F471140

General Info

Members Datasets Scaffolds Average Seq Length
634 292 1268 169

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100847782|Ga0070706_1008477821
Length 196
Sequence MQDRQPQTRERTKQREPTGGACRMVTWRFVSDVEHKAQAPRSVRCFVITVSDTRTEATDASGRAIATLLEAAGHSIAGRTIVRDDPEVVRGTIARQLANADVQVIITTGGTGITSRDSTYEAIETLLQKRLDGFGELFRMLSYEQIGSAAMMSRASAGLVAGRIIVSLPGSEAAVRLAMERLLIPELGHLVQQASR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
268 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 3.63
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 11.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100847782 3300005467 Bacteria 845
2 Ga0065712_10188082 3300005290 Bacteria 1160
3 Ga0065715_10192933 3300005293 Bacteria 1399
4 Ga0065707_10360981 3300005295 Unclassified 904
5 Ga0070658_10087847 3300005327 Bacteria 2559
6 Ga0070676_10476440 3300005328 Bacteria 882
7 Ga0070676_10992152 3300005328 Bacteria 630
8 Ga0070683_100753199 3300005329 Bacteria 933
9 Ga0070683_100804691 3300005329 Bacteria 901
10 Ga0070683_100997581 3300005329 Bacteria 804
11 Ga0070690_100007164 3300005330 Bacteria 6378
12 Ga0070690_100098535 3300005330 Bacteria 1935
13 Ga0070670_100026115 3300005331 Bacteria 5027
14 Ga0070670_100248389 3300005331 Bacteria 1550
15 Ga0070666_10034216 3300005335 Bacteria 3367
16 Ga0070666_10075031 3300005335 Bacteria 2306
17 Ga0070666_10317901 3300005335 Unclassified 1110
18 Ga0070682_101098728 3300005337 Bacteria 666
19 Ga0068868_100193614 3300005338 Unclassified 1691
20 Ga0068868_100205215 3300005338 Bacteria 1645
21 Ga0068868_100205217 3300005338 Bacteria 1645
22 Ga0070660_100189135 3300005339 Bacteria 1667
23 Ga0070660_100825254 3300005339 Bacteria 780
24 Ga0070689_100052078 3300005340 Bacteria 3166
25 Ga0070689_100772704 3300005340 Bacteria 843
26 Ga0070691_10343357 3300005341 Bacteria 827
27 Ga0070687_100018989 3300005343 Bacteria 3191
28 Ga0070668_100169489 3300005347 Bacteria 1776
29 Ga0070668_101135868 3300005347 Bacteria 706
30 Ga0070669_100012961 3300005353 Bacteria 5921
31 Ga0070669_100041073 3300005353 Bacteria 3363
32 Ga0070675_100001391 3300005354 Bacteria 17761
33 Ga0070675_100829171 3300005354 Unclassified 846
34 Ga0070671_100054040 3300005355 Bacteria 3338
35 Ga0070674_100015355 3300005356 Bacteria 4780
36 Ga0070688_100277447 3300005365 Bacteria 1203
37 Ga0070659_100075419 3300005366 Bacteria 2688
38 Ga0070659_100109818 3300005366 Bacteria 2226
39 Ga0070659_100156060 3300005366 Bacteria 1864
40 Ga0070667_100036885 3300005367 Bacteria 4098
41 Ga0070667_100647171 3300005367 Bacteria 976
42 Ga0070709_10040179 3300005434 Bacteria 2875
43 Ga0070714_100044379 3300005435 Bacteria 3763
44 Ga0070713_100437334 3300005436 Unclassified 1227
45 Ga0070713_101606887 3300005436 Unclassified 631
46 Ga0070705_100297916 3300005440 Bacteria 1154
47 Ga0070700_100196244 3300005441 Unclassified 1415
48 Ga0070700_100565003 3300005441 Bacteria 886
49 Ga0070700_101325889 3300005441 Bacteria 606
50 Ga0070708_100417811 3300005445 Bacteria 1265
51 Ga0070708_100865148 3300005445 Bacteria 849
52 Ga0070663_101042937 3300005455 Bacteria 713
53 Ga0070662_100027317 3300005457 Bacteria 3960
54 Ga0070681_10043713 3300005458 Bacteria 4486
55 Ga0070681_10078537 3300005458 Bacteria 3257
56 Ga0070681_10106845 3300005458 Bacteria 2740
57 Ga0070681_11303470 3300005458 Bacteria 649
58 Ga0068867_100020766 3300005459 Bacteria 4681
59 Ga0070685_10292399 3300005466 Bacteria 1095
60 Ga0070706_100684850 3300005467 Bacteria 951
61 Ga0070707_100027288 3300005468 Bacteria 5432
62 Ga0070707_100064301 3300005468 Bacteria 3523
63 Ga0070707_100188111 3300005468 Bacteria 2013
64 Ga0070707_100296574 3300005468 Unclassified 1571
65 Ga0070707_100346384 3300005468 Unclassified 1443
66 Ga0070698_100036905 3300005471 Bacteria 5043
67 Ga0070698_100093154 3300005471 Bacteria 2993
68 Ga0070698_100206945 3300005471 Unclassified 1897
69 Ga0070698_100481544 3300005471 Bacteria 1178
70 Ga0070698_100508558 3300005471 Unclassified 1143
71 Ga0070698_100574823 3300005471 Bacteria 1067
72 Ga0070698_101165095 3300005471 Bacteria 720
73 Ga0070699_100084814 3300005518 Bacteria 2765
74 Ga0070699_100111273 3300005518 Unclassified 2405
75 Ga0070699_100143412 3300005518 Bacteria 2110
76 Ga0070699_100155115 3300005518 Bacteria 2026
77 Ga0070699_100265326 3300005518 Bacteria 1536
78 Ga0070699_100960599 3300005518 Bacteria 783
79 Ga0070679_100085745 3300005530 Bacteria 3136
80 Ga0070679_100100023 3300005530 Bacteria 2887
81 Ga0070697_100119163 3300005536 Bacteria 2206
82 Ga0070697_100766090 3300005536 Unclassified 853
83 Ga0070697_100929403 3300005536 Bacteria 772
84 Ga0070672_100042781 3300005543 Bacteria 3488
85 Ga0070672_100860854 3300005543 Unclassified 799
86 Ga0070686_100003805 3300005544 Bacteria 8302
87 Ga0070686_100154767 3300005544 Bacteria 1609
88 Ga0070686_100810687 3300005544 Bacteria 755
89 Ga0070686_101349596 3300005544 Unclassified 597
90 Ga0070695_100001441 3300005545 Bacteria 13201
91 Ga0070695_100002655 3300005545 Bacteria 10344
92 Ga0070695_100342986 3300005545 Bacteria 1117
93 Ga0070696_100240114 3300005546 Bacteria 1366
94 Ga0070696_100340388 3300005546 Bacteria 1159
95 Ga0070665_100016860 3300005548 Bacteria 7325
96 Ga0070665_100160848 3300005548 Bacteria 2248
97 Ga0070704_100003928 3300005549 Bacteria 8561
98 Ga0070704_100113039 3300005549 Bacteria 2070
99 Ga0068855_100164407 3300005563 Unclassified 2517
100 Ga0068855_100441552 3300005563 Bacteria 1421
101 Ga0068855_100509611 3300005563 Bacteria 1307
102 Ga0068855_100546840 3300005563 Bacteria 1254
103 Ga0068855_101011838 3300005563 Bacteria 873
104 Ga0070664_100231692 3300005564 Bacteria 1656
105 Ga0068857_101444124 3300005577 Bacteria 670
106 Ga0068854_100029661 3300005578 Bacteria 3788
107 Ga0068854_100586405 3300005578 Bacteria 950
108 Ga0068856_100088877 3300005614 Bacteria 3072
109 Ga0068856_100104376 3300005614 Bacteria 2828
110 Ga0068856_101090884 3300005614 Bacteria 816
111 Ga0068852_100325285 3300005616 Bacteria 1494
112 Ga0068852_100413537 3300005616 Bacteria 1329
