F471014

General Info

Members Datasets Scaffolds Average Seq Length
632 387 581 240

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0186567|Ga0436360_0186567_1506_2351
Length 281
Sequence MDGIDLDRQTAPQSWTAPQSDAVAWPHLLHRWLAGGTRVPGGAMTATTELFRDDAYLQDCSATVTAVDAAGIRLDRTVFYPMGGGQPGDSGVLRRADGREIAIADTRKGEAAGEIVHVPAAPIDDLKPGETVTAAIDWTRRYRHMRMHSCLHLLCAAVPAGVTGGSIGDGKGRLDFDAGDTVLDKAAIEEKLNALVAQNLAVTSRWIDDAEMAARPELVRTMSVKPPSGQGRVRLMEVAGTDLQPCGGTHVRATGEIGAVRVDKIESKGKRNRRVSLSLVE

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
10 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2519103095 Burkholderia sp. KJ006 Isolate Nodule
13 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
14 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
15 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
22 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
23 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
24 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
25 2818991452 Burkholderia cepacia 561 Isolate Unclassified
26 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
27 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
28 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
29 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
30 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
31 2904564687 Burkholderia sp. 571 Isolate Unclassified
32 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
33 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
34 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
35 2928163908 Burkholderia sp. 567 Isolate Unclassified
36 2928170801 Burkholderia sp. 572 Isolate Unclassified
37 2928536128 Burkholderia sola 565 Isolate Unclassified
38 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
39 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
220 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
358 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
366 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
367 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
370 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
375 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
376 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
377 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
378 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
379 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
380 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
381 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
382 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
383 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
384 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
385 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
386 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
387 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.46
Metatranscriptomes 0.47
Isolates 8.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.82
Nodule 1.11
Rhizoplane 6.96
Rhizosphere 68.51
Stem 0
Stem Tuber 0
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016749 3300001989 Bacteria 2650
2 JGI24735J21928_10001950 3300002067 Bacteria 7250
3 JGI25153J46596_10000019 3300003215 Bacteria 260291
4 rootH2_10017122 3300003320 Bacteria 6354
5 rootH2_10144662 3300003320 Bacteria 2391
6 rootH1_10067028 3300003323 Bacteria 1580
7 JGI25160J50197_1001398 3300003354 Bacteria 12123
8 Ga0055532_1000764 3300003758 Bacteria 11446
9 Ga0055532_1003316 3300003758 Bacteria 2820
10 Ga0055532_1003330 3300003758 Bacteria 2807
11 Ga0055527_1000596 3300003760 Bacteria 11671
12 Ga0055527_1003210 3300003760 Bacteria 2493
13 Ga0055535_1001464 3300003761 Bacteria 11882
14 Ga0055535_1001470 3300003761 Bacteria 11866
15 Ga0055542_1001437 3300003762 Bacteria 11882
16 Ga0055542_1001771 3300003762 Bacteria 9063
17 Ga0055529_1000378 3300003763 Bacteria 48131
18 Ga0055529_1003123 3300003763 Bacteria 2868
19 Ga0055536_1014864 3300003781 Bacteria 2701
20 Ga0055528_1001333 3300003790 Bacteria 15358
21 Ga0055530_10018712 3300003791 Bacteria 2125
22 Ga0065165_1001568 3300005262 Bacteria 23601
23 Ga0070658_10018941 3300005327 Bacteria 5514
24 Ga0070658_10044306 3300005327 Bacteria 3596
25 Ga0070683_100207616 3300005329 Bacteria 1860
26 Ga0070670_100124505 3300005331 Bacteria 2225
27 Ga0068868_100529057 3300005338 Bacteria 1036
28 Ga0070660_100000045 3300005339 Bacteria 70908
29 Ga0070660_100000404 3300005339 Bacteria 28766
30 Ga0070661_100179028 3300005344 Bacteria 1612
31 Ga0070659_100000069 3300005366 Bacteria 81078
32 Ga0070659_100144437 3300005366 Bacteria 1938
33 Ga0070667_100077374 3300005367 Bacteria 2841
34 Ga0070667_100127444 3300005367 Bacteria 2219
35 Ga0070714_100023238 3300005435 Bacteria 5090
36 Ga0070714_100081941 3300005435 Bacteria 2810
37 Ga0070714_100174613 3300005435 Bacteria 1952
38 Ga0070713_100091028 3300005436 Bacteria 2623
39 Ga0070710_10002420 3300005437 Bacteria 8849
40 Ga0070710_10166700 3300005437 Bacteria 1370
41 Ga0070710_10221957 3300005437 Bacteria 1203
42 Ga0070711_100007844 3300005439 Bacteria 6506
43 Ga0070711_100187670 3300005439 Bacteria 1586
44 Ga0070708_100220968 3300005445 Bacteria 1777
45 Ga0070663_100110670 3300005455 Bacteria 2063
46 Ga0070662_100233883 3300005457 Bacteria 1471
47 Ga0070681_10077512 3300005458 Bacteria 3281
48 Ga0070681_10078349 3300005458 Bacteria 3261
49 Ga0070681_10535897 3300005458 Bacteria 1084
50 Ga0070706_100098800 3300005467 Bacteria 2712
51 Ga0070706_100307772 3300005467 Bacteria 1478
52 Ga0070706_100446750 3300005467 Bacteria 1203
53 Ga0070707_100019235 3300005468 Bacteria 6433
54 Ga0070698_100155965 3300005471 Bacteria 2229
55 Ga0070698_100488537 3300005471 Bacteria 1168
56 Ga0070698_100770342 3300005471 Bacteria 906
57 Ga0070699_100570067 3300005518 Bacteria 1031
58 Ga0070679_100066596 3300005530 Bacteria 3590
59 Ga0068853_100022323 3300005539 Bacteria 5285
60 Ga0070696_100533464 3300005546 Bacteria 938
61 Ga0070665_100779701 3300005548 Bacteria 969
62 Ga0068855_100012359 3300005563 Bacteria 10313
63 Ga0068855_100027446 3300005563 Bacteria 6810
64 Ga0068855_100589619 3300005563 Bacteria 1200
65 Ga0068857_100333197 3300005577 Bacteria 1403
66 Ga0068856_100130245 3300005614 Bacteria 2520
67 Ga0068856_100268545 3300005614 Bacteria 1722
68 Ga0068856_100312110 3300005614 Bacteria 1590
69 Ga0068856_100456315 3300005614 Bacteria 1299
70 Ga0068852_100062860 3300005616 Bacteria 3230
71 Ga0068859_100499099 3300005617 Bacteria 1312
72 Ga0068864_100485322 3300005618 Bacteria 1187
73 Ga0068864_100777235 3300005618 Bacteria 940
74 Ga0068858_100624927 3300005842 Bacteria 1046
75 Ga0068862_100031459 3300005844 Bacteria 4480
76 Ga0081538_10017322 3300005981 Bacteria 5474
77 Ga0070717_10010512 3300006028 Bacteria 6992
78 Ga0070717_10072470 3300006028 Bacteria 2876
