300005336 Bacteria 1208
33 Ga0070680_100425605 3300005336 Bacteria 1133
34 Ga0070682_100307069 3300005337 Bacteria 1166
35 Ga0068868_100149815 3300005338 Bacteria 1920
36 Ga0070689_100119201 3300005340 Bacteria 2107
37 Ga0070687_100062068 3300005343 Bacteria 1977
38 Ga0070661_100068282 3300005344 Bacteria 2612
39 Ga0070692_10003110 3300005345 Bacteria 6651
40 Ga0070668_100018690 3300005347 Bacteria 5204
41 Ga0070669_100029435 3300005353 Bacteria 3958
42 Ga0070669_100110732 3300005353 Bacteria 2083
43 Ga0070669_100131041 3300005353 Unclassified 1924
44 Ga0070675_100001553 3300005354 Bacteria 16970
45 Ga0070675_100169206 3300005354 Bacteria 1883
46 Ga0070675_100235191 3300005354 Bacteria 1599
47 Ga0070675_100401614 3300005354 Bacteria 1223
48 Ga0070671_100043971 3300005355 Bacteria 3711
49 Ga0070671_100086917 3300005355 Bacteria 2616
50 Ga0070674_100044531 3300005356 Bacteria 3026
51 Ga0070674_100064780 3300005356 Unclassified 2563
52 Ga0070673_100001098 3300005364 Bacteria 15493
53 Ga0070673_100031266 3300005364 Unclassified 3993
54 Ga0070673_100116490 3300005364 Bacteria 2223
55 Ga0070688_100042669 3300005365 Unclassified 2791
56 Ga0070659_100377302 3300005366 Bacteria 1194
57 Ga0070667_100044210 3300005367 Bacteria 3739
58 Ga0070667_100067323 3300005367 Bacteria 3044
59 Ga0070701_10005249 3300005438 Bacteria 5332
60 Ga0070701_10019528 3300005438 Bacteria 3202
61 Ga0070705_100053056 3300005440 Bacteria 2371
62 Ga0070705_100072091 3300005440 Bacteria 2091
63 Ga0070705_100185894 3300005440 Bacteria 1412
64 Ga0070700_100144108 3300005441 Bacteria 1622
65 Ga0070700_100380147 3300005441 Bacteria 1056
66 Ga0070694_100000904 3300005444 Bacteria 16761
67 Ga0070694_100017794 3300005444 Bacteria 4494
68 Ga0070694_100110174 3300005444 Bacteria 1960
69 Ga0070708_100551149 3300005445 Bacteria 1087
70 Ga0070663_100029109 3300005455 Bacteria 3769
71 Ga0070678_100152978 3300005456 Bacteria 1860
72 Ga0070662_100040544 3300005457 Bacteria 3316
73 Ga0070662_100108649 3300005457 Bacteria 2110
74 Ga0070662_100167799 3300005457 Bacteria 1721
75 Ga0070681_10000032 3300005458 Bacteria 99533
76 Ga0070681_10070428 3300005458 Bacteria 3462
77 Ga0070681_10171095 3300005458 Bacteria 2094
78 Ga0070681_10269886 3300005458 Bacteria 1613
79 Ga0068867_100001356 3300005459 Bacteria 16916
80 Ga0068867_100098772 3300005459 Bacteria 2226
81 Ga0070685_10099907 3300005466 Bacteria 1771
82 Ga0070685_10152669 3300005466 Bacteria 1465
83 Ga0070685_10281495 3300005466 Bacteria 1114
84 Ga0070706_100165271 3300005467 Bacteria 2067
85 Ga0070698_100005844 3300005471 Bacteria 13448
86 Ga0070698_100007147 3300005471 Bacteria 12093
87 Ga0070698_100153452 3300005471 Bacteria 2249
88 Ga0070698_100369879 3300005471 Bacteria 1365
89 Ga0070698_100402319 3300005471 Bacteria 1302
90 Ga0070699_100000251 3300005518 Bacteria 52592
91 Ga0070699_100040805 3300005518 Bacteria 4017
92 Ga0070699_100087853 3300005518 Bacteria 2714
93 Ga0070699_100128193 3300005518 Bacteria 2235
94 Ga0070679_100000111 3300005530 Bacteria 64109
95 Ga0070684_100152024 3300005535 Bacteria 2097
96 Ga0070684_100355197 3300005535 Bacteria 1348
97 Ga0068853_100033399 3300005539 Bacteria 4365
98 Ga0068853_100364433 3300005539 Bacteria 1347
99 Ga0068853_100607187 3300005539 Unclassified 1039
100 Ga0070672_100341362 3300005543 Bacteria 1275
101 Ga0070686_100138813 3300005544 Bacteria 1689
102 Ga0070686_100163360 3300005544 Bacteria 1570
103 Ga0070695_100035876 3300005545 Bacteria 3117
104 Ga0070695_100107168 3300005545 Unclassified 1890
105 Ga0070695_100126673 3300005545 Bacteria 1754
106 Ga0070696_100134548 3300005546 Bacteria 1801
107 Ga0070696_100251850 3300005546 Bacteria 1336
108 Ga0070696_100437728 3300005546 Bacteria 1029
109 Ga0070693_100011213 3300005547 Bacteria 4510
110 Ga0070693_100153479 3300005547 Bacteria 1460
111 Ga0070665_100006297 3300005548 Bacteria 12123
112 Ga0070665_100030093 3300005548 Bacteria 5464
113 Ga0070704_100232273 3300005549 Bacteria 1505
114 Ga0070664_100000870 3300005564 Bacteria 23371
115 Ga0070664_100149267 3300005564 Bacteria 2063
116 Ga0068857_100136002 3300005577 Bacteria 2219
117 Ga0068857_100189711 3300005577 Bacteria 1872
118 Ga0068854_100048107 3300005578 Bacteria 3041
119 Ga0068854_100162594 3300005578 Bacteria 1730
120 Ga0068854_100234527 3300005578 Bacteria 1458
121 Ga0068856_100015332 3300005614 Bacteria 7407
122 Ga0068856_100058194 3300005614 Bacteria 3817
123 Ga0070702_100002240 3300005615 Bacteria 8259
124 Ga0070702_100244166 3300005615 Bacteria 1214
125 Ga0068852_100097505 3300005616 Bacteria 2645
126 Ga0068852_100455224 3300005616 Bacteria 1267
127 Ga0068859_100000128 3300005617 Bacteria 72119
128 Ga0068859_100017870 3300005617 Bacteria 7129
129 Ga0068859_100028039 3300005617 Bacteria 5647
130 Ga0068859_100046925 3300005617 Bacteria 4338
131 Ga0068859_100085471 3300005617 Bacteria 3200
132 Ga0068859_100128817 3300005617 Bacteria 2601
133 Ga0068859_100160833 3300005617 Bacteria 2325
134 Ga0068859_100387396 3300005617 Bacteria 1493
135 Ga0068859_100451594 3300005617 Bacteria 1381
136 Ga0068864_100000771 3300005618 Bacteria 26901
137 Ga0068864_100073245 3300005618 Bacteria 2986
138 Ga0068864_100079795 3300005618 Bacteria 2866
139 Ga0068864_100106570 3300005618 Bacteria 2492
140 Ga0068864_100262208 3300005618 Bacteria 1608
141 Ga0068864_100308779 3300005618 Bacteria 1482
142 Ga0068866_10073377 3300005718 Bacteria 1816
143 Ga0068861_100000325 3300005719 Bacteria 26917
144 Ga0068861_100035784 3300005719 Bacteria 3681
145 Ga0068861_100098136 3300005719 Bacteria 2325
146 Ga0068861_100283149 3300005719 Bacteria 1428
147 Ga0068851_10000051 3300005834 Bacteria 72304
148 Ga0068870_10017350 3300005840 Unclassified 3456
149 Ga0068863_100116706 3300005841 Bacteria 2544