113 Ga0068859_100039790 3300005617 Bacteria 4718
114 Ga0068859_100053980 3300005617 Bacteria 4041
115 Ga0068859_100146220 3300005617 Bacteria 2439
116 Ga0068859_100306658 3300005617 Bacteria 1681
117 Ga0068859_100373844 3300005617 Bacteria 1521
118 Ga0068859_100468211 3300005617 Bacteria 1356
119 Ga0068864_100149976 3300005618 Unclassified 2111
120 Ga0068864_100205158 3300005618 Bacteria 1813
121 Ga0068864_100255615 3300005618 Bacteria 1628
122 Ga0068864_100699750 3300005618 Bacteria 990
123 Ga0068864_100934325 3300005618 Bacteria 858
124 Ga0068866_10030379 3300005718 Bacteria 2593
125 Ga0068866_10201637 3300005718 Bacteria 1189
126 Ga0068866_10326291 3300005718 Bacteria 967
127 Ga0068861_100029368 3300005719 Bacteria 4022
128 Ga0068851_10150364 3300005834 Bacteria 1272
129 Ga0068851_10172789 3300005834 Bacteria 1193
130 Ga0068870_10575926 3300005840 Bacteria 762
131 Ga0068863_100012476 3300005841 Bacteria 8203
132 Ga0068863_100065341 3300005841 Unclassified 3442
133 Ga0068863_100349885 3300005841 Bacteria 1439
134 Ga0068863_100455683 3300005841 Bacteria 1256
135 Ga0068858_100000694 3300005842 Bacteria 35166
136 Ga0068858_100056544 3300005842 Bacteria 3625
137 Ga0068858_100183041 3300005842 Bacteria 1979
138 Ga0068858_100890412 3300005842 Bacteria 870
139 Ga0068860_100143913 3300005843 Bacteria 2293
140 Ga0068860_100221681 3300005843 Bacteria 1837
141 Ga0068860_100256255 3300005843 Bacteria 1705
142 Ga0068860_100490715 3300005843 Bacteria 1225
143 Ga0068860_100753381 3300005843 Bacteria 986
144 Ga0068862_100012334 3300005844 Bacteria 7066
145 Ga0081455_10036603 3300005937 Bacteria 4367
146 Ga0081540_1058665 3300005983 Bacteria 1852
147 Ga0081539_10084148 3300005985 Bacteria 1663
148 Ga0075363_100054489 3300006048 Bacteria 2140
149 Ga0075432_10013080 3300006058 Bacteria 2821
150 Ga0075432_10079341 3300006058 Bacteria 1188
151 Ga0070712_101227933 3300006175 Bacteria 652
152 Ga0097621_100015314 3300006237 Bacteria 5767
153 Ga0097621_100084073 3300006237 Bacteria 2653
154 Ga0097621_100584040 3300006237 Unclassified 1020
155 Ga0097621_101055181 3300006237 Bacteria 762
156 Ga0068871_100061869 3300006358 Bacteria 3058
157 Ga0068871_100111311 3300006358 Bacteria 2303
158 Ga0068871_101180120 3300006358 Bacteria 718
159 Ga0075428_100312636 3300006844 Bacteria 1689
160 Ga0075428_100634638 3300006844 Unclassified 1140
161 Ga0075428_100918382 3300006844 Unclassified 928
162 Ga0075430_100005925 3300006846 Bacteria 10322
163 Ga0075431_100001686 3300006847 Bacteria 20728
164 Ga0075431_100003499 3300006847 Bacteria 15227
165 Ga0075431_100016515 3300006847 Bacteria 7492
166 Ga0075433_10000062 3300006852 Bacteria 46932
167 Ga0075433_10000446 3300006852 Bacteria 26719
168 Ga0075433_10602466 3300006852 Bacteria 964
169 Ga0075433_10767309 3300006852 Bacteria 843
170 Ga0075434_100011109 3300006871 Bacteria 8473
171 Ga0075434_100016198 3300006871 Bacteria 7165
172 Ga0075434_100034937 3300006871 Bacteria 4968
173 Ga0075434_100057748 3300006871 Bacteria 3857
174 Ga0075434_100124690 3300006871 Bacteria 2593
175 Ga0075434_100137351 3300006871 Bacteria 2464
176 Ga0075434_100339894 3300006871 Bacteria 1522
177 Ga0075434_100439116 3300006871 Bacteria 1326
178 Ga0075434_100543563 3300006871 Bacteria 1182
179 Ga0075429_100002697 3300006880 Bacteria 14960
180 Ga0075429_100042378 3300006880 Unclassified 3962
181 Ga0075429_100043339 3300006880 Bacteria 3916
182 Ga0075429_100365728 3300006880 Bacteria 1263
183 Ga0068865_100025544 3300006881 Bacteria 3886
184 Ga0068865_100248548 3300006881 Unclassified 1403
185 Ga0068865_101694886 3300006881 Unclassified 570
186 Ga0075436_100036146 3300006914 Bacteria 3408
187 Ga0075436_100064078 3300006914 Bacteria 2540
188 Ga0075436_100074692 3300006914 Bacteria 2347
189 Ga0075436_100186151 3300006914 Bacteria 1468
190 Ga0097620_100039790 3300006931 Bacteria 4718
191 Ga0097620_100053983 3300006931 Bacteria 4041
192 Ga0097620_100146224 3300006931 Bacteria 2439
193 Ga0097620_100306680 3300006931 Bacteria 1681
194 Ga0097620_100373844 3300006931 Bacteria 1521
195 Ga0075435_100001816 3300007076 Bacteria 13876
196 Ga0075435_100017880 3300007076 Bacteria 5374
197 Ga0075435_100020411 3300007076 Bacteria 5077
198 Ga0075435_100028517 3300007076 Bacteria 4379
199 Ga0075435_100046046 3300007076 Bacteria 3497
200 Ga0075435_100246429 3300007076 Bacteria 1520
201 Ga0075435_100944341 3300007076 Unclassified 752
202 Ga0075435_101392008 3300007076 Archaea 615
203 Ga0099794_10101622 3300007265 Bacteria 1435
204 Ga0099794_10203554 3300007265 Bacteria 1014
205 Ga0105240_10059721 3300009093 Bacteria 4758
206 Ga0105240_10100492 3300009093 Bacteria 3519
207 Ga0105240_10825540 3300009093 Bacteria 1002
208 Ga0105240_10980010 3300009093 Bacteria 905
209 Ga0111539_10002994 3300009094 Bacteria 22414
210 Ga0111539_10005984 3300009094 Bacteria 15714
211 Ga0111539_10086034 3300009094 Bacteria 3695
212 Ga0111539_10181527 3300009094 Bacteria 2458
213 Ga0111539_10306565 3300009094 Bacteria 1848
214 Ga0111539_10755120 3300009094 Bacteria 1132
215 Ga0105245_10113683 3300009098 Bacteria 2521
216 Ga0105245_11163876 3300009098 Bacteria 818
217 Ga0105245_12142049 3300009098 Bacteria 613
218 Ga0105247_10004214 3300009101 Bacteria 9223
219 Ga0105247_10249053 3300009101 Bacteria 1214
220 Ga0114129_10000002 3300009147 Bacteria 204413
221 Ga0114129_10002454 3300009147 Bacteria 25742
222 Ga0114129_10002522 3300009147 Bacteria 25425
223 Ga0114129_10004744 3300009147 Bacteria 19206
224 Ga0114129_10014069 3300009147 Bacteria 11399
225 Ga0114129_10023846 3300009147 Bacteria 8671
226 Ga0114129_10024935 3300009147 Bacteria 8479
227 Ga0114129_10038807 3300009147 Bacteria 6713
228 Ga0114129_10162450 3300009147 Bacteria 3050
229 Ga0114129_10209251 3300009147 Unclassified 2638
230 Ga0114129_10725740 3300009147 Bacteria 1275
231 Ga0114129_10747330 3300009147 Bacteria 1252
232 Ga0114129_11096887 3300009147 Bacteria 997
233 Ga0114129_11160942 3300009147 Bacteria 964
234 Ga0105243_10269734 3300009148 Bacteria 1527