79 Ga0075365_10087525 3300006038 Bacteria 2118
80 Ga0075368_10015202 3300006042 Bacteria 2851
81 Ga0075368_10062816 3300006042 Bacteria 1489
82 Ga0075363_100191621 3300006048 Bacteria 1166
83 Ga0070712_100013466 3300006175 Bacteria 5227
84 Ga0070712_100282709 3300006175 Bacteria 1337
85 Ga0075362_10023471 3300006177 Bacteria 2609
86 Ga0075366_10101579 3300006195 Bacteria 1726
87 Ga0075366_10163552 3300006195 Bacteria 1349
88 Ga0075428_100429145 3300006844 Bacteria 1416
89 Ga0075430_100017546 3300006846 Bacteria 6097
90 Ga0075430_100495506 3300006846 Bacteria 1008
91 Ga0075431_100154909 3300006847 Bacteria 2358
92 Ga0075431_100345283 3300006847 Bacteria 1497
93 Ga0075429_100436502 3300006880 Unclassified 1147
94 Ga0097620_100499117 3300006931 Bacteria 1312
95 Ga0099795_10049502 3300007788 Bacteria 1525
96 Ga0099795_10082232 3300007788 Bacteria 1234
97 Ga0105251_10002123 3300009011 Bacteria 15936
98 Ga0105250_10010724 3300009092 Bacteria 3813
99 Ga0105240_10006999 3300009093 Bacteria 16468
100 Ga0105240_10009057 3300009093 Bacteria 14131
101 Ga0105240_10060794 3300009093 Bacteria 4709
102 Ga0105240_10068460 3300009093 Bacteria 4396
103 Ga0105240_10115070 3300009093 Bacteria 3248
104 Ga0105240_10158073 3300009093 Bacteria 2694
105 Ga0105240_10348169 3300009093 Bacteria 1681
106 Ga0111539_10481083 3300009094 Bacteria 1446
107 Ga0111539_10535451 3300009094 Bacteria 1364
108 Ga0105245_10248036 3300009098 Bacteria 1729
109 Ga0114129_10224327 3300009147 Bacteria 2533
110 Ga0105248_10019259 3300009177 Bacteria 7552
111 Ga0105237_10015869 3300009545 Bacteria 7832
112 Ga0105237_10087138 3300009545 Bacteria 3112
113 Ga0105237_10295192 3300009545 Bacteria 1624
114 Ga0105237_10748272 3300009545 Bacteria 984
115 Ga0105237_10915333 3300009545 Bacteria 884
116 Ga0105238_10054313 3300009551 Bacteria 4023
117 Ga0105238_10235938 3300009551 Bacteria 1806
118 Ga0105238_10571829 3300009551 Bacteria 1136
119 Ga0105249_10107315 3300009553 Bacteria 2635
120 Ga0105249_10261207 3300009553 Bacteria 1721
121 Ga0105030_103461 3300009987 Bacteria 1360
122 Ga0099796_10145298 3300010159 Bacteria 930
123 Ga0105239_10001236 3300010375 Bacteria 34816
124 Ga0105239_11003658 3300010375 Bacteria 960
125 Ga0157373_10004810 3300013100 Bacteria 10160
126 Ga0157373_10228649 3300013100 Bacteria 1313
127 Ga0157370_10001406 3300013104 Bacteria 29865
128 Ga0157370_10003087 3300013104 Bacteria 19723
129 Ga0157370_10031109 3300013104 Bacteria 5224
130 Ga0157369_10000915 3300013105 Bacteria 37650
131 Ga0157369_10001268 3300013105 Bacteria 31342
132 Ga0157369_10004199 3300013105 Bacteria 17053
133 Ga0157374_10000318 3300013296 Bacteria 44740
134 Ga0157378_10302455 3300013297 Bacteria 1548
135 Ga0163162_10093316 3300013306 Bacteria 3095
136 Ga0157372_10029152 3300013307 Bacteria 6024
137 Ga0157372_10149106 3300013307 Bacteria 2698
138 Ga0157372_10261283 3300013307 Bacteria 2010
139 Ga0163163_10329241 3300014325 Bacteria 1582
140 Ga0182008_10263461 3300014497 Bacteria 892
141 Ga0157376_10440772 3300014969 Bacteria 1268
142 Ga0182006_1032216 3300015261 Bacteria 2108
143 Ga0182006_1056763 3300015261 Bacteria 1490
144 Ga0182007_10055992 3300015262 Bacteria 1296
145 Ga0183361_10010 3300016635 Bacteria 204902
146 Ga0206356_10633488 3300020070 Bacteria 2413
147 Ga0206353_10938556 3300020082 Bacteria 2393
148 Ga0213873_10029473 3300021358 Bacteria 1353
149 Ga0213876_10134403 3300021384 Bacteria 1315
150 Ga0213875_10000933 3300021388 Bacteria 21085
151 Ga0213875_10003818 3300021388 Bacteria 8469
152 Ga0213875_10009528 3300021388 Bacteria 4917
153 Ga0213875_10050780 3300021388 Bacteria 1943
154 Ga0213875_10105190 3300021388 Bacteria 1318
155 Ga0224712_10000188 3300022467 Bacteria 10883
156 Ga0209566_101237 3300025225 Bacteria 8796
157 Ga0209672_100033 3300025228 Bacteria 315326
158 Ga0209672_100114 3300025228 Bacteria 90538
159 Ga0209672_100224 3300025228 Bacteria 43765
160 Ga0209147_100161 3300025229 Bacteria 90627
161 Ga0209147_100168 3300025229 Bacteria 89085
162 Ga0209147_100199 3300025229 Bacteria 67646
163 Ga0209258_100100 3300025242 Bacteria 214027
164 Ga0209258_100263 3300025242 Bacteria 90453
165 Ga0209148_1000630 3300025254 Bacteria 31045
166 Ga0209148_1001267 3300025254 Bacteria 13898
167 Ga0209759_1002552 3300025256 Bacteria 7901
168 Ga0209759_1023340 3300025256 Bacteria 1363
169 Ga0209565_1010916 3300025263 Bacteria 2236
170 Ga0209455_1000192 3300025272 Bacteria 90553
171 Ga0209455_1000250 3300025272 Bacteria 64478
172 Ga0209455_1002064 3300025272 Bacteria 8114
173 Ga0209673_1000332 3300025273 Bacteria 86973
174 Ga0209130_1014437 3300025284 Bacteria 1982
175 Ga0209675_1002185 3300025291 Bacteria 10259
176 Ga0209676_1000269 3300025292 Bacteria 108375
177 Ga0209564_1001581 3300025295 Bacteria 22255
178 Ga0209564_1004794 3300025295 Bacteria 8062
179 Ga0209758_1000028 3300025297 Bacteria 530102
180 Ga0209758_1013444 3300025297 Bacteria 4461
181 Ga0209050_1007558 3300025298 Bacteria 6053
182 Ga0209050_1010486 3300025298 Bacteria 4558
183 Ga0207426_1000168 3300025302 Bacteria 165214
184 Ga0209051_1049656 3300025303 Bacteria 1411
185 Ga0209257_1000574 3300025304 Bacteria 61789
186 Ga0207696_1027943 3300025711 Bacteria 1735
187 Ga0207713_1007559 3300025735 Bacteria 6386
188 Ga0207692_10014619 3300025898 Bacteria 3433
189 Ga0207680_10108814 3300025903 Bacteria 1794
190 Ga0207647_10000235 3300025904 Bacteria 45337
191 Ga0207647_10000590 3300025904 Bacteria 28264
192 Ga0207647_10005516 3300025904 Bacteria 9265
193 Ga0207684_10078410 3300025910 Bacteria 2809
194 Ga0207707_10062688 3300025912 Bacteria 3235
195 Ga0207707_10454976 3300025912 Bacteria 1095
196 Ga0207707_10532593 3300025912 Bacteria 999
197 Ga0207695_10004347 3300025913 Bacteria 19403
198 Ga0207695_10036589 3300025913 Bacteria 5306
199 Ga0207695_10051646 3300025913 Bacteria 4314
200 Ga0207695_10138268 3300025913 Bacteria 2387
201 Ga0207695_10177497 3300025913 Bacteria 2052
202 Ga0207671_10047271 3300025914 Bacteria 3185
203 Ga0207671_10190430 3300025914 Bacteria 1599
204 Ga0207693_10001194 3300025915 Bacteria 23199
205 Ga0207693_10088368 3300025915 Bacteria 2429
206 Ga0207693_10150011 3300025915 Bacteria 1833
207 Ga0207693_10416272 3300025915 Bacteria 1050
208 Ga0207663_10208662 3300025916 Bacteria 1414
209 Ga0207657_10000068 3300025919 Bacteria 96575
210 Ga0207657_10001021 3300025919 Bacteria 29707
211 Ga0207646_10004718 3300025922 Bacteria 14684
212 Ga0207694_10181790 3300025924 Bacteria 1705
213 Ga0207650_10020407 3300025925 Bacteria 4673
214 Ga0207650_10584957 3300025925 Bacteria 938
215 Ga0207700_10087296 3300025928 Bacteria 2453
216 Ga0207700_10137589 3300025928 Bacteria 2003
217 Ga0207664_10189519 3300025929 Bacteria 1769
218 Ga0207664_10254399 3300025929 Bacteria 1534
219 Ga0207644_10238798 3300025931 Bacteria 1446
220 Ga0207690_10000027 3300025932 Bacteria 162225