150 Ga0068863_100309747 3300005841 Bacteria 1532
151 Ga0068858_100030840 3300005842 Bacteria 4979
152 Ga0068858_100091135 3300005842 Unclassified 2837
153 Ga0068858_100100203 3300005842 Bacteria 2701
154 Ga0068860_100086613 3300005843 Bacteria 2981
155 Ga0068860_100092258 3300005843 Bacteria 2885
156 Ga0068860_100164406 3300005843 Bacteria 2141
157 Ga0068860_100232551 3300005843 Bacteria 1791
158 Ga0068862_100000722 3300005844 Bacteria 33471
159 Ga0068862_100002467 3300005844 Bacteria 16385
160 Ga0068862_100039161 3300005844 Bacteria 4024
161 Ga0068862_100118409 3300005844 Bacteria 2332
162 Ga0068862_100325175 3300005844 Bacteria 1420
163 Ga0081455_10006826 3300005937 Bacteria 12167
164 Ga0081455_10025843 3300005937 Bacteria 5412
165 Ga0081539_10003097 3300005985 Bacteria 21360
166 Ga0070717_10076195 3300006028 Bacteria 2807
167 Ga0070716_100136023 3300006173 Bacteria 1561
168 Ga0097621_100003491 3300006237 Bacteria 10844
169 Ga0068871_100022816 3300006358 Bacteria 4831
170 Ga0068871_100053651 3300006358 Bacteria 3268
171 Ga0068871_100092607 3300006358 Bacteria 2521
172 Ga0068871_100132678 3300006358 Bacteria 2113
173 Ga0068871_100313835 3300006358 Bacteria 1379
174 Ga0075428_100001961 3300006844 Bacteria 22134
175 Ga0075428_100024165 3300006844 Bacteria 6723
176 Ga0075428_100029141 3300006844 Bacteria 6108
177 Ga0075428_100063090 3300006844 Bacteria 4057
178 Ga0075428_100124258 3300006844 Bacteria 2809
179 Ga0075428_100366686 3300006844 Bacteria 1545
180 Ga0075428_100722269 3300006844 Bacteria 1061
181 Ga0075430_100053718 3300006846 Bacteria 3392
182 Ga0075430_100057863 3300006846 Bacteria 3259
183 Ga0075431_100000011 3300006847 Bacteria 95501
184 Ga0075431_100001505 3300006847 Bacteria 21604
185 Ga0075431_100005404 3300006847 Bacteria 12617
186 Ga0075431_100049956 3300006847 Bacteria 4312
187 Ga0075431_100320386 3300006847 Unclassified 1563
188 Ga0075431_100471239 3300006847 Bacteria 1249
189 Ga0075433_10000163 3300006852 Bacteria 36379
190 Ga0075433_10035336 3300006852 Bacteria 4297
191 Ga0075433_10133107 3300006852 Bacteria 2209
192 Ga0075433_10366209 3300006852 Bacteria 1273
193 Ga0075434_100000405 3300006871 Bacteria 31760
194 Ga0075434_100129223 3300006871 Bacteria 2544
195 Ga0075434_100187690 3300006871 Bacteria 2087
196 Ga0075429_100000689 3300006880 Bacteria 26304
197 Ga0075429_100073231 3300006880 Bacteria 2984
198 Ga0075429_100154606 3300006880 Bacteria 2008
199 Ga0075429_100203567 3300006880 Bacteria 1734
200 Ga0068865_100016853 3300006881 Bacteria 4686
201 Ga0068865_100325134 3300006881 Bacteria 1238
202 Ga0075436_100001530 3300006914 Bacteria 15799
203 Ga0097620_100000128 3300006931 Bacteria 72119
204 Ga0097620_100017869 3300006931 Bacteria 7129
205 Ga0097620_100028040 3300006931 Bacteria 5647
206 Ga0097620_100046925 3300006931 Bacteria 4338
207 Ga0097620_100085472 3300006931 Bacteria 3200
208 Ga0097620_100128814 3300006931 Bacteria 2601
209 Ga0097620_100160834 3300006931 Bacteria 2325
210 Ga0097620_100387363 3300006931 Bacteria 1493
211 Ga0097620_100451604 3300006931 Bacteria 1381
212 Ga0075435_100005843 3300007076 Bacteria 8654
213 Ga0099794_10033448 3300007265 Bacteria 2418
214 Ga0099795_10064417 3300007788 Bacteria 1368
215 Ga0105240_10000223 3300009093 Bacteria 113647
216 Ga0105240_10159424 3300009093 Bacteria 2681
217 Ga0105240_10566963 3300009093 Bacteria 1254
218 Ga0111539_10004994 3300009094 Bacteria 17245
219 Ga0111539_10006898 3300009094 Bacteria 14592
220 Ga0111539_10015647 3300009094 Bacteria 9430
221 Ga0111539_10019711 3300009094 Bacteria 8318
222 Ga0111539_10037876 3300009094 Bacteria 5818
223 Ga0111539_10213523 3300009094 Bacteria 2248
224 Ga0105247_10001251 3300009101 Bacteria 18829
225 Ga0105247_10060173 3300009101 Bacteria 2353
226 Ga0114129_10028678 3300009147 Bacteria 7887
227 Ga0114129_10050373 3300009147 Bacteria 5850
228 Ga0114129_10051684 3300009147 Bacteria 5769
229 Ga0114129_10086408 3300009147 Bacteria 4350
230 Ga0114129_10289335 3300009147 Bacteria 2187
231 Ga0114129_10315035 3300009147 Bacteria 2082
232 Ga0114129_10427696 3300009147 Bacteria 1740
233 Ga0114129_10596295 3300009147 Bacteria 1432
234 Ga0105243_10000412 3300009148 Bacteria 44922
235 Ga0105243_10000824 3300009148 Bacteria 29535
236 Ga0105243_10025905 3300009148 Bacteria 4486
237 Ga0105241_10055395 3300009174 Bacteria 3038
238 Ga0105241_10425801 3300009174 Bacteria 1169
239 Ga0105242_10000133 3300009176 Bacteria 54096
240 Ga0105242_10001014 3300009176 Bacteria 22062
241 Ga0105242_10066451 3300009176 Bacteria 2978
242 Ga0105242_10206612 3300009176 Bacteria 1747
243 Ga0105248_10023490 3300009177 Bacteria 6849
244 Ga0105248_10052186 3300009177 Bacteria 4589
245 Ga0105248_10436508 3300009177 Bacteria 1475
246 Ga0105248_10592136 3300009177 Bacteria 1251
247 Ga0105237_10042779 3300009545 Bacteria 4566
248 Ga0105237_10289577 3300009545 Bacteria 1640
249 Ga0105238_10067259 3300009551 Bacteria 3585
250 Ga0105249_10002342 3300009553 Bacteria 16459
251 Ga0105249_10004971 3300009553 Bacteria 11467
252 Ga0105249_10031266 3300009553 Unclassified 4814
253 Ga0105249_10174722 3300009553 Bacteria 2085
254 Ga0105249_10204686 3300009553 Bacteria 1933
255 Ga0105249_10253328 3300009553 Unclassified 1746
256 Ga0105249_10796525 3300009553 Bacteria 1009
257 Ga0099796_10028511 3300010159 Bacteria 1793
258 Ga0099796_10066216 3300010159 Bacteria 1294
259 Ga0105239_10037657 3300010375 Bacteria 5300
260 Ga0105239_10045882 3300010375 Bacteria 4789
261 Ga0105239_10326018 3300010375 Bacteria 1732
262 Ga0105239_10343213 3300010375 Bacteria 1685
263 Ga0105239_10509867 3300010375 Bacteria 1368
264 Ga0157373_10027671 3300013100 Bacteria 4090
265 Ga0157373_10044945 3300013100 Unclassified 3153
266 Ga0157373_10113194 3300013100 Bacteria 1907
267 Ga0157373_10185007 3300013100 Bacteria 1468