235 Ga0105243_10714290 3300009148 Bacteria 978
236 Ga0105241_10115219 3300009174 Bacteria 2157
237 Ga0105241_11022337 3300009174 Bacteria 774
238 Ga0105242_10004556 3300009176 Bacteria 10755
239 Ga0105242_10021424 3300009176 Bacteria 5075
240 Ga0105242_10172852 3300009176 Bacteria 1900
241 Ga0105242_10229054 3300009176 Bacteria 1665
242 Ga0105242_11325975 3300009176 Unclassified 744
243 Ga0105242_12273832 3300009176 Unclassified 588
244 Ga0105248_10003660 3300009177 Bacteria 17052
245 Ga0105248_10013961 3300009177 Bacteria 8838
246 Ga0105248_10032263 3300009177 Bacteria 5855
247 Ga0105248_10117250 3300009177 Bacteria 3003
248 Ga0105248_10306928 3300009177 Unclassified 1787
249 Ga0105248_10377711 3300009177 Bacteria 1595
250 Ga0105248_10400585 3300009177 Bacteria 1545
251 Ga0105237_11485879 3300009545 Bacteria 684
252 Ga0105238_10803151 3300009551 Bacteria 956
253 Ga0105249_10344442 3300009553 Unclassified 1508
254 Ga0105249_10483048 3300009553 Bacteria 1282
255 Ga0105249_11185392 3300009553 Bacteria 835
256 Ga0105239_10890760 3300010375 Bacteria 1021
257 Ga0157370_10628375 3300013104 Bacteria 982
258 Ga0157374_10775022 3300013296 Bacteria 974
259 Ga0157378_10172107 3300013297 Bacteria 2031
260 Ga0157378_10195318 3300013297 Bacteria 1911
261 Ga0157378_10300948 3300013297 Bacteria 1552
262 Ga0157378_10608446 3300013297 Unclassified 1105
263 Ga0157378_10780553 3300013297 Unclassified 980
264 Ga0163162_10130160 3300013306 Unclassified 2625
265 Ga0163162_10139211 3300013306 Bacteria 2539
266 Ga0163162_10144147 3300013306 Bacteria 2497
267 Ga0163162_10335646 3300013306 Bacteria 1644
268 Ga0163162_11322873 3300013306 Bacteria 819
269 Ga0163162_12859461 3300013306 Bacteria 556
270 Ga0157372_10175390 3300013307 Bacteria 2481
271 Ga0157375_10105987 3300013308 Bacteria 2902
272 Ga0157375_10172306 3300013308 Bacteria 2312
273 Ga0157375_10353955 3300013308 Bacteria 1634
274 Ga0157375_11392896 3300013308 Bacteria 826
275 Ga0163163_10206654 3300014325 Bacteria 2012
276 Ga0157380_10278422 3300014326 Bacteria 1529
277 Ga0157380_10893637 3300014326 Unclassified 914
278 Ga0157380_11140918 3300014326 Bacteria 820
279 Ga0182008_10139665 3300014497 Unclassified 1211
280 Ga0157377_10177402 3300014745 Bacteria 1337
281 Ga0157379_10005340 3300014968 Bacteria 11038
282 Ga0157379_10045873 3300014968 Bacteria 3901
283 Ga0157379_10108407 3300014968 Unclassified 2493
284 Ga0157379_10194825 3300014968 Bacteria 1831
285 Ga0157379_10304999 3300014968 Bacteria 1452
286 Ga0157376_10007383 3300014969 Bacteria 7842
287 Ga0157376_10026344 3300014969 Bacteria 4593
288 Ga0157376_10689732 3300014969 Bacteria 1025
289 Ga0163161_10452907 3300017792 Bacteria 1038
290 Ga0206356_10470833 3300020070 Bacteria 905
291 Ga0206353_11660427 3300020082 Bacteria 2080
292 Ga0207656_10124196 3300025321 Bacteria 1204
293 Ga0207642_10091572 3300025899 Bacteria 1503
294 Ga0207642_10096210 3300025899 Bacteria 1475
295 Ga0207710_10101413 3300025900 Unclassified 1358
296 Ga0207688_10412437 3300025901 Bacteria 839
297 Ga0207680_10016440 3300025903 Bacteria 3884
298 Ga0207680_10225427 3300025903 Bacteria 1286
299 Ga0207699_10099325 3300025906 Bacteria 1843
300 Ga0207684_11472440 3300025910 Unclassified 555
301 Ga0207654_10586818 3300025911 Bacteria 794
302 Ga0207707_10840351 3300025912 Bacteria 762
303 Ga0207695_10060629 3300025913 Bacteria 3915
304 Ga0207695_10184633 3300025913 Archaea 2005
305 Ga0207662_10015625 3300025918 Bacteria 4273
306 Ga0207657_10005931 3300025919 Bacteria 12716
307 Ga0207657_10601173 3300025919 Unclassified 858
308 Ga0207652_10076066 3300025921 Bacteria 2927
309 Ga0207652_10178137 3300025921 Bacteria 1909
310 Ga0207652_10284258 3300025921 Bacteria 1492
311 Ga0207646_10020140 3300025922 Bacteria 6185
312 Ga0207646_10058756 3300025922 Bacteria 3435
313 Ga0207646_10501258 3300025922 Unclassified 1094
314 Ga0207681_10025375 3300025923 Bacteria 3812
315 Ga0207650_10082582 3300025925 Bacteria 2439
316 Ga0207659_10000452 3300025926 Bacteria 24737
317 Ga0207659_10856191 3300025926 Bacteria 781
318 Ga0207687_10045889 3300025927 Bacteria 3022
319 Ga0207700_10654846 3300025928 Bacteria 936
320 Ga0207644_10025923 3300025931 Bacteria 4035
321 Ga0207690_10129360 3300025932 Bacteria 1846
322 Ga0207706_10042596 3300025933 Bacteria 4024
323 Ga0207706_10072364 3300025933 Bacteria 3032
324 Ga0207706_10301011 3300025933 Bacteria 1397
325 Ga0207706_10806333 3300025933 Bacteria 797
326 Ga0207706_11031222 3300025933 Bacteria 690
327 Ga0207686_10006529 3300025934 Bacteria 6282
328 Ga0207709_10553826 3300025935 Bacteria 905
329 Ga0207670_10145182 3300025936 Bacteria 1754
330 Ga0207670_11028055 3300025936 Bacteria 694
331 Ga0207669_11070275 3300025937 Bacteria 680
332 Ga0207704_10057709 3300025938 Bacteria 2386
333 Ga0207704_11059531 3300025938 Bacteria 688
334 Ga0207665_10065136 3300025939 Bacteria 2477
335 Ga0207691_10010298 3300025940 Bacteria 8969
336 Ga0207691_10894108 3300025940 Bacteria 744
337 Ga0207711_10024485 3300025941 Bacteria 5059
338 Ga0207711_10072277 3300025941 Bacteria 2996
339 Ga0207711_10074698 3300025941 Bacteria 2948
340 Ga0207711_10323592 3300025941 Bacteria 1425
341 Ga0207689_10504040 3300025942 Unclassified 1014
342 Ga0207661_10581963 3300025944 Bacteria 1027
343 Ga0207661_10630509 3300025944 Bacteria 985
344 Ga0207679_10186952 3300025945 Unclassified 1719
345 Ga0207667_10335042 3300025949 Bacteria 1544
346 Ga0207667_10536377 3300025949 Bacteria 1184
347 Ga0207651_11731000 3300025960 Bacteria 563
348 Ga0207712_10773401 3300025961 Unclassified 843
349 Ga0207712_10813997 3300025961 Unclassified 822
350 Ga0207668_11255897 3300025972 Bacteria 666
351 Ga0207640_10049885 3300025981 Bacteria 2712
352 Ga0207658_10024715 3300025986 Bacteria 4204
353 Ga0207658_10195465 3300025986 Unclassified 1685
354 Ga0207677_10023554 3300026023 Unclassified 3807
355 Ga0207677_10101453 3300026023 Bacteria 2119
356 Ga0207677_10193025 3300026023 Bacteria 1612
357 Ga0207677_10234892 3300026023 Bacteria 1479