221 Ga0207690_10157782 3300025932 Bacteria 1688
222 Ga0207709_10611413 3300025935 Bacteria 864
223 Ga0207665_10014121 3300025939 Bacteria 5253
224 Ga0207711_10026069 3300025941 Bacteria 4903
225 Ga0207689_10136782 3300025942 Bacteria 2018
226 Ga0207679_10176225 3300025945 Bacteria 1765
227 Ga0207667_10024533 3300025949 Bacteria 6619
228 Ga0207667_10282489 3300025949 Bacteria 1696
229 Ga0207667_10295381 3300025949 Bacteria 1655
230 Ga0207667_10696218 3300025949 Bacteria 1019
231 Ga0207712_10132822 3300025961 Bacteria 1899
232 Ga0207640_10824464 3300025981 Bacteria 805
233 Ga0207658_10058163 3300025986 Bacteria 2876
234 Ga0207658_10162632 3300025986 Bacteria 1831
235 Ga0207677_10365379 3300026023 Bacteria 1214
236 Ga0207677_10585220 3300026023 Bacteria 977
237 Ga0207639_10042728 3300026041 Bacteria 3398
238 Ga0207678_10000386 3300026067 Bacteria 40106
239 Ga0207702_10234875 3300026078 Bacteria 1715
240 Ga0207676_10298636 3300026095 Bacteria 1470
241 Ga0207676_10610410 3300026095 Bacteria 1049
242 Ga0207674_10114973 3300026116 Bacteria 2662
243 Ga0207674_10235164 3300026116 Bacteria 1780
244 Ga0207698_10019463 3300026142 Bacteria 4648
245 Ga0209371_1000405 3300027312 Bacteria 44970
246 Ga0209813_10039629 3300027866 Bacteria 1428
247 Ga0268265_10093043 3300028380 Bacteria 2414
248 Ga0268265_10516178 3300028380 Bacteria 1129
249 Ga0265338_10000557 3300028800 Bacteria 65338
250 Ga0268256_1000345 3300030500 Bacteria 44970
251 Ga0265332_10046725 3300031238 Bacteria 1864
252 Ga0265325_10050137 3300031241 Bacteria 2151
253 Ga0265340_10033340 3300031247 Bacteria 2564
254 Ga0265340_10035988 3300031247 Bacteria 2456
255 Ga0265340_10204420 3300031247 Bacteria 888
256 Ga0265339_10103505 3300031249 Bacteria 1479
257 Ga0265331_10004759 3300031250 Bacteria 8373
258 Ga0265331_10094212 3300031250 Bacteria 1383
259 Ga0265316_10304301 3300031344 Bacteria 1161
260 Ga0307509_10230028 3300031507 Bacteria 1658
261 Ga0265313_10000453 3300031595 Bacteria 43360
262 Ga0265314_10230484 3300031711 Bacteria 1075
263 Ga0265342_10033712 3300031712 Bacteria 3145
264 Ga0307406_10231640 3300031901 Bacteria 1380
265 Ga0307407_10252116 3300031903 Bacteria 1210
266 Ga0307409_100460152 3300031995 Bacteria 1230
267 Ga0307416_100357110 3300032002 Bacteria 1482
268 Ga0307416_100770832 3300032002 Bacteria 1056
269 Ga0373923_0178048 3300035111 Bacteria 976
270 Ga0373953_0089600 3300035117 Bacteria 1286
271 Ga0316574_0005800 3300035398 Bacteria 6623
272 Ga0316574_0021391 3300035398 Bacteria 3840
273 Ga0316574_0024027 3300035398 Bacteria 3644
274 Ga0373931_0251611 3300035691 Bacteria 1075
275 Ga0373935_0330773 3300035692 Bacteria 1083
276 Ga0373927_0097605 3300035695 Bacteria 1910
277 Ga0373947_0106257 3300035725 Bacteria 1769
278 Ga0373937_0626681 3300036401 Bacteria 1021
279 Ga0316584_0157396 3300036712 Unclassified 1689
280 Ga0316584_0221922 3300036712 Bacteria 1388
281 Ga0373925_0049212 3300037068 Bacteria 3142
282 Ga0373925_0074859 3300037068 Bacteria 2565
283 Ga0373925_0152609 3300037068 Bacteria 1815
284 Ga0373925_0328960 3300037068 Bacteria 1238
285 Ga0373925_0574338 3300037068 Bacteria 928
286 Ga0395900_0000635 3300037418 Bacteria 47215
287 Ga0395900_0115375 3300037418 Bacteria 2756
288 Ga0395900_0302667 3300037418 Bacteria 1585
289 Ga0395898_0001892 3300037466 Bacteria 26705
290 Ga0395898_0024305 3300037466 Bacteria 6111
291 Ga0395898_0043167 3300037466 Bacteria 4444
292 Ga0395905_0000012 3300037471 Bacteria 420861
293 Ga0395905_0027618 3300037471 Bacteria 5352
294 Ga0395905_0043010 3300037471 Bacteria 4238
295 Ga0436364_0169683 3300037853 Bacteria 86149
296 Ga0436364_0393226 3300037853 Bacteria 35432
297 Ga0436364_0534702 3300037853 Bacteria 1518
298 Ga0436364_0654159 3300037853 Bacteria 5237
299 Ga0436364_1146099 3300037853 Bacteria 15147
300 Ga0436364_1391815 3300037853 Bacteria 1092
301 Ga0395901_0000002 3300038443 Bacteria 761045
302 Ga0395901_0000079 3300038443 Bacteria 134462
303 Ga0395901_0062632 3300038443 Bacteria 3870
304 Ga0395901_0265894 3300038443 Bacteria 1784
305 Ga0395901_0268033 3300038443 Bacteria 1776
306 Ga0395901_0551379 3300038443 Bacteria 1168
307 Ga0400489_75299 3300039093 Bacteria 2245
308 Ga0400487_61945 3300039110 Bacteria 3180
309 Ga0436365_0614583 3300039437 Bacteria 2232
310 Ga0436365_1280460 3300039437 Bacteria 1409
311 Ga0436360_0186567 3300039438 Bacteria 3552
312 Ga0436360_0732647 3300039438 Bacteria 2661
313 Ga0436360_0966976 3300039438 Bacteria 1048
314 Ga0436361_0228888 3300039447 Bacteria 17557
315 Ga0436361_0302900 3300039447 Bacteria 2822
316 Ga0436361_0723959 3300039447 Bacteria 5657
317 Ga0436363_0337490 3300039450 Bacteria 865
318 Ga0436363_0810913 3300039450 Bacteria 1363
319 Ga0436362_0302354 3300039453 Bacteria 2907
320 Ga0436362_0907642 3300039453 Bacteria 4029
321 Ga0436362_1155506 3300039453 Bacteria 1902
322 Ga0436362_1204423 3300039453 Bacteria 1184
323 Ga0439448_0001158 3300042005 Bacteria 6689
324 Ga0451577_0498466 3300042876 Bacteria 1106
325 Ga0466969_0018240 3300044656 Bacteria 3657
326 Ga0466969_0024770 3300044656 Bacteria 3086
327 Ga0466972_0103974 3300044658 Bacteria 1343
328 Ga0466973_0042623 3300044659 Bacteria 4265
329 Ga0466965_0000552 3300044683 Bacteria 13479
330 Ga0466965_0018142 3300044683 Bacteria 3370
331 Ga0466965_0126631 3300044683 Bacteria 1322
332 Ga0466966_0003017 3300044684 Bacteria 11103
333 Ga0466966_0005413 3300044684 Bacteria 8392
334 Ga0466966_0026815 3300044684 Bacteria 3760
335 Ga0466966_0057976 3300044684 Bacteria 2448
336 Ga0466961_0004320 3300044693 Bacteria 8897
337 Ga0466961_0005705 3300044693 Bacteria 7875
338 Ga0466963_0000989 3300044694 Bacteria 14647
339 Ga0466963_0001909 3300044694 Bacteria 11405
340 Ga0466971_0005454 3300044719 Bacteria 5520
341 Ga0466970_0035633 3300044765 Bacteria 2636
342 Ga0466970_0077386 3300044765 Bacteria 1793
343 Ga0466957_0000377 3300044842 Bacteria 21850
344 Ga0466960_0013141 3300044901 Bacteria 3511
345 Ga0466959_0001316 3300045049 Bacteria 15078
346 Ga0451576_0127963 3300045051 Bacteria 2647
347 Ga0466958_0003652 3300045836 Bacteria 8030
348 Ga0466967_0235960 3300045976 Bacteria 1743
349 Ga0466967_0250170 3300045976 Bacteria 1693
350 Ga0495592_0277003 3300046454 Bacteria 1098
351 Ga0495603_0000924 3300046455 Bacteria 16860
352 Ga0495603_0017279 3300046455 Bacteria 4367
353 Ga0495590_0000706 3300046457 Bacteria 15268
354 Ga0495590_0045035 3300046457 Bacteria 1539
355 Ga0495629_0000774 3300046459 Bacteria 25829
356 Ga0495653_0041438 3300046463 Bacteria 3594
357 Ga0495653_0074231 3300046463 Bacteria 2535
358 Ga0495650_0002070 3300046471 Bacteria 17390
359 Ga0495650_0094711 3300046471 Bacteria 1130
360 Ga0495580_0008325 3300046472 Bacteria 8248
361 Ga0495580_0013673 3300046472 Bacteria 6186
362 Ga0495580_0186232 3300046472 Bacteria 1433
363 Ga0495580_0285682 3300046472 Bacteria 1125
364 Ga0495580_0386652 3300046472 Bacteria 945