268 Ga0157373_10202065 3300013100 Unclassified 1401
269 Ga0157371_10326443 3300013102 Bacteria 1114
270 Ga0157370_10039260 3300013104 Bacteria 4575
271 Ga0157369_10073859 3300013105 Bacteria 3658
272 Ga0157369_10415788 3300013105 Bacteria 1394
273 Ga0157374_10209431 3300013296 Bacteria 1911
274 Ga0157374_10479199 3300013296 Bacteria 1247
275 Ga0157378_10055820 3300013297 Bacteria 3519
276 Ga0157378_10407416 3300013297 Bacteria 1341
277 Ga0163162_10001047 3300013306 Bacteria 25683
278 Ga0163162_10073113 3300013306 Bacteria 3484
279 Ga0163162_10102248 3300013306 Bacteria 2959
280 Ga0163162_10103962 3300013306 Bacteria 2934
281 Ga0163162_10243455 3300013306 Bacteria 1930
282 Ga0163162_10307704 3300013306 Bacteria 1717
283 Ga0157372_10021096 3300013307 Bacteria 7035
284 Ga0157372_10049253 3300013307 Bacteria 4684
285 Ga0157375_10163539 3300013308 Bacteria 2369
286 Ga0157375_10191982 3300013308 Bacteria 2197
287 Ga0157375_10431887 3300013308 Bacteria 1483
288 Ga0163163_10114007 3300014325 Bacteria 2733
289 Ga0157380_10082516 3300014326 Bacteria 2631
290 Ga0157380_10084760 3300014326 Bacteria 2599
291 Ga0157380_10088930 3300014326 Bacteria 2543
292 Ga0157380_10487934 3300014326 Bacteria 1193
293 Ga0157377_10026942 3300014745 Unclassified 3081
294 Ga0157377_10061784 3300014745 Bacteria 2142
295 Ga0157379_10159187 3300014968 Bacteria 2038
296 Ga0157376_10342177 3300014969 Bacteria 1429
297 Ga0157376_10351061 3300014969 Bacteria 1411
298 Ga0157376_10393171 3300014969 Bacteria 1339
299 Ga0163161_10000627 3300017792 Bacteria 28166
300 Ga0209673_1000014 3300025273 Bacteria 537082
301 Ga0209673_1000018 3300025273 Bacteria 458281
302 Ga0209564_1009841 3300025295 Bacteria 4486
303 Ga0209758_1002678 3300025297 Bacteria 17595
304 Ga0209758_1004647 3300025297 Bacteria 11245
305 Ga0209050_1000750 3300025298 Bacteria 46636
306 Ga0207426_1000612 3300025302 Bacteria 46054
307 Ga0207426_1024346 3300025302 Bacteria 2055
308 Ga0207697_10050159 3300025315 Bacteria 1723
309 Ga0207656_10037291 3300025321 Bacteria 2044
310 Ga0207642_10042693 3300025899 Bacteria 1995
311 Ga0207642_10137887 3300025899 Bacteria 1282
312 Ga0207710_10000281 3300025900 Bacteria 41434
313 Ga0207710_10040532 3300025900 Bacteria 2064
314 Ga0207688_10074638 3300025901 Bacteria 1929
315 Ga0207647_10109707 3300025904 Bacteria 1632
316 Ga0207645_10142080 3300025907 Bacteria 1564
317 Ga0207645_10236964 3300025907 Bacteria 1205
318 Ga0207643_10103187 3300025908 Archaea 1674
319 Ga0207643_10129133 3300025908 Bacteria 1502
320 Ga0207705_10284945 3300025909 Bacteria 1265
321 Ga0207684_10171242 3300025910 Bacteria 1872
322 Ga0207654_10283782 3300025911 Bacteria 1121
323 Ga0207654_10315811 3300025911 Bacteria 1067
324 Ga0207707_10000062 3300025912 Bacteria 108192
325 Ga0207707_10004351 3300025912 Bacteria 12529
326 Ga0207707_10021687 3300025912 Bacteria 5614
327 Ga0207707_10183661 3300025912 Bacteria 1825
328 Ga0207707_10253396 3300025912 Bacteria 1529
329 Ga0207707_10352419 3300025912 Bacteria 1268
330 Ga0207695_10000326 3300025913 Bacteria 113674
331 Ga0207695_10358586 3300025913 Bacteria 1345
332 Ga0207671_10204790 3300025914 Bacteria 1542
333 Ga0207660_10000247 3300025917 Bacteria 35109
334 Ga0207662_10035006 3300025918 Bacteria 2932
335 Ga0207662_10126780 3300025918 Bacteria 1606
336 Ga0207657_10017705 3300025919 Bacteria 6823
337 Ga0207657_10147672 3300025919 Bacteria 1917
338 Ga0207649_10050822 3300025920 Unclassified 2565
339 Ga0207649_10143114 3300025920 Bacteria 1639
340 Ga0207649_10348675 3300025920 Bacteria 1095
341 Ga0207652_10000175 3300025921 Bacteria 68407
342 Ga0207652_10018356 3300025921 Bacteria 5736
343 Ga0207652_10061257 3300025921 Bacteria 3249
344 Ga0207652_10103268 3300025921 Bacteria 2520
345 Ga0207652_10247403 3300025921 Bacteria 1608
346 Ga0207646_10259244 3300025922 Bacteria 1571
347 Ga0207681_10092712 3300025923 Bacteria 2160
348 Ga0207681_10135606 3300025923 Bacteria 1826
349 Ga0207650_10003522 3300025925 Bacteria 10752
350 Ga0207650_10205484 3300025925 Bacteria 1579
351 Ga0207659_10110165 3300025926 Unclassified 2092
352 Ga0207644_10026968 3300025931 Bacteria 3966
353 Ga0207644_10029178 3300025931 Bacteria 3825
354 Ga0207644_10059148 3300025931 Bacteria 2771
355 Ga0207706_10038935 3300025933 Bacteria 4217
356 Ga0207706_10042362 3300025933 Bacteria 4035
357 Ga0207706_10126353 3300025933 Unclassified 2249
358 Ga0207706_10137714 3300025933 Bacteria 2147
359 Ga0207686_10000018 3300025934 Bacteria 189717
360 Ga0207686_10376182 3300025934 Bacteria 1076
361 Ga0207709_10000041 3300025935 Bacteria 258279
362 Ga0207709_10000056 3300025935 Bacteria 221962
363 Ga0207709_10385335 3300025935 Bacteria 1068
364 Ga0207670_10203420 3300025936 Bacteria 1506
365 Ga0207670_10232583 3300025936 Bacteria 1416
366 Ga0207670_10527150 3300025936 Bacteria 962
367 Ga0207669_10045207 3300025937 Bacteria 2593
368 Ga0207704_10174765 3300025938 Bacteria 1545
369 Ga0207704_10546338 3300025938 Bacteria 941
370 Ga0207665_10139073 3300025939 Bacteria 1730
371 Ga0207691_10007611 3300025940 Bacteria 10425
372 Ga0207691_10152883 3300025940 Bacteria 2028
373 Ga0207691_10223685 3300025940 Bacteria 1631
374 Ga0207691_10385054 3300025940 Bacteria 1197
375 Ga0207711_10021424 3300025941 Bacteria 5400
376 Ga0207711_10064070 3300025941 Unclassified 3174
377 Ga0207711_10182180 3300025941 Bacteria 1911
378 Ga0207711_10447589 3300025941 Bacteria 1202
379 Ga0207711_10573890 3300025941 Bacteria 1052
380 Ga0207689_10006673 3300025942 Bacteria 10179
381 Ga0207689_10014456 3300025942 Bacteria 6714
382 Ga0207689_10041467 3300025942 Bacteria 3809
383 Ga0207689_10121251 3300025942 Bacteria 2151
384 Ga0207689_10126224 3300025942 Bacteria 2105
385 Ga0207679_10140137 3300025945 Bacteria 1954