358 Ga0207677_10856458 3300026023 Bacteria 817
359 Ga0207703_10089450 3300026035 Bacteria 2586
360 Ga0207703_10098340 3300026035 Bacteria 2474
361 Ga0207703_10265263 3300026035 Bacteria 1554
362 Ga0207678_11529276 3300026067 Bacteria 589
363 Ga0207708_10120927 3300026075 Bacteria 2040
364 Ga0207708_10373532 3300026075 Bacteria 1174
365 Ga0207708_10562486 3300026075 Bacteria 963
366 Ga0207702_10089558 3300026078 Bacteria 2691
367 Ga0207702_10303183 3300026078 Bacteria 1516
368 Ga0207702_10570364 3300026078 Bacteria 1108
369 Ga0207702_11057010 3300026078 Bacteria 806
370 Ga0207641_10001556 3300026088 Bacteria 22467
371 Ga0207641_10255922 3300026088 Bacteria 1637
372 Ga0207648_10037830 3300026089 Bacteria 4248
373 Ga0207648_10298301 3300026089 Bacteria 1445
374 Ga0207648_10496005 3300026089 Bacteria 1117
375 Ga0207676_10044179 3300026095 Bacteria 3436
376 Ga0207676_10049820 3300026095 Bacteria 3261
377 Ga0207676_10196398 3300026095 Bacteria 1780
378 Ga0207676_10633645 3300026095 Bacteria 1030
379 Ga0207675_100025632 3300026118 Bacteria 5487
380 Ga0207675_100082220 3300026118 Bacteria 3020
381 Ga0207675_100135415 3300026118 Bacteria 2337
382 Ga0207675_100586823 3300026118 Bacteria 1116
383 Ga0207675_100716580 3300026118 Bacteria 1010
384 Ga0207683_10097729 3300026121 Bacteria 2619
385 Ga0207698_10188782 3300026142 Bacteria 1833
386 Ga0207698_10403119 3300026142 Bacteria 1308
387 Ga0209967_1016833 3300027364 Bacteria 1052
388 Ga0209981_1006216 3300027378 Bacteria 1595
389 Ga0209996_1003930 3300027395 Bacteria 1882
390 Ga0210000_1016941 3300027462 Bacteria 1102
391 Ga0209995_1006005 3300027471 Bacteria 1954
392 Ga0209968_1005902 3300027526 Bacteria 1842
393 Ga0209999_1005157 3300027543 Bacteria 2349
394 Ga0209970_1012892 3300027614 Bacteria 1383
395 Ga0209983_1000119 3300027665 Bacteria 13889
396 Ga0209971_1000033 3300027682 Bacteria 48530
397 Ga0209966_1000069 3300027695 Bacteria 46015
398 Ga0209998_10000003 3300027717 Bacteria 110511
399 Ga0209974_10007467 3300027876 Bacteria 3766
400 Ga0209974_10071360 3300027876 Bacteria 1185
401 Ga0207428_10017515 3300027907 Bacteria 6144
402 Ga0207428_10098398 3300027907 Unclassified 2264
403 Ga0207428_10130725 3300027907 Bacteria 1921
404 Ga0268266_10027359 3300028379 Bacteria 4850
405 Ga0268266_10075175 3300028379 Bacteria 2934
406 Ga0268266_10155253 3300028379 Bacteria 2066
407 Ga0268265_10019194 3300028380 Bacteria 4747
408 Ga0268265_10798451 3300028380 Bacteria 920
409 Ga0268264_10194583 3300028381 Bacteria 1851
410 Ga0268264_11014909 3300028381 Bacteria 836
411 Ga0268264_11146957 3300028381 Unclassified 786
412 Ga0316182_1372464 3300030745 Bacteria 1204
413 Ga0307408_100216838 3300031548 Bacteria 1559
414 Ga0265314_10525039 3300031711 Unclassified 620
415 Ga0307405_10173807 3300031731 Unclassified 1539
416 Ga0307413_10050614 3300031824 Bacteria 2497
417 Ga0307410_10018291 3300031852 Unclassified 4232
418 Ga0307406_10013857 3300031901 Bacteria 4628
419 Ga0307406_11061015 3300031901 Bacteria 698
420 Ga0307407_10033925 3300031903 Bacteria 2789
421 Ga0307409_100318563 3300031995 Bacteria 1454
422 Ga0307416_100002835 3300032002 Bacteria 10088
423 Ga0307416_101284626 3300032002 Bacteria 838
424 Ga0307414_10015663 3300032004 Unclassified 4583
425 Ga0307411_10038805 3300032005 Bacteria 3008
426 Ga0307415_100018695 3300032126 Bacteria 4191
427 Ga0373958_0051919 3300034819 Bacteria 868
428 Ga0373929_0107396 3300035085 Bacteria 710
429 Ga0373940_0100530 3300035088 Bacteria 877
430 Ga0373945_0198586 3300035116 Bacteria 832
431 Ga0373953_0340810 3300035117 Bacteria 656
432 Ga0373956_0211121 3300035119 Bacteria 921
433 Ga0373957_0256026 3300035120 Unclassified 737
434 Ga0373955_0235871 3300035172 Bacteria 1095
435 Ga0373955_0294038 3300035172 Unclassified 979
436 Ga0373962_0020283 3300035242 Bacteria 1745
437 Ga0373924_0233815 3300035410 Unclassified 813
438 Ga0373931_0065829 3300035691 Bacteria 1965
439 Ga0373931_0896065 3300035691 Bacteria 596
440 Ga0373935_0812062 3300035692 Bacteria 691
441 Ga0373927_0252811 3300035695 Bacteria 1159
442 Ga0373947_0070383 3300035725 Bacteria 2143
443 Ga0373947_0192364 3300035725 Bacteria 1332
444 Ga0373947_0219934 3300035725 Bacteria 1248
445 Ga0373937_0141992 3300036401 Bacteria 2247
446 Ga0373937_0530280 3300036401 Bacteria 1119
447 Ga0373925_0104241 3300037068 Bacteria 2184
448 Ga0436361_1039134 3300039447 Bacteria 943
449 Ga0439443_090950 3300042003 Bacteria 576
450 Ga0439435_0035588 3300042436 Bacteria 1373
451 Ga0451577_0044661 3300042876 Bacteria 3967
452 Ga0451577_0089724 3300042876 Bacteria 2743
453 Ga0451577_0588070 3300042876 Bacteria 1010
454 Ga0466963_0577585 3300044694 Bacteria 794
455 Ga0453684_0079391 3300044712 Bacteria 4102
456 Ga0453684_0627656 3300044712 Bacteria 1175
457 Ga0451576_0051804 3300045051 Bacteria 4303
458 Ga0451576_0163205 3300045051 Bacteria 2325
459 Ga0451576_0235910 3300045051 Bacteria 1910
460 Ga0451576_0661334 3300045051 Bacteria 1098
461 Ga0451576_1885113 3300045051 Bacteria 617
462 Ga0466967_0161689 3300045976 Bacteria 2102
463 Ga0495603_0289929 3300046455 Bacteria 940
464 Ga0495629_0125629 3300046459 Bacteria 1787
465 Ga0495580_0197069 3300046472 Bacteria 1388
466 Ga0495608_0281199 3300046511 Bacteria 1033
467 Ga0495628_0544283 3300046516 Bacteria 834
468 Ga0495628_0939426 3300046516 Bacteria 598
469 Ga0495640_0196411 3300046533 Bacteria 1281
470 Ga0495598_0047318 3300046537 Bacteria 1282
471 Ga0495645_0780664 3300046543 Bacteria 574
472 Ga0495633_0205390 3300046558 Bacteria 904
473 Ga0495656_0065119 3300046615 Bacteria 1602
474 Ga0495634_0405621 3300046642 Bacteria 809
475 Ga0495611_0285388 3300046648 Bacteria 762
476 Ga0495635_0251376 3300046663 Bacteria 1192
477 Ga0495659_0156896 3300046664 Bacteria 917
478 Ga0495646_0405885 3300046680 Unclassified 708
479 Ga0495658_0017387 3300046683 Unclassified 3714
480 Ga0495658_0178426 3300046683 Bacteria 1317
481 Ga0495669_0238927 3300046684 Unclassified 872
482 Ga0495674_0521307 3300047319 Bacteria 949
483 Ga0495684_0876071 3300047471 Bacteria 580