365 Ga0495662_0036471 3300046476 Bacteria 2373
366 Ga0495664_0002778 3300046477 Bacteria 9421
367 Ga0495584_0025551 3300046491 Bacteria 2994
368 Ga0495585_0129372 3300046492 Bacteria 1330
369 Ga0495606_0002948 3300046507 Bacteria 18768
370 Ga0495606_0036166 3300046507 Bacteria 3366
371 Ga0495606_0053361 3300046507 Bacteria 2623
372 Ga0495606_0135743 3300046507 Bacteria 1457
373 Ga0495628_0320477 3300046516 Bacteria 1144
374 Ga0495648_0055509 3300046524 Bacteria 2387
375 Ga0495642_0144202 3300046528 Bacteria 1029
376 Ga0495652_0071993 3300046529 Bacteria 2882
377 Ga0495654_0018564 3300046530 Bacteria 3643
378 Ga0495665_0010913 3300046531 Bacteria 4915
379 Ga0495665_0022130 3300046531 Bacteria 3418
380 Ga0495640_0055468 3300046533 Bacteria 2711
381 Ga0495586_0098491 3300046535 Bacteria 1621
382 Ga0495586_0179592 3300046535 Bacteria 1197
383 Ga0495597_0004104 3300046542 Bacteria 8116
384 Ga0495645_0007762 3300046543 Bacteria 7461
385 Ga0495645_0058610 3300046543 Bacteria 2793
386 Ga0495667_0016713 3300046559 Bacteria 4955
387 Ga0495611_0031701 3300046648 Bacteria 2328
388 Ga0495588_0014205 3300046674 Bacteria 3808
389 Ga0495599_0413017 3300046678 Bacteria 803
390 Ga0495646_0115462 3300046680 Bacteria 1524
391 Ga0495669_0020892 3300046684 Bacteria 2836
392 Ga0495669_0109982 3300046684 Bacteria 1286
393 Ga0495671_0018661 3300046692 Bacteria 3678
394 Ga0495649_0008350 3300046694 Bacteria 6232
395 Ga0495589_0029786 3300046794 Bacteria 2752
396 Ga0495589_0052667 3300046794 Bacteria 2010
397 Ga0495589_0096473 3300046794 Bacteria 1433
398 Ga0495600_0054630 3300046809 Bacteria 2609
399 Ga0495581_0001974 3300047315 Bacteria 11503
400 Ga0495604_0086967 3300047317 Bacteria 2329
401 Ga0495674_0008236 3300047319 Bacteria 9946
402 Ga0495674_0013834 3300047319 Bacteria 7574
403 Ga0495674_0163930 3300047319 Bacteria 1858
404 Ga0495680_0151216 3300047322 Bacteria 1692
405 Ga0495680_0277758 3300047322 Bacteria 1181
406 Ga0495683_0002040 3300047323 Bacteria 12513
407 Ga0495683_0012429 3300047323 Bacteria 4468
408 Ga0495683_0034712 3300047323 Bacteria 2564
409 Ga0495687_000025 3300047443 Bacteria 310498
410 Ga0495675_0042986 3300047444 Bacteria 2879
411 Ga0495593_0025150 3300047673 Bacteria 3295
412 Ga0495602_0011140 3300048088 Bacteria 9309
413 Ga0495602_0064861 3300048088 Bacteria 3155
414 Ga0495614_0018957 3300048089 Bacteria 2979
415 Ga0495626_0122937 3300048091 Bacteria 1114
416 Ga0496100_0000791 3300048903 Bacteria 15063
417 Ga0496100_0090560 3300048903 Bacteria 2086
418 Ga0496100_0517583 3300048903 Bacteria 920
419 Ga0496101_0002729 3300048904 Bacteria 10835
420 Ga0496101_0005842 3300048904 Bacteria 7871
421 Ga0496101_0134029 3300048904 Bacteria 1883
422 Ga0496101_0308613 3300048904 Bacteria 1240
423 Ga0496102_0008235 3300048905 Bacteria 8926
424 Ga0496102_0035606 3300048905 Bacteria 4482
425 Ga0496102_0148342 3300048905 Bacteria 2202
426 Ga0496103_0002256 3300048906 Bacteria 12202
427 Ga0496103_0004743 3300048906 Bacteria 8223
428 Ga0496104_0050043 3300048907 Bacteria 3942
429 Ga0496104_0379973 3300048907 Bacteria 1325
430 Ga0496105_0040038 3300048908 Bacteria 3863
431 Ga0496105_0187294 3300048908 Bacteria 1693
432 Ga0496105_0396969 3300048908 Bacteria 1095
433 Ga0496106_0000053 3300048909 Bacteria 93929
434 Ga0496106_0031278 3300048909 Bacteria 3965
435 Ga0496106_0043788 3300048909 Bacteria 3359
436 Ga0496106_0074774 3300048909 Bacteria 2594
437 Ga0496107_0015100 3300048910 Bacteria 5411
438 Ga0496107_0120339 3300048910 Bacteria 1934
439 Ga0496109_0268345 3300048912 Bacteria 1608
440 Ga0496110_0006687 3300048913 Bacteria 9162
441 Ga0496110_0370856 3300048913 Bacteria 1304
442 Ga0496111_0008603 3300048914 Bacteria 6767
443 Ga0496111_0247274 3300048914 Bacteria 1324
444 Ga0496112_0011544 3300048915 Bacteria 8074
445 Ga0496112_0025678 3300048915 Bacteria 5659
446 Ga0496112_0121102 3300048915 Bacteria 2586
447 Ga0496112_0336044 3300048915 Bacteria 1454
448 Ga0496113_0024627 3300048916 Bacteria 4280
449 Ga0496113_0085022 3300048916 Bacteria 2430
450 Ga0496113_0200721 3300048916 Bacteria 1585
451 Ga0496113_0505574 3300048916 Bacteria 970
452 Ga0496113_0637215 3300048916 Bacteria 853
453 Ga0496114_0001299 3300048917 Bacteria 18897
454 Ga0496115_0025883 3300048918 Bacteria 4572
455 Ga0496115_0047431 3300048918 Bacteria 3436
456 Ga0496116_0020686 3300048919 Bacteria 4989
457 Ga0496116_0050663 3300048919 Bacteria 2765
458 Ga0496116_0085578 3300048919 Bacteria 1937
459 Ga0496116_0237236 3300048919 Bacteria 919
460 Ga0496117_0002599 3300048920 Bacteria 22450
461 Ga0496117_0078535 3300048920 Bacteria 2178
462 Ga0496118_0011356 3300048921 Bacteria 8705
463 Ga0496119_0119083 3300048922 Bacteria 1454
464 Ga0496120_0194029 3300048923 Bacteria 988
465 Ga0496121_0000585 3300048924 Bacteria 68389
466 Ga0496121_0003743 3300048924 Bacteria 21303
467 Ga0496121_0009234 3300048924 Bacteria 11389
468 Ga0496121_0016230 3300048924 Bacteria 7706
469 Ga0496121_0215272 3300048924 Bacteria 1358
470 Ga0496121_0221336 3300048924 Bacteria 1333
471 Ga0496123_0012440 3300048926 Bacteria 7255
472 Ga0496125_0012344 3300048928 Bacteria 8488
473 Ga0496126_0006736 3300048929 Bacteria 12756
474 Ga0496126_0125160 3300048929 Bacteria 2226
475 Ga0496126_0249978 3300048929 Bacteria 1478
476 Ga0501031_0057249 3300049568 Bacteria 2540
477 Ga0501032_0001025 3300049569 Bacteria 22442
478 Ga0501032_0061429 3300049569 Bacteria 2519
479 Ga0501033_0004528 3300049570 Bacteria 11125
480 Ga0501033_0272029 3300049570 Bacteria 1197
481 Ga0501034_0089476 3300049571 Bacteria 3076
482 Ga0501034_0407800 3300049571 Bacteria 1281
483 Ga0501036_0001419 3300049572 Bacteria 18419
484 Ga0501036_0085282 3300049572 Bacteria 2669
485 Ga0501037_0003506 3300049573 Bacteria 11384
486 Ga0501038_0003266 3300049574 Bacteria 15128
487 Ga0501038_0140124 3300049574 Bacteria 1979
488 Ga0501038_0396205 3300049574 Bacteria 1069
489 Ga0501039_0002791 3300049575 Bacteria 13048
490 Ga0501039_0057189 3300049575 Bacteria 3020
491 Ga0501040_0045383 3300049576 Bacteria 2997
492 Ga0501042_0036652 3300049578 Bacteria 3480
493 Ga0501043_0000339 3300049579 Bacteria 42404
494 Ga0501043_0050266 3300049579 Bacteria 3277
495 Ga0501043_0189972 3300049579 Bacteria 1598
496 Ga0501046_0000671 3300049580 Bacteria 33150
497 Ga0501046_0051026 3300049580 Bacteria 3266
498 Ga0501047_0001976 3300049581 Bacteria 19681
499 Ga0501048_0013230 3300049582 Bacteria 6123
500 Ga0501067_0014845 3300049583 Bacteria 4310
501 Ga0501068_0000979 3300049584 Bacteria 15009
502 Ga0501068_0054939 3300049584 Bacteria 2413
503 Ga0501069_0000349 3300049585 Bacteria 20802
504 Ga0501070_0003463 3300049586 Bacteria 13689
505 Ga0501070_0003907 3300049586 Bacteria 12859
506 Ga0501071_0022662 3300049587 Bacteria 4380
507 Ga0501071_0048542 3300049587 Bacteria 3054
508 Ga0501072_0013637 3300049588 Bacteria 6222