386 Ga0207651_10000698 3300025960 Bacteria 14356
387 Ga0207651_10168951 3300025960 Bacteria 1723
388 Ga0207651_10356423 3300025960 Unclassified 1233
389 Ga0207651_10383289 3300025960 Bacteria 1192
390 Ga0207712_10004145 3300025961 Bacteria 9156
391 Ga0207712_10010062 3300025961 Bacteria 5996
392 Ga0207712_10047321 3300025961 Bacteria 2986
393 Ga0207712_10360824 3300025961 Bacteria 1211
394 Ga0207668_10091468 3300025972 Bacteria 2236
395 Ga0207668_10404407 3300025972 Bacteria 1155
396 Ga0207640_10103393 3300025981 Bacteria 2003
397 Ga0207640_10108312 3300025981 Bacteria 1963
398 Ga0207658_10055440 3300025986 Bacteria 2937
399 Ga0207658_10158818 3300025986 Bacteria 1851
400 Ga0207677_10119688 3300026023 Bacteria 1978
401 Ga0207677_10261724 3300026023 Bacteria 1410
402 Ga0207703_10085755 3300026035 Unclassified 2636
403 Ga0207703_10100340 3300026035 Bacteria 2452
404 Ga0207703_10147340 3300026035 Bacteria 2049
405 Ga0207703_10281876 3300026035 Bacteria 1509
406 Ga0207703_10298441 3300026035 Bacteria 1469
407 Ga0207703_10381773 3300026035 Bacteria 1303
408 Ga0207639_10208830 3300026041 Bacteria 1679
409 Ga0207678_10001055 3300026067 Bacteria 25207
410 Ga0207678_10373651 3300026067 Bacteria 1232
411 Ga0207708_10003221 3300026075 Bacteria 12023
412 Ga0207708_10005083 3300026075 Bacteria 9704
413 Ga0207708_10100344 3300026075 Bacteria 2240
414 Ga0207708_10184577 3300026075 Bacteria 1657
415 Ga0207708_10195079 3300026075 Bacteria 1613
416 Ga0207702_10342577 3300026078 Bacteria 1428
417 Ga0207641_10018141 3300026088 Bacteria 5766
418 Ga0207641_10145190 3300026088 Bacteria 2145
419 Ga0207641_10260444 3300026088 Bacteria 1623
420 Ga0207641_10264568 3300026088 Bacteria 1611
421 Ga0207648_10002187 3300026089 Bacteria 21219
422 Ga0207648_10042247 3300026089 Bacteria 4003
423 Ga0207648_10197408 3300026089 Bacteria 1784
424 Ga0207648_10246797 3300026089 Bacteria 1591
425 Ga0207676_10016280 3300026095 Bacteria 5383
426 Ga0207676_10103244 3300026095 Bacteria 2368
427 Ga0207676_10194253 3300026095 Bacteria 1788
428 Ga0207676_10499796 3300026095 Bacteria 1154
429 Ga0207674_10149291 3300026116 Bacteria 2295
430 Ga0207674_10162699 3300026116 Bacteria 2186
431 Ga0207674_10174879 3300026116 Bacteria 2099
432 Ga0207675_100000779 3300026118 Bacteria 31810
433 Ga0207675_100008372 3300026118 Bacteria 9747
434 Ga0207675_100009986 3300026118 Bacteria 8890
435 Ga0207675_100081549 3300026118 Bacteria 3033
436 Ga0207675_100123670 3300026118 Unclassified 2449
437 Ga0207675_100141708 3300026118 Bacteria 2284
438 Ga0207683_10141153 3300026121 Bacteria 2171
439 Ga0207683_10179962 3300026121 Bacteria 1917
440 Ga0207683_10191426 3300026121 Bacteria 1857
441 Ga0207698_10031562 3300026142 Bacteria 3826
442 Ga0207698_10209575 3300026142 Bacteria 1752
443 Ga0207698_10220841 3300026142 Bacteria 1712
444 Ga0207698_10579894 3300026142 Bacteria 1103
445 Ga0209588_1027172 3300027671 Bacteria 1820
446 Ga0209998_10014173 3300027717 Bacteria 1663
447 Ga0207428_10008688 3300027907 Bacteria 9169
448 Ga0207428_10018846 3300027907 Bacteria 5888
449 Ga0207428_10020626 3300027907 Bacteria 5595
450 Ga0207428_10079943 3300027907 Bacteria 2555
451 Ga0207428_10098014 3300027907 Bacteria 2269
452 Ga0207428_10099543 3300027907 Bacteria 2248
453 Ga0207428_10121655 3300027907 Bacteria 2001
454 Ga0207428_10127071 3300027907 Bacteria 1952
455 Ga0268266_10063617 3300028379 Bacteria 3185
456 Ga0268265_10000547 3300028380 Bacteria 38290
457 Ga0268265_10098193 3300028380 Bacteria 2358
458 Ga0268265_10105878 3300028380 Bacteria 2283
459 Ga0268265_10339348 3300028380 Bacteria 1367
460 Ga0268265_10386607 3300028380 Bacteria 1289
461 Ga0268264_10023936 3300028381 Bacteria 4982
462 Ga0268264_10155813 3300028381 Bacteria 2053
463 Ga0268264_10161590 3300028381 Bacteria 2018
464 Ga0268264_10190883 3300028381 Bacteria 1867
465 Ga0268264_10442971 3300028381 Bacteria 1257
466 Ga0268264_10443461 3300028381 Bacteria 1256
467 Ga0307515_10000019 3300028794 Bacteria 422262
468 Ga0265338_10153338 3300028800 Bacteria 1788
469 Ga0265762_1018551 3300030760 Bacteria 1271
470 Ga0265760_10052291 3300031090 Bacteria 1231
471 Ga0307408_100095398 3300031548 Bacteria 2255
472 Ga0307408_100540554 3300031548 Bacteria 1027
473 Ga0307405_10011842 3300031731 Bacteria 4591
474 Ga0307405_10222927 3300031731 Bacteria 1385
475 Ga0307413_10009362 3300031824 Bacteria 4685
476 Ga0307413_10018014 3300031824 Bacteria 3694
477 Ga0307410_10003028 3300031852 Bacteria 8303
478 Ga0307410_10156140 3300031852 Bacteria 1704
479 Ga0307406_10015702 3300031901 Bacteria 4389
480 Ga0307406_10051804 3300031901 Bacteria 2608
481 Ga0307406_10116964 3300031901 Bacteria 1846
482 Ga0307407_10020565 3300031903 Bacteria 3386
483 Ga0307407_10092584 3300031903 Bacteria 1857
484 Ga0307407_10419301 3300031903 Bacteria 964
485 Ga0307409_100001622 3300031995 Bacteria 11240
486 Ga0307409_100270651 3300031995 Bacteria 1564
487 Ga0307409_100387142 3300031995 Bacteria 1331
488 Ga0307416_100019419 3300032002 Bacteria 4818
489 Ga0307416_100651493 3300032002 Bacteria 1138
490 Ga0307411_10240986 3300032005 Bacteria 1416
491 Ga0307415_100027265 3300032126 Bacteria 3617
492 Ga0373926_0031146 3300035083 Bacteria 1880
493 Ga0373949_0078880 3300035090 Bacteria 875
494 Ga0373954_0141510 3300035118 Bacteria 1173
495 Ga0373924_0160170 3300035410 Bacteria 987
496 Ga0373931_0104058 3300035691 Bacteria 1601
497 Ga0373935_0068823 3300035692 Bacteria 2278
498 Ga0373927_0173065 3300035695 Bacteria 1415
499 Ga0373925_0491123 3300037068 Bacteria 1007
500 Ga0395900_0177466 3300037418 Bacteria 2166
501 Ga0436364_0689913 3300037853 Bacteria 1683
502 Ga0395901_0268849 3300038443 Bacteria 1774
503 Ga0395901_0268851 3300038443 Bacteria 1774
504 Ga0242420_017696 3300038996 Bacteria 1250