484 Ga0496102_0215479 3300048905 Bacteria 1810
485 Ga0496104_0159802 3300048907 Bacteria 2162
486 Ga0496104_0286356 3300048907 Bacteria 1560
487 Ga0496105_0378887 3300048908 Bacteria 1126
488 Ga0496106_0247510 3300048909 Bacteria 1425
489 Ga0496106_0843773 3300048909 Bacteria 725
490 Ga0496108_0007470 3300048911 Bacteria 8860
491 Ga0496109_0072409 3300048912 Bacteria 3166
492 Ga0496109_0641467 3300048912 Bacteria 999
493 Ga0496109_0719744 3300048912 Bacteria 936
494 Ga0496111_0204420 3300048914 Bacteria 1468
495 Ga0496111_0210722 3300048914 Bacteria 1443
496 Ga0496111_0749580 3300048914 Unclassified 708
497 Ga0496112_0015032 3300048915 Bacteria 7206
498 Ga0496112_0403142 3300048915 Bacteria 1307
499 Ga0496112_0762809 3300048915 Bacteria 893
500 Ga0496112_0835430 3300048915 Bacteria 845
501 Ga0496112_1609029 3300048915 Bacteria 563
502 Ga0496113_0144178 3300048916 Bacteria 1875
503 Ga0496113_0670233 3300048916 Bacteria 829
504 Ga0496114_0233774 3300048917 Bacteria 1615
505 Ga0496114_0648347 3300048917 Bacteria 929
506 Ga0496115_0136547 3300048918 Unclassified 2022
507 Ga0501033_0024377 3300049570 Bacteria 4564
508 Ga0501037_0150912 3300049573 Bacteria 1661
509 Ga0501038_0730262 3300049574 Bacteria 740
510 Ga0501039_0574394 3300049575 Bacteria 884
511 Ga0501040_0140489 3300049576 Bacteria 1701
512 Ga0501040_0573765 3300049576 Bacteria 814
513 Ga0501040_0751312 3300049576 Bacteria 705
514 Ga0501041_0031443 3300049577 Bacteria 3207
515 Ga0501041_0033597 3300049577 Bacteria 3104
516 Ga0501042_0003419 3300049578 Bacteria 9970
517 Ga0501042_0061678 3300049578 Bacteria 2679
518 Ga0501042_0241261 3300049578 Bacteria 1304
519 Ga0501046_0001961 3300049580 Bacteria 19558
520 Ga0501047_0800364 3300049581 Bacteria 757
521 Ga0501048_0044239 3300049582 Bacteria 3185
522 Ga0501068_0049071 3300049584 Bacteria 2549
523 Ga0501070_1185028 3300049586 Bacteria 587
524 Ga0501071_0032402 3300049587 Bacteria 3711
525 Ga0501071_0042271 3300049587 Bacteria 3265
526 Ga0501071_0118542 3300049587 Bacteria 1961
527 Ga0501074_0012958 3300049590 Bacteria 6062
528 Ga0501074_0070547 3300049590 Bacteria 2512
529 Ga0501075_0010772 3300049591 Bacteria 6441
530 Ga0501075_0032604 3300049591 Bacteria 3871
531 Ga0501075_0056507 3300049591 Bacteria 2954
532 Ga0501075_0638170 3300049591 Bacteria 812
533 Ga0501076_0012114 3300049592 Bacteria 6446
534 Ga0501076_0066515 3300049592 Bacteria 2877
535 Ga0501076_0221444 3300049592 Bacteria 1546
536 Ga0501077_0007141 3300049593 Bacteria 6886
537 Ga0501077_0109963 3300049593 Bacteria 1746
538 Ga0501214_033035 3300049659 Unclassified 719
539 Ga0501233_073530 3300049668 Unclassified 870
540 Ga0501079_0004463 3300049741 Bacteria 10376
541 Ga0501079_0052813 3300049741 Bacteria 3136
542 Ga0501080_0032378 3300049742 Bacteria 4876
543 Ga0501080_0121884 3300049742 Bacteria 2416
544 Ga0501080_0161335 3300049742 Bacteria 2070
545 Ga0501081_0005691 3300049743 Bacteria 8065
546 Ga0501081_1199047 3300049743 Bacteria 575
547 Ga0501083_0070776 3300049744 Bacteria 2319
548 Ga0501083_0081842 3300049744 Bacteria 2140
549 Ga0501268_065476 3300049765 Unclassified 727
550 Ga0501270_002032 3300049767 Bacteria 2028
551 Ga0501035_0772767 3300049822 Bacteria 769
552 Ga0501044_0124696 3300049823 Bacteria 2574
553 Ga0501045_0002500 3300049824 Bacteria 12496
554 Ga0501045_0087716 3300049824 Bacteria 2298
555 nmdc:mga03n38_264549_c1 3300050490 Archaea 913
556 nmdc:mga05p37_128118_c1 3300050507 Bacteria 3116
557 nmdc:mga05p37_13856_c1 3300050507 Bacteria 9660
558 nmdc:mga05p37_18651_c1 3300050507 Bacteria 8385
559 nmdc:mga05p37_216726_c1 3300050507 Bacteria 2312
560 nmdc:mga05p37_23817_c1 3300050507 Bacteria 7434
561 nmdc:mga05p37_273748_c1 3300050507 Bacteria 2016
562 nmdc:mga05p37_28334_c1 3300050507 Bacteria 6830
563 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
564 nmdc:mga05p37_4712_c1 3300050507 Bacteria 15933
565 nmdc:mga05p37_53810_c1 3300050507 Bacteria 4951
566 nmdc:mga05p37_58211_c1 3300050507 Bacteria 4759
567 nmdc:mga05p37_60038_c1 3300050507 Bacteria 4682
568 nmdc:mga05p37_699289_c1 3300050507 Bacteria 1126
569 nmdc:mga05p37_80900_c1 3300050507 Bacteria 4002
570 nmdc:mga05p37_970813_c1 3300050507 Bacteria 907
571 nmdc:mga09592_302611_c1 3300050508 Bacteria 1386
572 nmdc:mga09592_5209_c1 3300050508 Bacteria 10564
573 nmdc:mga09592_53222_c1 3300050508 Bacteria 3418
574 nmdc:mga09592_70001_c1 3300050508 Unclassified 2611
575 nmdc:mga09592_74490_c1 3300050508 Bacteria 2884
576 nmdc:mga09592_763734_c1 3300050508 Unclassified 820
577 nmdc:mga0qj67_193788_c1 3300050509 Bacteria 1651
578 nmdc:mga0qj67_279683_c1 3300050509 Unclassified 1353
579 nmdc:mga06r32_104565_c1 3300050510 Bacteria 2781
580 nmdc:mga06r32_22308_c1 3300050510 Bacteria 5852
581 nmdc:mga08y16_298546_c1 3300050511 Bacteria 1661
582 nmdc:mga08y16_83527_c1 3300050511 Bacteria 3329
583 nmdc:mga0n895_111406_c1 3300050512 Bacteria 2451
584 nmdc:mga0n895_138164_c1 3300050512 Bacteria 2464
585 nmdc:mga0n895_202478_c1 3300050512 Bacteria 2016
586 nmdc:mga0n895_212666_c1 3300050512 Bacteria 1964
587 nmdc:mga0n895_260923_c1 3300050512 Bacteria 1758
588 nmdc:mga0n895_316635_c1 3300050512 Bacteria 1581
589 nmdc:mga0n895_473405_c1 3300050512 Bacteria 1264
590 nmdc:mga0n895_608855_c1 3300050512 Unclassified 1094
591 nmdc:mga0rr50_117961_c1 3300050513 Bacteria 2108
592 nmdc:mga0rr50_1264730_c1 3300050513 Archaea 626
593 nmdc:mga0rr50_156268_c1 3300050513 Bacteria 1848
594 nmdc:mga0rr50_199624_c1 3300050513 Bacteria 1643
595 nmdc:mga0rr50_2705_c1 3300050513 Bacteria 10059
596 nmdc:mga0rr50_30471_c1 3300050513 Bacteria 3820
597 nmdc:mga0rr50_678141_c1 3300050513 Bacteria 880
598 nmdc:mga08x19_102444_c1 3300050514 Bacteria 1901
599 nmdc:mga08x19_306575_c1 3300050514 Bacteria 1103
600 nmdc:mga08x19_44305_c1 3300050514 Bacteria 2841
601 nmdc:mga08x19_50485_c1 3300050514 Unclassified 2670
602 nmdc:mga08x19_51917_c1 3300050514 Bacteria 2635
603 nmdc:mga08x19_689846_c1 3300050514 Bacteria 725
604 nmdc:mga08x19_75351_c1 3300050514 Bacteria 2206