509 Ga0501072_0095321 3300049588 Bacteria 2365
510 Ga0501073_0002667 3300049589 Bacteria 13363
511 Ga0501073_0025562 3300049589 Bacteria 4232
512 Ga0501073_0457168 3300049589 Bacteria 883
513 Ga0501074_0000220 3300049590 Bacteria 31534
514 Ga0501074_0060829 3300049590 Bacteria 2721
515 Ga0501075_0038974 3300049591 Bacteria 3554
516 Ga0501076_0031675 3300049592 Bacteria 4126
517 Ga0501077_0031384 3300049593 Bacteria 3380
518 Ga0501079_0033771 3300049741 Bacteria 3936
519 Ga0501079_0184530 3300049741 Bacteria 1628
520 Ga0501079_0442586 3300049741 Bacteria 1020
521 Ga0501080_0000471 3300049742 Bacteria 31285
522 Ga0501080_0058767 3300049742 Bacteria 3579
523 Ga0501080_0072578 3300049742 Bacteria 3202
524 Ga0501080_0433094 3300049742 Bacteria 1180
525 Ga0501081_0057266 3300049743 Bacteria 2694
526 Ga0501083_0000746 3300049744 Bacteria 21235
527 Ga0501083_0009943 3300049744 Bacteria 6715
528 Ga0501083_0073553 3300049744 Bacteria 2272
529 Ga0501083_0094333 3300049744 Bacteria 1975
530 Ga0501035_0001114 3300049822 Bacteria 28107
531 Ga0501035_0057126 3300049822 Bacteria 3480
532 Ga0501044_0002829 3300049823 Bacteria 19746
533 Ga0501044_0006665 3300049823 Bacteria 12729
534 Ga0501044_0180637 3300049823 Bacteria 2077
535 Ga0501045_0053629 3300049824 Bacteria 2946
536 nmdc:mga03683_90481_c1 3300050489 Bacteria 1333
537 nmdc:mga0yw44_616492_c1 3300050492 Bacteria 737
538 nmdc:mga0k408_101739_c1 3300050493 Bacteria 1694
539 nmdc:mga0k408_287567_c1 3300050493 Bacteria 981
540 nmdc:mga05p37_80389_c1 3300050507 Bacteria 4015
541 nmdc:mga0qj67_215733_c1 3300050509 Bacteria 1558
542 nmdc:mga06r32_419249_c1 3300050510 Bacteria 1320
543 nmdc:mga08y16_517676_c1 3300050511 Bacteria 1210
544 nmdc:mga08x19_22005_c1 3300050514 Bacteria 3943
545 nmdc:mga08x19_231225_c1 3300050514 Bacteria 1272
546 nmdc:mga0sz30_4790_c1 3300050516 Bacteria 4922
547 Ga0495601_0033068 3300053077 Bacteria 3221
548 Ga0495595_0012215 3300053084 Bacteria 3605
549 Ga0495619_0023272 3300053085 Bacteria 3970
550 Ga0500578_0120951 3300053086 Bacteria 1646
551 Ga0500646_0021763 3300053090 Bacteria 1710
552 Ga0500646_0036670 3300053090 Bacteria 1367
553 Ga0500651_0067078 3300053093 Bacteria 2234
554 Ga0500566_0078925 3300053094 Bacteria 1836
555 Ga0500641_0000418 3300053096 Bacteria 15650
556 Ga0500641_0011956 3300053096 Bacteria 3161
557 Ga0500555_016134 3300053103 Bacteria 2153
558 Ga0500594_0031775 3300053118 Bacteria 1394
559 Ga0500594_0042543 3300053118 Bacteria 1249
560 Ga0500595_001208 3300053119 Bacteria 14277
561 Ga0500642_0000211 3300053130 Bacteria 23725
562 Ga0500642_0009703 3300053130 Bacteria 3357
563 Ga0500658_0048747 3300053134 Bacteria 1723
564 Ga0500568_0006454 3300053139 Bacteria 5882
565 Ga0500577_0015195 3300053142 Bacteria 2400
566 Ga0500588_0173547 3300053146 Bacteria 790
567 Ga0500604_0002385 3300053151 Bacteria 5137
568 Ga0500604_0004752 3300053151 Bacteria 3599
569 Ga0500604_0016842 3300053151 Bacteria 2016
570 Ga0500616_0001275 3300053153 Bacteria 25176
571 Ga0500645_011319 3300053730 Bacteria 2918
572 Ga0500609_002846 3300053731 Bacteria 2467
573 Ga0501084_0017748 3300054114 Bacteria 5922
574 Ga0501082_0001076 3300060353 Bacteria 24166
575 Ga0501082_0243089 3300060353 Bacteria 1566
576 Ga0501082_0253371 3300060353 Bacteria 1531
577 Ga0501082_0557460 3300060353 Bacteria 1002
578 Ga0501082_0762183 3300060353 Bacteria 847
579 Ga0466962_0008250 3300061719 Bacteria 4992
580 Ga0466962_0010777 3300061719 Bacteria 4392
581 Ga0530510_0027453 3300061734 Bacteria 4078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100022323 Ga0068853_1000223232 214
2 3300026041 Ga0207639_10042728 Ga0207639_100427283 214
3 3300053118 Ga0500594_0042543 Ga0500594_0042543_16_672 216
4 3300042876 Ga0451577_0498466 Ga0451577_0498466_331_1038 219
5 3300053093 Ga0500651_0067078 Ga0500651_0067078_809_1552 219
6 3300053142 Ga0500577_0015195 Ga0500577_0015195_1494_2237 219
7 3300053103 Ga0500555_016134 Ga0500555_016134_545_1288 221
8 3300053146 Ga0500588_0173547 Ga0500588_0173547_13_756 221
9 3300053094 Ga0500566_0078925 Ga0500566_0078925_960_1703 222
10 3300053119 Ga0500595_001208 Ga0500595_001208_3187_3930 222
11 3300031247 Ga0265340_10204420 Ga0265340_102044201 224
12 3300038443 Ga0395901_0551379 Ga0395901_0551379_343_1062 224
13 3300053096 Ga0500641_0000418 Ga0500641_0000418_8734_9435 224
14 3300009553 Ga0105249_10107315 Ga0105249_101073153 225
15 3300025961 Ga0207712_10132822 Ga0207712_101328222 225
16 3300046463 Ga0495653_0074231 Ga0495653_0074231_1799_2476 225
17 3300047322 Ga0495680_0277758 Ga0495680_0277758_40_717 225
18 3300006038 Ga0075365_10087525 Ga0075365_100875252 226
19 3300006042 Ga0075368_10062816 Ga0075368_100628162 226
20 3300027866 Ga0209813_10039629 Ga0209813_100396292 226
21 3300035691 Ga0373931_0251611 Ga0373931_0251611_119_829 226
22 3300037068 Ga0373925_0152609 Ga0373925_0152609_12_713 226
23 3300039447 Ga0436361_0302900 Ga0436361_0302900_1733_2437 226
24 3300045051 Ga0451576_0127963 Ga0451576_0127963_1599_2309 226
25 3300050489 nmdc:mga03683_90481_c1 nmdc:mga03683_90481_c1_479_1180 226
26 3300050516 nmdc:mga0sz30_4790_c1 nmdc:mga0sz30_4790_c1_1016_1717 226
27 3300005437 Ga0070710_10221957 Ga0070710_102219571 227
28 3300005467 Ga0070706_100446750 Ga0070706_1004467501 227
29 3300005471 Ga0070698_100155965 Ga0070698_1001559653 227
30 3300005518 Ga0070699_100570067 Ga0070699_1005700672 227
31 3300007788 Ga0099795_10049502 Ga0099795_100495021 227
32 3300014325 Ga0163163_10329241 Ga0163163_103292412 227
33 3300025915 Ga0207693_10416272 Ga0207693_104162722 227
34 3300025928 Ga0207700_10137589 Ga0207700_101375893 227
35 3300035117 Ga0373953_0089600 Ga0373953_0089600_216_944 227
36 3300049574 Ga0501038_0396205 Ga0501038_0396205_261_971 227
37 3300049588 Ga0501072_0095321 Ga0501072_0095321_492_1202 227
38 3300049589 Ga0501073_0457168 Ga0501073_0457168_106_816 227
39 3300049741 Ga0501079_0184530 Ga0501079_0184530_741_1451 227
40 3300060353 Ga0501082_0557460 Ga0501082_0557460_97_807 227
41 3300005439 Ga0070711_100187670 Ga0070711_1001876703 228
42 3300025915 Ga0207693_10088368 Ga0207693_100883681 228
43 iso_pu_bacteria 8054002106 8054002490 228
44 3300006175 Ga0070712_100282709 Ga0070712_1002827092 229
45 3300021358 Ga0213873_10029473 Ga0213873_100294731 229
46 3300021384 Ga0213876_10134403 Ga0213876_101344032 229
47 3300039437 Ga0436365_0614583 Ga0436365_0614583_375_1097 229
48 3300039453 Ga0436362_0907642 Ga0436362_0907642_2761_3483 229
49 3300049570 Ga0501033_0272029 Ga0501033_0272029_49_768 229
50 3300049579 Ga0501043_0189972 Ga0501043_0189972_344_1063 229
51 3300049589 Ga0501073_0025562 Ga0501073_0025562_520_1239 229
52 3300049744 Ga0501083_0009943 Ga0501083_0009943_2607_3326 229
53 3300006844 Ga0075428_100429145 Ga0075428_1004291452 230
54 3300006847 Ga0075431_100345283 Ga0075431_1003452832 230