505 Ga0436363_0056893 3300039450 Bacteria 929
506 Ga0439462_0045612 3300042015 Bacteria 1174
507 Ga0439464_0076177 3300042439 Bacteria 997
508 Ga0451577_0000318 3300042876 Bacteria 90882
509 Ga0451577_0044503 3300042876 Bacteria 3974
510 Ga0453683_0088554 3300044673 Bacteria 1940
511 Ga0453684_0006872 3300044712 Bacteria 21361
512 Ga0453684_0072803 3300044712 Bacteria 4335
513 Ga0453684_0136828 3300044712 Bacteria 2931
514 Ga0453684_0656217 3300044712 Bacteria 1144
515 Ga0451576_0041249 3300045051 Bacteria 4881
516 Ga0451576_0236416 3300045051 Unclassified 1908
517 Ga0495592_0101895 3300046454 Bacteria 2045
518 Ga0495651_0173601 3300046462 Bacteria 1532
519 Ga0495580_0093104 3300046472 Bacteria 2097
520 Ga0495582_0062412 3300046473 Bacteria 2058
521 Ga0495662_0088400 3300046476 Bacteria 1509
522 Ga0495664_0047970 3300046477 Bacteria 2535
523 Ga0495618_0188559 3300046514 Bacteria 1308
524 Ga0495620_0149739 3300046515 Bacteria 910
525 Ga0495628_0044794 3300046516 Bacteria 3518
526 Ga0495630_0091364 3300046517 Bacteria 2300
527 Ga0495652_0060741 3300046529 Bacteria 3193
528 Ga0495587_0052088 3300046536 Bacteria 2416
529 Ga0495621_0006506 3300046539 Bacteria 3417
530 Ga0495645_0017574 3300046543 Bacteria 5123
531 Ga0495656_0077580 3300046615 Bacteria 1491
532 Ga0495656_0099303 3300046615 Bacteria 1344
533 Ga0495634_0030257 3300046642 Bacteria 3741
534 Ga0495635_0038384 3300046663 Bacteria 3316
535 Ga0495659_0033840 3300046664 Bacteria 1795
536 Ga0495599_0074829 3300046678 Bacteria 2114
537 Ga0495623_0185994 3300046679 Bacteria 1203
538 Ga0495646_0078356 3300046680 Bacteria 1931
539 Ga0495669_0036502 3300046684 Bacteria 2173
540 Ga0495581_0126333 3300047315 Bacteria 1489
541 Ga0495672_0020807 3300047320 Unclassified 4291
542 Ga0495680_0043188 3300047322 Bacteria 3571
543 Ga0495675_0143219 3300047444 Bacteria 1480
544 Ga0496102_0649919 3300048905 Bacteria 978
545 Ga0496106_0412374 3300048909 Bacteria 1086
546 Ga0496108_0430154 3300048911 Bacteria 1153
547 Ga0496109_0053291 3300048912 Bacteria 3689
548 Ga0496109_0100698 3300048912 Bacteria 2681
549 Ga0496112_0682813 3300048915 Bacteria 955
550 Ga0496113_0138461 3300048916 Unclassified 1914
551 Ga0496118_0059290 3300048921 Bacteria 2852
552 Ga0501296_010354 3300049519 Bacteria 1105
553 Ga0501300_009726 3300049523 Bacteria 1402
554 Ga0501034_0013290 3300049571 Bacteria 8482
555 Ga0501048_0372399 3300049582 Bacteria 1019
556 Ga0501067_0012423 3300049583 Bacteria 4724
557 Ga0501067_0089567 3300049583 Bacteria 1707
558 Ga0501069_0038954 3300049585 Bacteria 2624
559 Ga0501070_0011542 3300049586 Bacteria 7457
560 Ga0501071_0045621 3300049587 Bacteria 3146
561 Ga0501071_0068986 3300049587 Bacteria 2573
562 Ga0501072_0006490 3300049588 Bacteria 8908
563 Ga0501072_0038927 3300049588 Bacteria 3733
564 Ga0501072_0301006 3300049588 Bacteria 1275
565 Ga0501073_0006479 3300049589 Bacteria 8709
566 Ga0501074_0017307 3300049590 Bacteria 5228
567 Ga0501074_0081916 3300049590 Bacteria 2314
568 Ga0501077_0132925 3300049593 Bacteria 1578
569 Ga0501080_0028709 3300049742 Bacteria 5178
570 Ga0501080_0149476 3300049742 Bacteria 2159
571 Ga0501083_0003403 3300049744 Bacteria 11129
572 Ga0501083_0132011 3300049744 Bacteria 1637
573 Ga0501083_0201452 3300049744 Bacteria 1298
574 nmdc:mga05p37_100050_c1 3300050507 Bacteria 3570
575 nmdc:mga05p37_133928_c1 3300050507 Bacteria 3040
576 nmdc:mga05p37_205142_c1 3300050507 Bacteria 2385
577 nmdc:mga05p37_337282_c1 3300050507 Bacteria 1779
578 nmdc:mga05p37_39588_c1 3300050507 Bacteria 5788
579 nmdc:mga05p37_67774_c1 3300050507 Bacteria 4390
580 nmdc:mga05p37_80409_c1 3300050507 Bacteria 4015
581 nmdc:mga05p37_86563_c1 3300050507 Bacteria 3862
582 nmdc:mga05p37_94321_c1 3300050507 Bacteria 3688
583 nmdc:mga09592_29475_c1 3300050508 Bacteria 4565
584 nmdc:mga09592_310072_c1 3300050508 Bacteria 1368
585 nmdc:mga09592_655_c1 3300050508 Bacteria 26383
586 nmdc:mga09592_66773_c1 3300050508 Bacteria 3049
587 nmdc:mga09592_722415_c1 3300050508 Bacteria 847
588 nmdc:mga0qj67_103613_c1 3300050509 Bacteria 2295
589 nmdc:mga0qj67_1222_c1 3300050509 Bacteria 17888
590 nmdc:mga0qj67_3672_c2 3300050509 Bacteria 3260
591 nmdc:mga0qj67_41329_c1 3300050509 Bacteria 3626
592 nmdc:mga0qj67_446338_c1 3300050509 Bacteria 1042
593 nmdc:mga0qj67_67695_c1 3300050509 Bacteria 2845
594 nmdc:mga06r32_203166_c1 3300050510 Bacteria 1969
595 nmdc:mga06r32_279931_c1 3300050510 Unclassified 1655
596 nmdc:mga06r32_351834_c1 3300050510 Bacteria 1458
597 nmdc:mga06r32_4704_c1 3300050510 Bacteria 12267
598 nmdc:mga06r32_493156_c1 3300050510 Bacteria 1202
599 nmdc:mga06r32_59667_c1 3300050510 Bacteria 3670
600 nmdc:mga06r32_842_c1 3300050510 Bacteria 27157
601 nmdc:mga06r32_94374_c1 3300050510 Bacteria 2927
602 nmdc:mga08y16_106981_c1 3300050511 Bacteria 2911
603 nmdc:mga08y16_152743_c1 3300050511 Bacteria 2400
604 nmdc:mga08y16_183481_c1 3300050511 Bacteria 2172
605 nmdc:mga08y16_22888_c1 3300050511 Bacteria 6595
606 nmdc:mga08y16_291100_c1 3300050511 Bacteria 1684
607 nmdc:mga08y16_312416_c1 3300050511 Bacteria 1619
608 nmdc:mga08y16_34799_c1 3300050511 Bacteria 5292
609 nmdc:mga08y16_431_c1 3300050511 Bacteria 38693
610 nmdc:mga08y16_546467_c1 3300050511 Unclassified 1173
611 nmdc:mga08y16_87714_c1 3300050511 Bacteria 3242
612 nmdc:mga0n895_136318_c1 3300050512 Bacteria 2481
613 nmdc:mga0n895_1568_c1 3300050512 Bacteria 17188
614 nmdc:mga0n895_84849_c1 3300050512 Bacteria 3161
615 nmdc:mga0n895_89121_c1 3300050512 Bacteria 3086
616 nmdc:mga0rr50_151239_c1 3300050513 Unclassified 1876
617 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
618 nmdc:mga08x19_59_c1 3300050514 Bacteria 118026
619 nmdc:mga0a205_112899_c1 3300050515 Bacteria 2616
620 nmdc:mga0a205_15472_c1 3300050515 Bacteria 7131