605 nmdc:mga0a205_142_c1 3300050515 Bacteria 45750
606 nmdc:mga0a205_148413_c1 3300050515 Bacteria 2245
607 nmdc:mga0a205_156446_c1 3300050515 Bacteria 2178
608 nmdc:mga0a205_177712_c1 3300050515 Bacteria 2023
609 nmdc:mga0a205_258465_c1 3300050515 Bacteria 1619
610 nmdc:mga0a205_41015_c1 3300050515 Bacteria 4457
611 nmdc:mga0a205_6014_c1 3300050515 Bacteria 10945
612 nmdc:mga0a205_619_c1 3300050515 Bacteria 28239
613 nmdc:mga0a205_628339_c1 3300050515 Bacteria 926
614 nmdc:mga0a205_658180_c1 3300050515 Bacteria 898
615 Ga0495601_0444063 3300053077 Bacteria 839
616 Ga0495595_0017737 3300053084 Bacteria 3066
617 Ga0495595_0190510 3300053084 Unclassified 1019
618 Ga0495619_0017075 3300053085 Bacteria 4601
619 Ga0495619_0797467 3300053085 Bacteria 639
620 Ga0500555_000627 3300053103 Bacteria 13659
621 Ga0500645_001086 3300053730 Bacteria 14949
622 Ga0501084_0001889 3300054114 Bacteria 16706
623 Ga0501084_0053063 3300054114 Bacteria 3391
624 Ga0501084_0344759 3300054114 Bacteria 1258
625 Ga0590071_117677 3300059421 Bacteria 677
626 Ga0590075_075910 3300059424 Bacteria 869
627 Ga0590077_017709 3300059426 Bacteria 1500
628 Ga0501082_0004764 3300060353 Bacteria 11835
629 Ga0501082_0320157 3300060353 Bacteria 1351
630 Ga0501082_0395463 3300060353 Unclassified 1206
631 Ga0530510_0043028 3300061734 Bacteria 3262
632 Ga0530510_0090278 3300061734 Bacteria 2235
633 Ga0530510_0111459 3300061734 Bacteria 2004
634 Ga0530510_0125188 3300061734 Bacteria 1889
635 Ga0070706_100847782
636 Ga0065712_10188082
637 Ga0065715_10192933
638 Ga0065707_10360981
639 Ga0070658_10087847
640 Ga0070676_10476440
641 Ga0070676_10992152
642 Ga0070683_100753199
643 Ga0070683_100804691
644 Ga0070683_100997581
645 Ga0070690_100007164
646 Ga0070690_100098535
647 Ga0070670_100026115
648 Ga0070670_100248389
649 Ga0070666_10034216
650 Ga0070666_10075031
651 Ga0070666_10317901
652 Ga0070682_101098728
653 Ga0068868_100193614
654 Ga0068868_100205215
655 Ga0068868_100205217
656 Ga0070660_100189135
657 Ga0070660_100825254
658 Ga0070689_100052078
659 Ga0070689_100772704
660 Ga0070691_10343357
661 Ga0070687_100018989
662 Ga0070668_100169489
663 Ga0070668_101135868
664 Ga0070669_100012961
665 Ga0070669_100041073
666 Ga0070675_100001391
667 Ga0070675_100829171
668 Ga0070671_100054040
669 Ga0070674_100015355
670 Ga0070688_100277447
671 Ga0070659_100075419
672 Ga0070659_100109818
673 Ga0070659_100156060
674 Ga0070667_100036885
675 Ga0070667_100647171
676 Ga0070709_10040179
677 Ga0070714_100044379
678 Ga0070713_100437334
679 Ga0070713_101606887
680 Ga0070705_100297916
681 Ga0070700_100196244
682 Ga0070700_100565003
683 Ga0070700_101325889
684 Ga0070708_100417811
685 Ga0070708_100865148
686 Ga0070663_101042937
687 Ga0070662_100027317
688 Ga0070681_10043713
689 Ga0070681_10078537
690 Ga0070681_10106845
691 Ga0070681_11303470
692 Ga0068867_100020766
693 Ga0070685_10292399
694 Ga0070706_100684850
695 Ga0070707_100027288
696 Ga0070707_100064301
697 Ga0070707_100188111
698 Ga0070707_100296574
699 Ga0070707_100346384
700 Ga0070698_100036905
701 Ga0070698_100093154
702 Ga0070698_100206945
703 Ga0070698_100481544
704 Ga0070698_100508558
705 Ga0070698_100574823
706 Ga0070698_101165095
707 Ga0070699_100084814
708 Ga0070699_100111273
709 Ga0070699_100143412
710 Ga0070699_100155115
711 Ga0070699_100265326
712 Ga0070699_100960599
713 Ga0070679_100085745
714 Ga0070679_100100023
715 Ga0070697_100119163
716 Ga0070697_100766090
717 Ga0070697_100929403
718 Ga0070672_100042781
719 Ga0070672_100860854
720 Ga0070686_100003805
721 Ga0070686_100154767
722 Ga0070686_100810687
723 Ga0070686_101349596
724 Ga0070695_100001441
725 Ga0070695_100002655
726 Ga0070695_100342986
727 Ga0070696_100240114
728 Ga0070696_100340388
729 Ga0070665_100016860
730 Ga0070665_100160848
731 Ga0070704_100003928
732 Ga0070704_100113039
733 Ga0068855_100164407
734 Ga0068855_100441552
735 Ga0068855_100509611
736 Ga0068855_100546840
737 Ga0068855_101011838
738 Ga0070664_100231692
739 Ga0068857_101444124
740 Ga0068854_100029661
741 Ga0068854_100586405
742 Ga0068856_100088877
743 Ga0068856_100104376
744 Ga0068856_101090884
745 Ga0068852_100325285
746 Ga0068852_100413537
747 Ga0068859_100039790
748 Ga0068859_100053980
749 Ga0068859_100146220
750 Ga0068859_100306658
751 Ga0068859_100373844
752 Ga0068859_100468211
753 Ga0068864_100149976
754 Ga0068864_100205158
755 Ga0068864_100255615
756 Ga0068864_100699750
757 Ga0068864_100934325
758 Ga0068866_10030379
759 Ga0068866_10201637
760 Ga0068866_10326291
761 Ga0068861_100029368
762 Ga0068851_10150364
763 Ga0068851_10172789
764 Ga0068870_10575926
765 Ga0068863_100012476
766 Ga0068863_100065341
767 Ga0068863_100349885
768 Ga0068863_100455683
769 Ga0068858_100000694
770 Ga0068858_100056544
771 Ga0068858_100183041
772 Ga0068858_100890412
773 Ga0068860_100143913
774 Ga0068860_100221681
775 Ga0068860_100256255
776 Ga0068860_100490715
777 Ga0068860_100753381
778 Ga0068862_100012334
779 Ga0081455_10036603
780 Ga0081540_1058665
781 Ga0081539_10084148
782 Ga0075363_100054489
783 Ga0075432_10013080
784 Ga0075432_10079341
785 Ga0070712_101227933
786 Ga0097621_100015314
787 Ga0097621_100084073
788 Ga0097621_100584040
789 Ga0097621_101055181
790 Ga0068871_100061869
791 Ga0068871_100111311
792 Ga0068871_101180120
793 Ga0075428_100312636
794 Ga0075428_100634638
795 Ga0075428_100918382
796 Ga0075430_100005925
797 Ga0075431_100001686
798 Ga0075431_100003499
799 Ga0075431_100016515
800 Ga0075433_10000062
801 Ga0075433_10000446
802 Ga0075433_10602466
803 Ga0075433_10767309
804 Ga0075434_100011109
805 Ga0075434_100016198
806 Ga0075434_100034937
807 Ga0075434_100057748
808 Ga0075434_100124690
809 Ga0075434_100137351
810 Ga0075434_100339894
811 Ga0075434_100439116
812 Ga0075434_100543563
813 Ga0075429_100002697
814 Ga0075429_100042378
815 Ga0075429_100043339
816 Ga0075429_100365728
817 Ga0068865_100025544
818 Ga0068865_100248548
819 Ga0068865_101694886
820 Ga0075436_100036146
821 Ga0075436_100064078
822 Ga0075436_100074692
823 Ga0075436_100186151