55 3300050492 nmdc:mga0yw44_616492_c1 nmdc:mga0yw44_616492_c1_14_709 230
56 3300050510 nmdc:mga06r32_419249_c1 nmdc:mga06r32_419249_c1_153_887 230
57 3300005458 Ga0070681_10077512 Ga0070681_100775124 232
58 3300005530 Ga0070679_100066596 Ga0070679_1000665962 232
59 3300005981 Ga0081538_10017322 Ga0081538_100173225 232
60 3300009093 Ga0105240_10158073 Ga0105240_101580732 232
61 3300009987 Ga0105030_103461 Ga0105030_1034612 232
62 3300013104 Ga0157370_10031109 Ga0157370_100311096 232
63 3300025912 Ga0207707_10062688 Ga0207707_100626882 232
64 3300025913 Ga0207695_10138268 Ga0207695_101382681 232
65 3300028380 Ga0268265_10516178 Ga0268265_105161781 232
66 3300035398 Ga0316574_0005800 Ga0316574_0005800_5401_6105 232
67 3300035398 Ga0316574_0021391 Ga0316574_0021391_759_1463 232
68 3300036712 Ga0316584_0221922 Ga0316584_0221922_132_833 232
69 3300039437 Ga0436365_1280460 Ga0436365_1280460_532_1233 232
70 3300046472 Ga0495580_0186232 Ga0495580_0186232_581_1285 232
71 3300049569 Ga0501032_0061429 Ga0501032_0061429_382_1086 232
72 3300049572 Ga0501036_0085282 Ga0501036_0085282_1895_2599 232
73 3300049575 Ga0501039_0057189 Ga0501039_0057189_2241_2945 232
74 3300049576 Ga0501040_0045383 Ga0501040_0045383_357_1061 232
75 3300049578 Ga0501042_0036652 Ga0501042_0036652_1234_1938 232
76 3300049579 Ga0501043_0050266 Ga0501043_0050266_329_1033 232
77 3300049580 Ga0501046_0051026 Ga0501046_0051026_969_1673 232
78 3300049582 Ga0501048_0013230 Ga0501048_0013230_4468_5172 232
79 3300049584 Ga0501068_0054939 Ga0501068_0054939_1198_1902 232
80 3300049587 Ga0501071_0022662 Ga0501071_0022662_1029_1733 232
81 3300049588 Ga0501072_0013637 Ga0501072_0013637_2245_2949 232
82 3300049590 Ga0501074_0060829 Ga0501074_0060829_1701_2405 232
83 3300049591 Ga0501075_0038974 Ga0501075_0038974_2263_2967 232
84 3300049592 Ga0501076_0031675 Ga0501076_0031675_2210_2914 232
85 3300049593 Ga0501077_0031384 Ga0501077_0031384_717_1421 232
86 3300049741 Ga0501079_0033771 Ga0501079_0033771_1312_2016 232
87 3300049742 Ga0501080_0072578 Ga0501080_0072578_390_1094 232
88 3300049743 Ga0501081_0057266 Ga0501081_0057266_1647_2351 232
89 3300049744 Ga0501083_0073553 Ga0501083_0073553_366_1070 232
90 3300049824 Ga0501045_0053629 Ga0501045_0053629_561_1265 232
91 3300053090 Ga0500646_0036670 Ga0500646_0036670_542_1252 232
92 3300054114 Ga0501084_0017748 Ga0501084_0017748_2043_2747 232
93 3300060353 Ga0501082_0253371 Ga0501082_0253371_264_968 232
94 3300061734 Ga0530510_0027453 Ga0530510_0027453_2202_2906 232
95 3300005331 Ga0070670_100124505 Ga0070670_1001245052 233
96 3300005367 Ga0070667_100077374 Ga0070667_1000773743 233
97 3300005458 Ga0070681_10535897 Ga0070681_105358972 233
98 3300005614 Ga0068856_100130245 Ga0068856_1001302452 233
99 3300009147 Ga0114129_10224327 Ga0114129_102243274 233
100 3300009545 Ga0105237_10915333 Ga0105237_109153332 233
101 3300010375 Ga0105239_11003658 Ga0105239_110036582 233
102 3300013297 Ga0157378_10302455 Ga0157378_103024552 233
103 3300025272 Ga0209455_1000250 Ga0209455_100025050 233
104 3300025912 Ga0207707_10454976 Ga0207707_104549762 233
105 3300025912 Ga0207707_10532593 Ga0207707_105325932 233
106 3300025925 Ga0207650_10020407 Ga0207650_100204073 233
107 3300025986 Ga0207658_10162632 Ga0207658_101626322 233
108 3300026023 Ga0207677_10365379 Ga0207677_103653792 233
109 3300026095 Ga0207676_10298636 Ga0207676_102986362 233
110 3300026116 Ga0207674_10114973 Ga0207674_101149733 233
111 3300031241 Ga0265325_10050137 Ga0265325_100501373 233
112 3300031247 Ga0265340_10035988 Ga0265340_100359882 233
113 3300031249 Ga0265339_10103505 Ga0265339_101035052 233
114 3300031250 Ga0265331_10004759 Ga0265331_100047593 233
115 3300031250 Ga0265331_10094212 Ga0265331_100942122 233
116 3300031344 Ga0265316_10304301 Ga0265316_103043012 233
117 3300031595 Ga0265313_10000453 Ga0265313_1000045310 233
118 3300031711 Ga0265314_10230484 Ga0265314_102304842 233
119 3300031712 Ga0265342_10033712 Ga0265342_100337122 233
120 3300035111 Ga0373923_0178048 Ga0373923_0178048_95_805 233
121 3300035398 Ga0316574_0024027 Ga0316574_0024027_2143_2853 233
122 3300036401 Ga0373937_0626681 Ga0373937_0626681_183_893 233
123 3300036712 Ga0316584_0157396 Ga0316584_0157396_141_851 233
124 3300037471 Ga0395905_0027618 Ga0395905_0027618_914_1621 233
125 3300039110 Ga0400487_61945 Ga0400487_61945_371_1081 233
126 3300044901 Ga0466960_0013141 Ga0466960_0013141_2231_2935 233
127 3300046472 Ga0495580_0386652 Ga0495580_0386652_117_827 233
128 3300048905 Ga0496102_0035606 Ga0496102_0035606_2257_2970 233
129 3300048909 Ga0496106_0031278 Ga0496106_0031278_98_811 233
130 3300048915 Ga0496112_0121102 Ga0496112_0121102_1811_2524 233
131 3300048916 Ga0496113_0085022 Ga0496113_0085022_842_1555 233
132 3300048916 Ga0496113_0637215 Ga0496113_0637215_58_768 233
133 3300049568 Ga0501031_0057249 Ga0501031_0057249_992_1699 233
134 3300049569 Ga0501032_0001025 Ga0501032_0001025_18274_18981 233
135 3300049570 Ga0501033_0004528 Ga0501033_0004528_10367_11074 233
136 3300049571 Ga0501034_0089476 Ga0501034_0089476_1300_2007 233
137 3300049572 Ga0501036_0001419 Ga0501036_0001419_11836_12543 233
138 3300049573 Ga0501037_0003506 Ga0501037_0003506_4176_4883 233
139 3300049574 Ga0501038_0003266 Ga0501038_0003266_10466_11173 233
140 3300049575 Ga0501039_0002791 Ga0501039_0002791_4081_4788 233
141 3300049579 Ga0501043_0000339 Ga0501043_0000339_7811_8518 233
142 3300049580 Ga0501046_0000671 Ga0501046_0000671_17730_18437 233
143 3300049581 Ga0501047_0001976 Ga0501047_0001976_17380_18087 233
144 3300049583 Ga0501067_0014845 Ga0501067_0014845_1073_1780 233
145 3300049584 Ga0501068_0000979 Ga0501068_0000979_11375_12082 233
146 3300049585 Ga0501069_0000349 Ga0501069_0000349_9258_9965 233
147 3300049586 Ga0501070_0003907 Ga0501070_0003907_2426_3133 233
148 3300049589 Ga0501073_0002667 Ga0501073_0002667_10088_10795 233
149 3300049590 Ga0501074_0000220 Ga0501074_0000220_870_1577 233
150 3300049742 Ga0501080_0000471 Ga0501080_0000471_17542_18249 233
151 3300049744 Ga0501083_0000746 Ga0501083_0000746_4399_5106 233
152 3300049822 Ga0501035_0001114 Ga0501035_0001114_10339_11046 233
153 3300049823 Ga0501044_0002829 Ga0501044_0002829_8701_9408 233
154 3300050507 nmdc:mga05p37_80389_c1 nmdc:mga05p37_80389_c1_3040_3753 233
155 3300050514 nmdc:mga08x19_231225_c1 nmdc:mga08x19_231225_c1_25_738 233
156 3300053730 Ga0500645_011319 Ga0500645_011319_1907_2611 233
157 3300060353 Ga0501082_0001076 Ga0501082_0001076_9528_10235 233
158 3300003781 Ga0055536_1014864 Ga0055536_10148642 234
159 3300005329 Ga0070683_100207616 Ga0070683_1002076161 234
160 3300005338 Ga0068868_100529057 Ga0068868_1005290572 234
161 3300005367 Ga0070667_100127444 Ga0070667_1001274442 234
162 3300005435 Ga0070714_100023238 Ga0070714_1000232385 234
163 3300005435 Ga0070714_100081941 Ga0070714_1000819414 234
164 3300005435 Ga0070714_100174613 Ga0070714_1001746131 234