621 nmdc:mga0a205_214762_c1 3300050515 Bacteria 1811
622 nmdc:mga0a205_375584_c1 3300050515 Bacteria 1287
623 nmdc:mga0a205_54_c1 3300050515 Bacteria 62054
624 nmdc:mga0a205_585817_c1 3300050515 Bacteria 969
625 Ga0500644_0000151 3300053088 Bacteria 43560
626 Ga0500616_0000047 3300053153 Bacteria 322354
627 Ga0500616_0000378 3300053153 Bacteria 62462
628 Ga0500616_0002076 3300053153 Bacteria 17545
629 Ga0500633_0000575 3300053160 Bacteria 6012
630 Ga0501084_0004483 3300054114 Bacteria 11403
631 Ga0501084_0018981 3300054114 Bacteria 5724
632 Ga0501082_0003803 3300060353 Bacteria 13200
633 Ga0530510_0231527 3300061734 Bacteria 1374
634 2920109674 2920107658 Bacteria 10042636
635 Ga0068862_100119386
636 JGI24739J22299_10005069
637 JGI25153J46596_10021585
638 rootH2_10044432
639 rootL2_10004956
640 rootH1_10051591
641 JGI25160J50197_1000735
642 Ga0055526_1005165
643 Ga0055528_1001241
644 Ga0055530_10001539
645 Ga0055543_1010855
646 Ga0065165_1000525
647 Ga0065704_10123260
648 Ga0065712_10000599
649 Ga0065712_10001080
650 Ga0065712_10074185
651 Ga0065715_10094969
652 Ga0065715_10268286
653 Ga0065707_10083023
654 Ga0065707_10092132
655 Ga0070676_10010770
656 Ga0070690_100000538
657 Ga0070690_100023068
658 Ga0070670_100069370
659 Ga0070670_100211031
660 Ga0070670_100269740
661 Ga0070677_10129325
662 Ga0068869_100023108
663 Ga0068869_100112755
664 Ga0070666_10227434
665 Ga0070680_100000255
666 Ga0070680_100376601
667 Ga0070680_100425605
668 Ga0070682_100307069
669 Ga0068868_100149815
670 Ga0070689_100119201
671 Ga0070687_100062068
672 Ga0070661_100068282
673 Ga0070692_10003110
674 Ga0070668_100018690
675 Ga0070669_100029435
676 Ga0070669_100110732
677 Ga0070669_100131041
678 Ga0070675_100001553
679 Ga0070675_100169206
680 Ga0070675_100235191
681 Ga0070675_100401614
682 Ga0070671_100043971
683 Ga0070671_100086917
684 Ga0070674_100044531
685 Ga0070674_100064780
686 Ga0070673_100001098
687 Ga0070673_100031266
688 Ga0070673_100116490
689 Ga0070688_100042669
690 Ga0070659_100377302
691 Ga0070667_100044210
692 Ga0070667_100067323
693 Ga0070701_10005249
694 Ga0070701_10019528
695 Ga0070705_100053056
696 Ga0070705_100072091
697 Ga0070705_100185894
698 Ga0070700_100144108
699 Ga0070700_100380147
700 Ga0070694_100000904
701 Ga0070694_100017794
702 Ga0070694_100110174
703 Ga0070708_100551149
704 Ga0070663_100029109
705 Ga0070678_100152978
706 Ga0070662_100040544
707 Ga0070662_100108649
708 Ga0070662_100167799
709 Ga0070681_10000032
710 Ga0070681_10070428
711 Ga0070681_10171095
712 Ga0070681_10269886
713 Ga0068867_100001356
714 Ga0068867_100098772
715 Ga0070685_10099907
716 Ga0070685_10152669
717 Ga0070685_10281495
718 Ga0070706_100165271
719 Ga0070698_100005844
720 Ga0070698_100007147
721 Ga0070698_100153452
722 Ga0070698_100369879
723 Ga0070698_100402319
724 Ga0070699_100000251
725 Ga0070699_100040805
726 Ga0070699_100087853
727 Ga0070699_100128193
728 Ga0070679_100000111
729 Ga0070684_100152024
730 Ga0070684_100355197
731 Ga0068853_100033399
732 Ga0068853_100364433
733 Ga0068853_100607187
734 Ga0070672_100341362
735 Ga0070686_100138813
736 Ga0070686_100163360
737 Ga0070695_100035876
738 Ga0070695_100107168
739 Ga0070695_100126673
740 Ga0070696_100134548
741 Ga0070696_100251850
742 Ga0070696_100437728
743 Ga0070693_100011213
744 Ga0070693_100153479
745 Ga0070665_100006297
746 Ga0070665_100030093
747 Ga0070704_100232273
748 Ga0070664_100000870
749 Ga0070664_100149267
750 Ga0068857_100136002
751 Ga0068857_100189711
752 Ga0068854_100048107
753 Ga0068854_100162594
754 Ga0068854_100234527
755 Ga0068856_100015332
756 Ga0068856_100058194
757 Ga0070702_100002240
758 Ga0070702_100244166
759 Ga0068852_100097505
760 Ga0068852_100455224
761 Ga0068859_100000128
762 Ga0068859_100017870
763 Ga0068859_100028039
764 Ga0068859_100046925
765 Ga0068859_100085471
766 Ga0068859_100128817
767 Ga0068859_100160833
768 Ga0068859_100387396
769 Ga0068859_100451594
770 Ga0068864_100000771
771 Ga0068864_100073245
772 Ga0068864_100079795
773 Ga0068864_100106570
774 Ga0068864_100262208
775 Ga0068864_100308779
776 Ga0068866_10073377
777 Ga0068861_100000325
778 Ga0068861_100035784
779 Ga0068861_100098136
780 Ga0068861_100283149
781 Ga0068851_10000051
782 Ga0068870_10017350
783 Ga0068863_100116706
784 Ga0068863_100309747
785 Ga0068858_100030840
786 Ga0068858_100091135
787 Ga0068858_100100203
788 Ga0068860_100086613
789 Ga0068860_100092258
790 Ga0068860_100164406
791 Ga0068860_100232551
792 Ga0068862_100000722
793 Ga0068862_100002467
794 Ga0068862_100039161
795 Ga0068862_100118409
796 Ga0068862_100325175
797 Ga0081455_10006826
798 Ga0081455_10025843
799 Ga0081539_10003097
800 Ga0070717_10076195
801 Ga0070716_100136023
802 Ga0097621_100003491
803 Ga0068871_100022816
804 Ga0068871_100053651
805 Ga0068871_100092607
806 Ga0068871_100132678
807 Ga0068871_100313835
808 Ga0075428_100001961
809 Ga0075428_100024165
810 Ga0075428_100029141
811 Ga0075428_100063090
812 Ga0075428_100124258
813 Ga0075428_100366686
814 Ga0075428_100722269
815 Ga0075430_100053718
816 Ga0075430_100057863
817 Ga0075431_100000011
818 Ga0075431_100001505
819 Ga0075431_100005404
820 Ga0075431_100049956
821 Ga0075431_100320386
822 Ga0075431_100471239
823 Ga0075433_10000163
824 Ga0075433_10035336
825 Ga0075433_10133107
826 Ga0075433_10366209
827 Ga0075434_100000405
828 Ga0075434_100129223
829 Ga0075434_100187690
830 Ga0075429_100000689
831 Ga0075429_100073231
832 Ga0075429_100154606
833 Ga0075429_100203567
834 Ga0068865_100016853
835 Ga0068865_100325134
836 Ga0075436_100001530
837 Ga0097620_100000128
838 Ga0097620_100017869
839 Ga0097620_100028040
840 Ga0097620_100046925
841 Ga0097620_100085472
842 Ga0097620_100128814
843 Ga0097620_100160834
844 Ga0097620_100387363
845 Ga0097620_100451604
846 Ga0075435_100005843
847 Ga0099794_10033448