824 Ga0097620_100039790
825 Ga0097620_100053983
826 Ga0097620_100146224
827 Ga0097620_100306680
828 Ga0097620_100373844
829 Ga0075435_100001816
830 Ga0075435_100017880
831 Ga0075435_100020411
832 Ga0075435_100028517
833 Ga0075435_100046046
834 Ga0075435_100246429
835 Ga0075435_100944341
836 Ga0075435_101392008
837 Ga0099794_10101622
838 Ga0099794_10203554
839 Ga0105240_10059721
840 Ga0105240_10100492
841 Ga0105240_10825540
842 Ga0105240_10980010
843 Ga0111539_10002994
844 Ga0111539_10005984
845 Ga0111539_10086034
846 Ga0111539_10181527
847 Ga0111539_10306565
848 Ga0111539_10755120
849 Ga0105245_10113683
850 Ga0105245_11163876
851 Ga0105245_12142049
852 Ga0105247_10004214
853 Ga0105247_10249053
854 Ga0114129_10000002
855 Ga0114129_10002454
856 Ga0114129_10002522
857 Ga0114129_10004744
858 Ga0114129_10014069
859 Ga0114129_10023846
860 Ga0114129_10024935
861 Ga0114129_10038807
862 Ga0114129_10162450
863 Ga0114129_10209251
864 Ga0114129_10725740
865 Ga0114129_10747330
866 Ga0114129_11096887
867 Ga0114129_11160942
868 Ga0105243_10269734
869 Ga0105243_10714290
870 Ga0105241_10115219
871 Ga0105241_11022337
872 Ga0105242_10004556
873 Ga0105242_10021424
874 Ga0105242_10172852
875 Ga0105242_10229054
876 Ga0105242_11325975
877 Ga0105242_12273832
878 Ga0105248_10003660
879 Ga0105248_10013961
880 Ga0105248_10032263
881 Ga0105248_10117250
882 Ga0105248_10306928
883 Ga0105248_10377711
884 Ga0105248_10400585
885 Ga0105237_11485879
886 Ga0105238_10803151
887 Ga0105249_10344442
888 Ga0105249_10483048
889 Ga0105249_11185392
890 Ga0105239_10890760
891 Ga0157370_10628375
892 Ga0157374_10775022
893 Ga0157378_10172107
894 Ga0157378_10195318
895 Ga0157378_10300948
896 Ga0157378_10608446
897 Ga0157378_10780553
898 Ga0163162_10130160
899 Ga0163162_10139211
900 Ga0163162_10144147
901 Ga0163162_10335646
902 Ga0163162_11322873
903 Ga0163162_12859461
904 Ga0157372_10175390
905 Ga0157375_10105987
906 Ga0157375_10172306
907 Ga0157375_10353955
908 Ga0157375_11392896
909 Ga0163163_10206654
910 Ga0157380_10278422
911 Ga0157380_10893637
912 Ga0157380_11140918
913 Ga0182008_10139665
914 Ga0157377_10177402
915 Ga0157379_10005340
916 Ga0157379_10045873
917 Ga0157379_10108407
918 Ga0157379_10194825
919 Ga0157379_10304999
920 Ga0157376_10007383
921 Ga0157376_10026344
922 Ga0157376_10689732
923 Ga0163161_10452907
924 Ga0206356_10470833
925 Ga0206353_11660427
926 Ga0207656_10124196
927 Ga0207642_10091572
928 Ga0207642_10096210
929 Ga0207710_10101413
930 Ga0207688_10412437
931 Ga0207680_10016440
932 Ga0207680_10225427
933 Ga0207699_10099325
934 Ga0207684_11472440
935 Ga0207654_10586818
936 Ga0207707_10840351
937 Ga0207695_10060629
938 Ga0207695_10184633
939 Ga0207662_10015625
940 Ga0207657_10005931
941 Ga0207657_10601173
942 Ga0207652_10076066
943 Ga0207652_10178137
944 Ga0207652_10284258
945 Ga0207646_10020140
946 Ga0207646_10058756
947 Ga0207646_10501258
948 Ga0207681_10025375
949 Ga0207650_10082582
950 Ga0207659_10000452
951 Ga0207659_10856191
952 Ga0207687_10045889
953 Ga0207700_10654846
954 Ga0207644_10025923
955 Ga0207690_10129360
956 Ga0207706_10042596
957 Ga0207706_10072364
958 Ga0207706_10301011
959 Ga0207706_10806333
960 Ga0207706_11031222
961 Ga0207686_10006529
962 Ga0207709_10553826
963 Ga0207670_10145182
964 Ga0207670_11028055
965 Ga0207669_11070275
966 Ga0207704_10057709
967 Ga0207704_11059531
968 Ga0207665_10065136
969 Ga0207691_10010298
970 Ga0207691_10894108
971 Ga0207711_10024485
972 Ga0207711_10072277
973 Ga0207711_10074698
974 Ga0207711_10323592
975 Ga0207689_10504040
976 Ga0207661_10581963
977 Ga0207661_10630509
978 Ga0207679_10186952
979 Ga0207667_10335042
980 Ga0207667_10536377
981 Ga0207651_11731000
982 Ga0207712_10773401
983 Ga0207712_10813997
984 Ga0207668_11255897
985 Ga0207640_10049885
986 Ga0207658_10024715
987 Ga0207658_10195465
988 Ga0207677_10023554
989 Ga0207677_10101453
990 Ga0207677_10193025
991 Ga0207677_10234892
992 Ga0207677_10856458
993 Ga0207703_10089450
994 Ga0207703_10098340
995 Ga0207703_10265263
996 Ga0207678_11529276
997 Ga0207708_10120927
998 Ga0207708_10373532
999 Ga0207708_10562486
1000 Ga0207702_10089558
1001 Ga0207702_10303183
1002 Ga0207702_10570364
1003 Ga0207702_11057010
1004 Ga0207641_10001556
1005 Ga0207641_10255922
1006 Ga0207648_10037830
1007 Ga0207648_10298301
1008 Ga0207648_10496005
1009 Ga0207676_10044179
1010 Ga0207676_10049820
1011 Ga0207676_10196398
1012 Ga0207676_10633645
1013 Ga0207675_100025632
1014 Ga0207675_100082220
1015 Ga0207675_100135415
1016 Ga0207675_100586823
1017 Ga0207675_100716580
1018 Ga0207683_10097729
1019 Ga0207698_10188782
1020 Ga0207698_10403119
1021 Ga0209967_1016833
1022 Ga0209981_1006216
1023 Ga0209996_1003930
1024 Ga0210000_1016941
1025 Ga0209995_1006005
1026 Ga0209968_1005902
1027 Ga0209999_1005157
1028 Ga0209970_1012892
1029 Ga0209983_1000119
1030 Ga0209971_1000033
1031 Ga0209966_1000069
1032 Ga0209998_10000003
1033 Ga0209974_10007467
1034 Ga0209974_10071360
1035 Ga0207428_10017515
1036 Ga0207428_10098398
1037 Ga0207428_10130725
1038 Ga0268266_10027359
1039 Ga0268266_10075175
1040 Ga0268266_10155253
1041 Ga0268265_10019194
1042 Ga0268265_10798451
1043 Ga0268264_10194583
1044 Ga0268264_11014909
1045 Ga0268264_11146957
1046 Ga0316182_1372464
1047 Ga0307408_100216838
1048 Ga0265314_10525039
1049 Ga0307405_10173807
1050 Ga0307413_10050614
1051 Ga0307410_10018291
1052 Ga0307406_10013857
1053 Ga0307406_11061015
1054 Ga0307407_10033925
1055 Ga0307409_100318563
1056 Ga0307416_100002835
1057 Ga0307416_101284626
1058 Ga0307414_10015663
1059 Ga0307411_10038805
1060 Ga0307415_100018695
1061 Ga0373958_0051919
1062 Ga0373929_0107396
1063 Ga0373940_0100530
1064 Ga0373945_0198586
1065 Ga0373953_0340810
1066 Ga0373956_0211121
1067 Ga0373957_0256026
1068 Ga0373955_0235871
1069 Ga0373955_0294038
1070 Ga0373962_0020283
1071 Ga0373924_0233815
1072 Ga0373931_0065829
1073 Ga0373931_0896065
1074 Ga0373935_0812062
1075 Ga0373927_0252811
1076 Ga0373947_0070383
1077 Ga0373947_0192364
1078 Ga0373947_0219934
1079 Ga0373937_0141992
1080 Ga0373937_0530280