165 3300005436 Ga0070713_100091028 Ga0070713_1000910283 234
166 3300005437 Ga0070710_10002420 Ga0070710_100024203 234
167 3300005437 Ga0070710_10166700 Ga0070710_101667001 234
168 3300005439 Ga0070711_100007844 Ga0070711_1000078442 234
169 3300005445 Ga0070708_100220968 Ga0070708_1002209682 234
170 3300005458 Ga0070681_10078349 Ga0070681_100783492 234
171 3300005467 Ga0070706_100098800 Ga0070706_1000988002 234
172 3300005467 Ga0070706_100307772 Ga0070706_1003077722 234
173 3300005468 Ga0070707_100019235 Ga0070707_1000192354 234
174 3300005471 Ga0070698_100488537 Ga0070698_1004885371 234
175 3300005471 Ga0070698_100770342 Ga0070698_1007703422 234
176 3300005546 Ga0070696_100533464 Ga0070696_1005334641 234
177 3300005548 Ga0070665_100779701 Ga0070665_1007797011 234
178 3300005563 Ga0068855_100589619 Ga0068855_1005896192 234
179 3300005614 Ga0068856_100312110 Ga0068856_1003121102 234
180 3300005617 Ga0068859_100499099 Ga0068859_1004990991 234
181 3300005618 Ga0068864_100485322 Ga0068864_1004853221 234
182 3300005618 Ga0068864_100777235 Ga0068864_1007772352 234
183 3300005842 Ga0068858_100624927 Ga0068858_1006249272 234
184 3300006028 Ga0070717_10010512 Ga0070717_100105125 234
185 3300006028 Ga0070717_10072470 Ga0070717_100724703 234
186 3300006042 Ga0075368_10015202 Ga0075368_100152023 234
187 3300006048 Ga0075363_100191621 Ga0075363_1001916212 234
188 3300006175 Ga0070712_100013466 Ga0070712_1000134663 234
189 3300006177 Ga0075362_10023471 Ga0075362_100234712 234
190 3300006195 Ga0075366_10101579 Ga0075366_101015792 234
191 3300006846 Ga0075430_100017546 Ga0075430_1000175462 234
192 3300006846 Ga0075430_100495506 Ga0075430_1004955062 234
193 3300006847 Ga0075431_100154909 Ga0075431_1001549093 234
194 3300006880 Ga0075429_100436502 Ga0075429_1004365022 234
195 3300006931 Ga0097620_100499117 Ga0097620_1004991171 234
196 3300007788 Ga0099795_10082232 Ga0099795_100822321 234
197 3300009094 Ga0111539_10481083 Ga0111539_104810832 234
198 3300009098 Ga0105245_10248036 Ga0105245_102480362 234
199 3300009545 Ga0105237_10295192 Ga0105237_102951922 234
200 3300009553 Ga0105249_10261207 Ga0105249_102612072 234
201 3300010159 Ga0099796_10145298 Ga0099796_101452981 234
202 3300013306 Ga0163162_10093316 Ga0163162_100933161 234
203 3300021388 Ga0213875_10000933 Ga0213875_1000093310 234
204 3300021388 Ga0213875_10003818 Ga0213875_100038185 234
205 3300021388 Ga0213875_10009528 Ga0213875_100095282 234
206 3300021388 Ga0213875_10050780 Ga0213875_100507802 234
207 3300021388 Ga0213875_10105190 Ga0213875_101051901 234
208 3300025291 Ga0209675_1002185 Ga0209675_10021855 234
209 3300025292 Ga0209676_1000269 Ga0209676_100026946 234
210 3300025298 Ga0209050_1010486 Ga0209050_10104866 234
211 3300025898 Ga0207692_10014619 Ga0207692_100146194 234
212 3300025903 Ga0207680_10108814 Ga0207680_101088142 234
213 3300025910 Ga0207684_10078410 Ga0207684_100784104 234
214 3300025914 Ga0207671_10190430 Ga0207671_101904301 234
215 3300025915 Ga0207693_10001194 Ga0207693_1000119420 234
216 3300025915 Ga0207693_10150011 Ga0207693_101500113 234
217 3300025916 Ga0207663_10208662 Ga0207663_102086622 234
218 3300025922 Ga0207646_10004718 Ga0207646_100047188 234
219 3300025925 Ga0207650_10584957 Ga0207650_105849571 234
220 3300025928 Ga0207700_10087296 Ga0207700_100872963 234
221 3300025929 Ga0207664_10189519 Ga0207664_101895192 234
222 3300025929 Ga0207664_10254399 Ga0207664_102543992 234
223 3300025931 Ga0207644_10238798 Ga0207644_102387982 234
224 3300025935 Ga0207709_10611413 Ga0207709_106114131 234
225 3300025939 Ga0207665_10014121 Ga0207665_100141212 234
226 3300025942 Ga0207689_10136782 Ga0207689_101367823 234
227 3300025949 Ga0207667_10696218 Ga0207667_106962182 234
228 3300025986 Ga0207658_10058163 Ga0207658_100581634 234
229 3300026023 Ga0207677_10585220 Ga0207677_105852201 234
230 3300026095 Ga0207676_10610410 Ga0207676_106104101 234
231 3300031507 Ga0307509_10230028 Ga0307509_102300281 234
232 3300031901 Ga0307406_10231640 Ga0307406_102316402 234
233 3300031903 Ga0307407_10252116 Ga0307407_102521162 234
234 3300031995 Ga0307409_100460152 Ga0307409_1004601522 234
235 3300032002 Ga0307416_100357110 Ga0307416_1003571101 234
236 3300032002 Ga0307416_100770832 Ga0307416_1007708322 234
237 3300035692 Ga0373935_0330773 Ga0373935_0330773_96_818 234
238 3300035695 Ga0373927_0097605 Ga0373927_0097605_889_1611 234
239 3300035725 Ga0373947_0106257 Ga0373947_0106257_513_1235 234
240 3300037068 Ga0373925_0049212 Ga0373925_0049212_336_1058 234
241 3300037068 Ga0373925_0074859 Ga0373925_0074859_1818_2540 234
242 3300037068 Ga0373925_0328960 Ga0373925_0328960_226_948 234
243 3300037068 Ga0373925_0574338 Ga0373925_0574338_67_789 234
244 3300037853 Ga0436364_0169683 Ga0436364_0169683_85111_85821 234
245 3300037853 Ga0436364_0393226 Ga0436364_0393226_12883_13593 234
246 3300037853 Ga0436364_0534702 Ga0436364_0534702_107_829 234
247 3300037853 Ga0436364_0654159 Ga0436364_0654159_3390_4100 234
248 3300037853 Ga0436364_1146099 Ga0436364_1146099_3445_4155 234
249 3300037853 Ga0436364_1391815 Ga0436364_1391815_73_783 234
250 3300039438 Ga0436360_0186567 Ga0436360_0186567_1506_2351 234
251 3300039438 Ga0436360_0732647 Ga0436360_0732647_52_786 234
252 3300039438 Ga0436360_0966976 Ga0436360_0966976_256_966 234
253 3300039450 Ga0436363_0337490 Ga0436363_0337490_27_737 234
254 3300039450 Ga0436363_0810913 Ga0436363_0810913_444_1154 234
255 3300039453 Ga0436362_0302354 Ga0436362_0302354_2041_2751 234
256 3300039453 Ga0436362_1155506 Ga0436362_1155506_448_1155 234
257 3300039453 Ga0436362_1204423 Ga0436362_1204423_367_1077 234
258 3300045976 Ga0466967_0235960 Ga0466967_0235960_365_1075 234
259 3300045976 Ga0466967_0250170 Ga0466967_0250170_357_1079 234
260 3300046533 Ga0495640_0055468 Ga0495640_0055468_873_1583 234
261 3300046535 Ga0495586_0179592 Ga0495586_0179592_262_972 234
262 3300046559 Ga0495667_0016713 Ga0495667_0016713_1557_2267 234
263 3300046678 Ga0495599_0413017 Ga0495599_0413017_81_791 234
264 3300047322 Ga0495680_0151216 Ga0495680_0151216_553_1263 234
265 3300048915 Ga0496112_0336044 Ga0496112_0336044_24_746 234
266 3300048916 Ga0496113_0200721 Ga0496113_0200721_141_863 234
267 3300049587 Ga0501071_0048542 Ga0501071_0048542_1342_2049 234
268 3300049741 Ga0501079_0442586 Ga0501079_0442586_38_745 234
269 3300049742 Ga0501080_0433094 Ga0501080_0433094_365_1081 234
270 3300049744 Ga0501083_0094333 Ga0501083_0094333_784_1512 234
271 3300050493 nmdc:mga0k408_287567_c1 nmdc:mga0k408_287567_c1_228_953 234
272 3300050509 nmdc:mga0qj67_215733_c1 nmdc:mga0qj67_215733_c1_709_1431 234
273 3300050514 nmdc:mga08x19_22005_c1 nmdc:mga08x19_22005_c1_330_1052 234
274 3300053077 Ga0495601_0033068 Ga0495601_0033068_1632_2342 234
275 3300053084 Ga0495595_0012215 Ga0495595_0012215_862_1572 234
276 3300053085 Ga0495619_0023272 Ga0495619_0023272_581_1291 234