848 Ga0099795_10064417
849 Ga0105240_10000223
850 Ga0105240_10159424
851 Ga0105240_10566963
852 Ga0111539_10004994
853 Ga0111539_10006898
854 Ga0111539_10015647
855 Ga0111539_10019711
856 Ga0111539_10037876
857 Ga0111539_10213523
858 Ga0105247_10001251
859 Ga0105247_10060173
860 Ga0114129_10028678
861 Ga0114129_10050373
862 Ga0114129_10051684
863 Ga0114129_10086408
864 Ga0114129_10289335
865 Ga0114129_10315035
866 Ga0114129_10427696
867 Ga0114129_10596295
868 Ga0105243_10000412
869 Ga0105243_10000824
870 Ga0105243_10025905
871 Ga0105241_10055395
872 Ga0105241_10425801
873 Ga0105242_10000133
874 Ga0105242_10001014
875 Ga0105242_10066451
876 Ga0105242_10206612
877 Ga0105248_10023490
878 Ga0105248_10052186
879 Ga0105248_10436508
880 Ga0105248_10592136
881 Ga0105237_10042779
882 Ga0105237_10289577
883 Ga0105238_10067259
884 Ga0105249_10002342
885 Ga0105249_10004971
886 Ga0105249_10031266
887 Ga0105249_10174722
888 Ga0105249_10204686
889 Ga0105249_10253328
890 Ga0105249_10796525
891 Ga0099796_10028511
892 Ga0099796_10066216
893 Ga0105239_10037657
894 Ga0105239_10045882
895 Ga0105239_10326018
896 Ga0105239_10343213
897 Ga0105239_10509867
898 Ga0157373_10027671
899 Ga0157373_10044945
900 Ga0157373_10113194
901 Ga0157373_10185007
902 Ga0157373_10202065
903 Ga0157371_10326443
904 Ga0157370_10039260
905 Ga0157369_10073859
906 Ga0157369_10415788
907 Ga0157374_10209431
908 Ga0157374_10479199
909 Ga0157378_10055820
910 Ga0157378_10407416
911 Ga0163162_10001047
912 Ga0163162_10073113
913 Ga0163162_10102248
914 Ga0163162_10103962
915 Ga0163162_10243455
916 Ga0163162_10307704
917 Ga0157372_10021096
918 Ga0157372_10049253
919 Ga0157375_10163539
920 Ga0157375_10191982
921 Ga0157375_10431887
922 Ga0163163_10114007
923 Ga0157380_10082516
924 Ga0157380_10084760
925 Ga0157380_10088930
926 Ga0157380_10487934
927 Ga0157377_10026942
928 Ga0157377_10061784
929 Ga0157379_10159187
930 Ga0157376_10342177
931 Ga0157376_10351061
932 Ga0157376_10393171
933 Ga0163161_10000627
934 Ga0209673_1000014
935 Ga0209673_1000018
936 Ga0209564_1009841
937 Ga0209758_1002678
938 Ga0209758_1004647
939 Ga0209050_1000750
940 Ga0207426_1000612
941 Ga0207426_1024346
942 Ga0207697_10050159
943 Ga0207656_10037291
944 Ga0207642_10042693
945 Ga0207642_10137887
946 Ga0207710_10000281
947 Ga0207710_10040532
948 Ga0207688_10074638
949 Ga0207647_10109707
950 Ga0207645_10142080
951 Ga0207645_10236964
952 Ga0207643_10103187
953 Ga0207643_10129133
954 Ga0207705_10284945
955 Ga0207684_10171242
956 Ga0207654_10283782
957 Ga0207654_10315811
958 Ga0207707_10000062
959 Ga0207707_10004351
960 Ga0207707_10021687
961 Ga0207707_10183661
962 Ga0207707_10253396
963 Ga0207707_10352419
964 Ga0207695_10000326
965 Ga0207695_10358586
966 Ga0207671_10204790
967 Ga0207660_10000247
968 Ga0207662_10035006
969 Ga0207662_10126780
970 Ga0207657_10017705
971 Ga0207657_10147672
972 Ga0207649_10050822
973 Ga0207649_10143114
974 Ga0207649_10348675
975 Ga0207652_10000175
976 Ga0207652_10018356
977 Ga0207652_10061257
978 Ga0207652_10103268
979 Ga0207652_10247403
980 Ga0207646_10259244
981 Ga0207681_10092712
982 Ga0207681_10135606
983 Ga0207650_10003522
984 Ga0207650_10205484
985 Ga0207659_10110165
986 Ga0207644_10026968
987 Ga0207644_10029178
988 Ga0207644_10059148
989 Ga0207706_10038935
990 Ga0207706_10042362
991 Ga0207706_10126353
992 Ga0207706_10137714
993 Ga0207686_10000018
994 Ga0207686_10376182
995 Ga0207709_10000041
996 Ga0207709_10000056
997 Ga0207709_10385335
998 Ga0207670_10203420
999 Ga0207670_10232583
1000 Ga0207670_10527150
1001 Ga0207669_10045207
1002 Ga0207704_10174765
1003 Ga0207704_10546338
1004 Ga0207665_10139073
1005 Ga0207691_10007611
1006 Ga0207691_10152883
1007 Ga0207691_10223685
1008 Ga0207691_10385054
1009 Ga0207711_10021424
1010 Ga0207711_10064070
1011 Ga0207711_10182180
1012 Ga0207711_10447589
1013 Ga0207711_10573890
1014 Ga0207689_10006673
1015 Ga0207689_10014456
1016 Ga0207689_10041467
1017 Ga0207689_10121251
1018 Ga0207689_10126224
1019 Ga0207679_10140137
1020 Ga0207651_10000698
1021 Ga0207651_10168951
1022 Ga0207651_10356423
1023 Ga0207651_10383289
1024 Ga0207712_10004145
1025 Ga0207712_10010062
1026 Ga0207712_10047321
1027 Ga0207712_10360824
1028 Ga0207668_10091468
1029 Ga0207668_10404407
1030 Ga0207640_10103393
1031 Ga0207640_10108312
1032 Ga0207658_10055440
1033 Ga0207658_10158818
1034 Ga0207677_10119688
1035 Ga0207677_10261724
1036 Ga0207703_10085755
1037 Ga0207703_10100340
1038 Ga0207703_10147340
1039 Ga0207703_10281876
1040 Ga0207703_10298441
1041 Ga0207703_10381773
1042 Ga0207639_10208830
1043 Ga0207678_10001055
1044 Ga0207678_10373651
1045 Ga0207708_10003221
1046 Ga0207708_10005083
1047 Ga0207708_10100344
1048 Ga0207708_10184577
1049 Ga0207708_10195079
1050 Ga0207702_10342577
1051 Ga0207641_10018141
1052 Ga0207641_10145190
1053 Ga0207641_10260444
1054 Ga0207641_10264568
1055 Ga0207648_10002187
1056 Ga0207648_10042247
1057 Ga0207648_10197408
1058 Ga0207648_10246797
1059 Ga0207676_10016280
1060 Ga0207676_10103244
1061 Ga0207676_10194253
1062 Ga0207676_10499796
1063 Ga0207674_10149291
1064 Ga0207674_10162699
1065 Ga0207674_10174879
1066 Ga0207675_100000779
1067 Ga0207675_100008372
1068 Ga0207675_100009986
1069 Ga0207675_100081549
1070 Ga0207675_100123670
1071 Ga0207675_100141708
1072 Ga0207683_10141153
1073 Ga0207683_10179962
1074 Ga0207683_10191426
1075 Ga0207698_10031562
1076 Ga0207698_10209575
1077 Ga0207698_10220841
1078 Ga0207698_10579894
1079 Ga0209588_1027172
1080 Ga0209998_10014173
1081 Ga0207428_10008688
1082 Ga0207428_10018846
1083 Ga0207428_10020626
1084 Ga0207428_10079943
1085 Ga0207428_10098014
1086 Ga0207428_10099543
1087 Ga0207428_10121655
1088 Ga0207428_10127071
1089 Ga0268266_10063617
1090 Ga0268265_10000547
1091 Ga0268265_10098193
1092 Ga0268265_10105878