1081 Ga0373925_0104241
1082 Ga0436361_1039134
1083 Ga0439443_090950
1084 Ga0439435_0035588
1085 Ga0451577_0044661
1086 Ga0451577_0089724
1087 Ga0451577_0588070
1088 Ga0466963_0577585
1089 Ga0453684_0079391
1090 Ga0453684_0627656
1091 Ga0451576_0051804
1092 Ga0451576_0163205
1093 Ga0451576_0235910
1094 Ga0451576_0661334
1095 Ga0451576_1885113
1096 Ga0466967_0161689
1097 Ga0495603_0289929
1098 Ga0495629_0125629
1099 Ga0495580_0197069
1100 Ga0495608_0281199
1101 Ga0495628_0544283
1102 Ga0495628_0939426
1103 Ga0495640_0196411
1104 Ga0495598_0047318
1105 Ga0495645_0780664
1106 Ga0495633_0205390
1107 Ga0495656_0065119
1108 Ga0495634_0405621
1109 Ga0495611_0285388
1110 Ga0495635_0251376
1111 Ga0495659_0156896
1112 Ga0495646_0405885
1113 Ga0495658_0017387
1114 Ga0495658_0178426
1115 Ga0495669_0238927
1116 Ga0495674_0521307
1117 Ga0495684_0876071
1118 Ga0496102_0215479
1119 Ga0496104_0159802
1120 Ga0496104_0286356
1121 Ga0496105_0378887
1122 Ga0496106_0247510
1123 Ga0496106_0843773
1124 Ga0496108_0007470
1125 Ga0496109_0072409
1126 Ga0496109_0641467
1127 Ga0496109_0719744
1128 Ga0496111_0204420
1129 Ga0496111_0210722
1130 Ga0496111_0749580
1131 Ga0496112_0015032
1132 Ga0496112_0403142
1133 Ga0496112_0762809
1134 Ga0496112_0835430
1135 Ga0496112_1609029
1136 Ga0496113_0144178
1137 Ga0496113_0670233
1138 Ga0496114_0233774
1139 Ga0496114_0648347
1140 Ga0496115_0136547
1141 Ga0501033_0024377
1142 Ga0501037_0150912
1143 Ga0501038_0730262
1144 Ga0501039_0574394
1145 Ga0501040_0140489
1146 Ga0501040_0573765
1147 Ga0501040_0751312
1148 Ga0501041_0031443
1149 Ga0501041_0033597
1150 Ga0501042_0003419
1151 Ga0501042_0061678
1152 Ga0501042_0241261
1153 Ga0501046_0001961
1154 Ga0501047_0800364
1155 Ga0501048_0044239
1156 Ga0501068_0049071
1157 Ga0501070_1185028
1158 Ga0501071_0032402
1159 Ga0501071_0042271
1160 Ga0501071_0118542
1161 Ga0501074_0012958
1162 Ga0501074_0070547
1163 Ga0501075_0010772
1164 Ga0501075_0032604
1165 Ga0501075_0056507
1166 Ga0501075_0638170
1167 Ga0501076_0012114
1168 Ga0501076_0066515
1169 Ga0501076_0221444
1170 Ga0501077_0007141
1171 Ga0501077_0109963
1172 Ga0501214_033035
1173 Ga0501233_073530
1174 Ga0501079_0004463
1175 Ga0501079_0052813
1176 Ga0501080_0032378
1177 Ga0501080_0121884
1178 Ga0501080_0161335
1179 Ga0501081_0005691
1180 Ga0501081_1199047
1181 Ga0501083_0070776
1182 Ga0501083_0081842
1183 Ga0501268_065476
1184 Ga0501270_002032
1185 Ga0501035_0772767
1186 Ga0501044_0124696
1187 Ga0501045_0002500
1188 Ga0501045_0087716
1189 nmdc:mga03n38_264549_c1
1190 nmdc:mga05p37_128118_c1
1191 nmdc:mga05p37_13856_c1
1192 nmdc:mga05p37_18651_c1
1193 nmdc:mga05p37_216726_c1
1194 nmdc:mga05p37_23817_c1
1195 nmdc:mga05p37_273748_c1
1196 nmdc:mga05p37_28334_c1
1197 nmdc:mga05p37_2_c1
1198 nmdc:mga05p37_4712_c1
1199 nmdc:mga05p37_53810_c1
1200 nmdc:mga05p37_58211_c1
1201 nmdc:mga05p37_60038_c1
1202 nmdc:mga05p37_699289_c1
1203 nmdc:mga05p37_80900_c1
1204 nmdc:mga05p37_970813_c1
1205 nmdc:mga09592_302611_c1
1206 nmdc:mga09592_5209_c1
1207 nmdc:mga09592_53222_c1
1208 nmdc:mga09592_70001_c1
1209 nmdc:mga09592_74490_c1
1210 nmdc:mga09592_763734_c1
1211 nmdc:mga0qj67_193788_c1
1212 nmdc:mga0qj67_279683_c1
1213 nmdc:mga06r32_104565_c1
1214 nmdc:mga06r32_22308_c1
1215 nmdc:mga08y16_298546_c1
1216 nmdc:mga08y16_83527_c1
1217 nmdc:mga0n895_111406_c1
1218 nmdc:mga0n895_138164_c1
1219 nmdc:mga0n895_202478_c1
1220 nmdc:mga0n895_212666_c1
1221 nmdc:mga0n895_260923_c1
1222 nmdc:mga0n895_316635_c1
1223 nmdc:mga0n895_473405_c1
1224 nmdc:mga0n895_608855_c1
1225 nmdc:mga0rr50_117961_c1
1226 nmdc:mga0rr50_1264730_c1
1227 nmdc:mga0rr50_156268_c1
1228 nmdc:mga0rr50_199624_c1
1229 nmdc:mga0rr50_2705_c1
1230 nmdc:mga0rr50_30471_c1
1231 nmdc:mga0rr50_678141_c1
1232 nmdc:mga08x19_102444_c1
1233 nmdc:mga08x19_306575_c1
1234 nmdc:mga08x19_44305_c1
1235 nmdc:mga08x19_50485_c1
1236 nmdc:mga08x19_51917_c1
1237 nmdc:mga08x19_689846_c1
1238 nmdc:mga08x19_75351_c1
1239 nmdc:mga0a205_142_c1
1240 nmdc:mga0a205_148413_c1
1241 nmdc:mga0a205_156446_c1
1242 nmdc:mga0a205_177712_c1
1243 nmdc:mga0a205_258465_c1
1244 nmdc:mga0a205_41015_c1
1245 nmdc:mga0a205_6014_c1
1246 nmdc:mga0a205_619_c1
1247 nmdc:mga0a205_628339_c1
1248 nmdc:mga0a205_658180_c1
1249 Ga0495601_0444063
1250 Ga0495595_0017737
1251 Ga0495595_0190510
1252 Ga0495619_0017075
1253 Ga0495619_0797467
1254 Ga0500555_000627
1255 Ga0500645_001086
1256 Ga0501084_0001889
1257 Ga0501084_0053063
1258 Ga0501084_0344759
1259 Ga0590071_117677
1260 Ga0590075_075910
1261 Ga0590077_017709
1262 Ga0501082_0004764
1263 Ga0501082_0320157
1264 Ga0501082_0395463
1265 Ga0530510_0043028
1266 Ga0530510_0090278
1267 Ga0530510_0111459
1268 Ga0530510_0125188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

46

189

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9711 14 159
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9698 14 159
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9653 10 166
3iwt-assembly1.cif.gz_A structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii 0.9533 12 168
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9361 10 166
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9679 14 159 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9569 10 168 3.40.980.10
2pjkA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9532 12 168 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.951 10 168 3.40.980.10
af_Q57631_3_163_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.899 10 166 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A2E6NHB7-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9909 5 168 GO:0005829
GO:0006777
AF-A0A2V8BFP9-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9903 3 168 GO:0005829
GO:0006777
AF-A0A1Q7PBG5-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9888 20 168 GO:0005829
GO:0006777
AF-A0A2V8ETF9-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9863 38 168 GO:0005829
GO:0006777
AF-A0A7W0TUF5-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9859 3 168 GO:0005829
GO:0006777

Map