1093 Ga0268265_10339348
1094 Ga0268265_10386607
1095 Ga0268264_10023936
1096 Ga0268264_10155813
1097 Ga0268264_10161590
1098 Ga0268264_10190883
1099 Ga0268264_10442971
1100 Ga0268264_10443461
1101 Ga0307515_10000019
1102 Ga0265338_10153338
1103 Ga0265762_1018551
1104 Ga0265760_10052291
1105 Ga0307408_100095398
1106 Ga0307408_100540554
1107 Ga0307405_10011842
1108 Ga0307405_10222927
1109 Ga0307413_10009362
1110 Ga0307413_10018014
1111 Ga0307410_10003028
1112 Ga0307410_10156140
1113 Ga0307406_10015702
1114 Ga0307406_10051804
1115 Ga0307406_10116964
1116 Ga0307407_10020565
1117 Ga0307407_10092584
1118 Ga0307407_10419301
1119 Ga0307409_100001622
1120 Ga0307409_100270651
1121 Ga0307409_100387142
1122 Ga0307416_100019419
1123 Ga0307416_100651493
1124 Ga0307411_10240986
1125 Ga0307415_100027265
1126 Ga0373926_0031146
1127 Ga0373949_0078880
1128 Ga0373954_0141510
1129 Ga0373924_0160170
1130 Ga0373931_0104058
1131 Ga0373935_0068823
1132 Ga0373927_0173065
1133 Ga0373925_0491123
1134 Ga0395900_0177466
1135 Ga0436364_0689913
1136 Ga0395901_0268849
1137 Ga0395901_0268851
1138 Ga0242420_017696
1139 Ga0436363_0056893
1140 Ga0439462_0045612
1141 Ga0439464_0076177
1142 Ga0451577_0000318
1143 Ga0451577_0044503
1144 Ga0453683_0088554
1145 Ga0453684_0006872
1146 Ga0453684_0072803
1147 Ga0453684_0136828
1148 Ga0453684_0656217
1149 Ga0451576_0041249
1150 Ga0451576_0236416
1151 Ga0495592_0101895
1152 Ga0495651_0173601
1153 Ga0495580_0093104
1154 Ga0495582_0062412
1155 Ga0495662_0088400
1156 Ga0495664_0047970
1157 Ga0495618_0188559
1158 Ga0495620_0149739
1159 Ga0495628_0044794
1160 Ga0495630_0091364
1161 Ga0495652_0060741
1162 Ga0495587_0052088
1163 Ga0495621_0006506
1164 Ga0495645_0017574
1165 Ga0495656_0077580
1166 Ga0495656_0099303
1167 Ga0495634_0030257
1168 Ga0495635_0038384
1169 Ga0495659_0033840
1170 Ga0495599_0074829
1171 Ga0495623_0185994
1172 Ga0495646_0078356
1173 Ga0495669_0036502
1174 Ga0495581_0126333
1175 Ga0495672_0020807
1176 Ga0495680_0043188
1177 Ga0495675_0143219
1178 Ga0496102_0649919
1179 Ga0496106_0412374
1180 Ga0496108_0430154
1181 Ga0496109_0053291
1182 Ga0496109_0100698
1183 Ga0496112_0682813
1184 Ga0496113_0138461
1185 Ga0496118_0059290
1186 Ga0501296_010354
1187 Ga0501300_009726
1188 Ga0501034_0013290
1189 Ga0501048_0372399
1190 Ga0501067_0012423
1191 Ga0501067_0089567
1192 Ga0501069_0038954
1193 Ga0501070_0011542
1194 Ga0501071_0045621
1195 Ga0501071_0068986
1196 Ga0501072_0006490
1197 Ga0501072_0038927
1198 Ga0501072_0301006
1199 Ga0501073_0006479
1200 Ga0501074_0017307
1201 Ga0501074_0081916
1202 Ga0501077_0132925
1203 Ga0501080_0028709
1204 Ga0501080_0149476
1205 Ga0501083_0003403
1206 Ga0501083_0132011
1207 Ga0501083_0201452
1208 nmdc:mga05p37_100050_c1
1209 nmdc:mga05p37_133928_c1
1210 nmdc:mga05p37_205142_c1
1211 nmdc:mga05p37_337282_c1
1212 nmdc:mga05p37_39588_c1
1213 nmdc:mga05p37_67774_c1
1214 nmdc:mga05p37_80409_c1
1215 nmdc:mga05p37_86563_c1
1216 nmdc:mga05p37_94321_c1
1217 nmdc:mga09592_29475_c1
1218 nmdc:mga09592_310072_c1
1219 nmdc:mga09592_655_c1
1220 nmdc:mga09592_66773_c1
1221 nmdc:mga09592_722415_c1
1222 nmdc:mga0qj67_103613_c1
1223 nmdc:mga0qj67_1222_c1
1224 nmdc:mga0qj67_3672_c2
1225 nmdc:mga0qj67_41329_c1
1226 nmdc:mga0qj67_446338_c1
1227 nmdc:mga0qj67_67695_c1
1228 nmdc:mga06r32_203166_c1
1229 nmdc:mga06r32_279931_c1
1230 nmdc:mga06r32_351834_c1
1231 nmdc:mga06r32_4704_c1
1232 nmdc:mga06r32_493156_c1
1233 nmdc:mga06r32_59667_c1
1234 nmdc:mga06r32_842_c1
1235 nmdc:mga06r32_94374_c1
1236 nmdc:mga08y16_106981_c1
1237 nmdc:mga08y16_152743_c1
1238 nmdc:mga08y16_183481_c1
1239 nmdc:mga08y16_22888_c1
1240 nmdc:mga08y16_291100_c1
1241 nmdc:mga08y16_312416_c1
1242 nmdc:mga08y16_34799_c1
1243 nmdc:mga08y16_431_c1
1244 nmdc:mga08y16_546467_c1
1245 nmdc:mga08y16_87714_c1
1246 nmdc:mga0n895_136318_c1
1247 nmdc:mga0n895_1568_c1
1248 nmdc:mga0n895_84849_c1
1249 nmdc:mga0n895_89121_c1
1250 nmdc:mga0rr50_151239_c1
1251 nmdc:mga08x19_12_c1
1252 nmdc:mga08x19_59_c1
1253 nmdc:mga0a205_112899_c1
1254 nmdc:mga0a205_15472_c1
1255 nmdc:mga0a205_214762_c1
1256 nmdc:mga0a205_375584_c1
1257 nmdc:mga0a205_54_c1
1258 nmdc:mga0a205_585817_c1
1259 Ga0500644_0000151
1260 Ga0500616_0000047
1261 Ga0500616_0000378
1262 Ga0500616_0002076
1263 Ga0500633_0000575
1264 Ga0501084_0004483
1265 Ga0501084_0018981
1266 Ga0501082_0003803
1267 Ga0530510_0231527
1268 2920109674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

82

240

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

83

272

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

84

309

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8664 37 152
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8568 33 152
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8316 35 290
2dst-assembly1.cif.gz_B crystal structure analysis of tt1977 0.8237 36 155
2ocl-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase s122a mutant 0.8236 37 290
ID Description Score Start End Superfamily
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9374 46 157 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9217 37 156 3.40.50.1820
af_A0A1D6M0A7_18_159_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8534 37 142 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8359 32 121 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8307 32 145 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A3R8L443-F1-model_v4 Alpha/beta fold hydrolase 0.9752 46 148 GO:0016020
GO:0016787
AF-A0A3D3ZGN8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9656 78 290
AF-A0A7V9HJ36-F1-model_v4 Alpha/beta hydrolase 0.9607 31 228 GO:0017171
AF-A0A1I1QL96-F1-model_v4 Alpha/beta hydrolase fold 0.9591 29 162 GO:0016787
AF-A0A3N4Q4W6-F1-model_v4 Alpha/beta hydrolase 0.9566 29 293 GO:0017171

Map