277 3300053090 Ga0500646_0021763 Ga0500646_0021763_562_1278 234
278 3300053118 Ga0500594_0031775 Ga0500594_0031775_586_1302 234
279 3300053130 Ga0500642_0009703 Ga0500642_0009703_252_965 234
280 3300053151 Ga0500604_0002385 Ga0500604_0002385_944_1660 234
281 3300060353 Ga0501082_0243089 Ga0501082_0243089_707_1435 234
282 3300060353 Ga0501082_0762183 Ga0501082_0762183_77_784 234
283 3300003215 JGI25153J46596_10000019 JGI25153J46596_1000001960 235
284 3300003791 Ga0055530_10018712 Ga0055530_100187122 235
285 3300005844 Ga0068862_100031459 Ga0068862_1000314594 235
286 3300006195 Ga0075366_10163552 Ga0075366_101635522 235
287 3300009093 Ga0105240_10348169 Ga0105240_103481692 235
288 3300025297 Ga0209758_1000028 Ga0209758_1000028261 235
289 3300025297 Ga0209758_1013444 Ga0209758_10134443 235
290 3300025298 Ga0209050_1007558 Ga0209050_10075582 235
291 3300025303 Ga0209051_1049656 Ga0209051_10496562 235
292 3300025304 Ga0209257_1000574 Ga0209257_100057450 235
293 3300028380 Ga0268265_10093043 Ga0268265_100930431 235
294 3300039093 Ga0400489_75299 Ga0400489_75299_729_1460 235
295 3300039447 Ga0436361_0228888 Ga0436361_0228888_16730_17449 235
296 3300049571 Ga0501034_0407800 Ga0501034_0407800_29_745 235
297 3300049574 Ga0501038_0140124 Ga0501038_0140124_360_1076 235
298 3300049586 Ga0501070_0003463 Ga0501070_0003463_7956_8672 235
299 3300049742 Ga0501080_0058767 Ga0501080_0058767_2296_3012 235
300 3300049822 Ga0501035_0057126 Ga0501035_0057126_2042_2758 235
301 3300049823 Ga0501044_0006665 Ga0501044_0006665_9184_9900 235
302 3300049823 Ga0501044_0180637 Ga0501044_0180637_220_936 235
303 3300050493 nmdc:mga0k408_101739_c1 nmdc:mga0k408_101739_c1_564_1274 235
304 3300053086 Ga0500578_0120951 Ga0500578_0120951_102_821 235
305 3300053096 Ga0500641_0011956 Ga0500641_0011956_1936_2652 235
306 3300053130 Ga0500642_0000211 Ga0500642_0000211_5664_6380 235
307 3300053134 Ga0500658_0048747 Ga0500658_0048747_88_804 235
308 3300053139 Ga0500568_0006454 Ga0500568_0006454_2363_3079 235
309 3300053151 Ga0500604_0004752 Ga0500604_0004752_1922_2638 235
310 3300053151 Ga0500604_0016842 Ga0500604_0016842_811_1533 235
311 3300053153 Ga0500616_0001275 Ga0500616_0001275_22882_23598 235
312 3300053731 Ga0500609_002846 Ga0500609_002846_1090_1812 235
313 3300009094 Ga0111539_10535451 Ga0111539_105354512 237
314 3300050511 nmdc:mga08y16_517676_c1 nmdc:mga08y16_517676_c1_199_945 237
315 iso_pu_bacteria 2513237166 2514048566 239
316 iso_pu_bacteria 2515154123 2515688815 239
317 iso_pu_bacteria 2519103095 2519459346 239
318 iso_pu_bacteria 2562617112 2563062510 239
319 iso_pu_bacteria 2582581311 2585294260 239
320 iso_pu_bacteria 2599185239 2599738392 239
321 iso_pu_bacteria 2599185240 2599746517 239
322 iso_pu_bacteria 2599185355 2600208423 239
323 iso_pu_bacteria 2600255067 2600813027 239
324 iso_pu_bacteria 2675903129 2676745383 239
325 iso_pu_bacteria 2711768613 2713477632 239
326 iso_pu_bacteria 2791355137 2792833783 239
327 iso_pu_bacteria 2816332253 2817261633 239
328 iso_pu_bacteria 2816332256 2817279315 239
329 iso_pu_bacteria 2816332286 2817454486 239
330 iso_pu_bacteria 2818991452 2819633481 239
331 iso_pu_bacteria 2863421361 2863425656 239
332 iso_pu_bacteria 2870068957 2870070665 239
333 iso_pu_bacteria 2904564687 2904569861 239
334 iso_pu_bacteria 2904571731 2904577119 239
335 iso_pu_bacteria 2904615490 2904619723 239
336 iso_pu_bacteria 2928157003 2928161600 239
337 iso_pu_bacteria 2928163908 2928168428 239
338 iso_pu_bacteria 2928170801 2928174845 239
339 iso_pu_bacteria 2928536128 2928542431 239
340 iso_pu_bacteria 2981990288 2981993588 239
341 iso_pu_bacteria 641736154 642419009 239
342 iso_pu_bacteria 642555112 642593829 239
343 iso_pu_bacteria 8018845410 8018850850 239
344 iso_pu_bacteria 8020807995 8020810030 239
345 iso_pu_bacteria 8020938398 8020941021 239
346 iso_pu_bacteria 8020945358 8020952382 239
347 iso_pu_bacteria 8020953355 8020958273 239
348 iso_pu_bacteria 8021120328 8021125228 239
349 iso_pu_bacteria 8039098773 8039103529 239
350 iso_pu_bacteria 8040167225 8040170376 239
351 iso_pu_bacteria 8040173305 8040175828 239
352 iso_pu_bacteria 2501025501 2501075795 240
353 iso_pu_bacteria 2501025502 2501076818 240
354 iso_pu_bacteria 2501025504 2501411296 240
355 iso_pu_bacteria 2510917013 2511089004 240
356 iso_pu_bacteria 2510917014 2511100062 240
357 iso_pu_bacteria 2510917015 2511104034 240
358 iso_pu_bacteria 2513237082 2513552672 240
359 iso_pu_bacteria 2513237083 2513565611 240
360 iso_pu_bacteria 2515154189 2516021253 240
361 iso_pu_bacteria 2883087390 2883094077 240
362 iso_pu_bacteria 8003955200 8003958698 240
363 3300025981 Ga0207640_10824464 Ga0207640_108244641 242
364 3300001989 JGI24739J22299_10016749 JGI24739J22299_100167493 243
365 3300002067 JGI24735J21928_10001950 JGI24735J21928_100019507 243
366 3300003320 rootH2_10017122 rootH2_100171222 243
367 3300003320 rootH2_10144662 rootH2_101446623 243
368 3300003323 rootH1_10067028 rootH1_100670282 243
369 3300003354 JGI25160J50197_1001398 JGI25160J50197_10013987 243
370 3300003758 Ga0055532_1000764 Ga0055532_10007646 243
371 3300003758 Ga0055532_1003316 Ga0055532_10033163 243
372 3300003758 Ga0055532_1003330 Ga0055532_10033303 243
373 3300003760 Ga0055527_1000596 Ga0055527_10005966 243
374 3300003760 Ga0055527_1003210 Ga0055527_10032103 243
375 3300003761 Ga0055535_1001464 Ga0055535_10014646 243
376 3300003761 Ga0055535_1001470 Ga0055535_10014706 243
377 3300003762 Ga0055542_1001437 Ga0055542_10014376 243
378 3300003762 Ga0055542_1001771 Ga0055542_10017714 243
379 3300003763 Ga0055529_1000378 Ga0055529_100037832 243
380 3300003763 Ga0055529_1003123 Ga0055529_10031233 243
381 3300003790 Ga0055528_1001333 Ga0055528_100133316 243
382 3300005262 Ga0065165_1001568 Ga0065165_100156818 243
383 3300005327 Ga0070658_10018941 Ga0070658_100189413 243
384 3300005327 Ga0070658_10044306 Ga0070658_100443063 243
385 3300005339 Ga0070660_100000045 Ga0070660_10000004535 243
386 3300005339 Ga0070660_100000404 Ga0070660_10000040421 243
387 3300005344 Ga0070661_100179028 Ga0070661_1001790282 243
388 3300005366 Ga0070659_100000069 Ga0070659_10000006920 243
389 3300005366 Ga0070659_100144437 Ga0070659_1001444372 243
390 3300005455 Ga0070663_100110670 Ga0070663_1001106702 243
391 3300005457 Ga0070662_100233883 Ga0070662_1002338832 243
392 3300005563 Ga0068855_100012359 Ga0068855_1000123599 243
393 3300005563 Ga0068855_100027446 Ga0068855_1000274463 243
394 3300005577 Ga0068857_100333197 Ga0068857_1003331972 243
395 3300005614 Ga0068856_100268545 Ga0068856_1002685452 243
396 3300005614 Ga0068856_100456315 Ga0068856_1004563152 243
397 3300005616 Ga0068852_100062860 Ga0068852_1000628603 243
398 3300009011 Ga0105251_10002123 Ga0105251_1000212312 243
399 3300009092 Ga0105250_10010724 Ga0105250_100107243 243
400 3300009093 Ga0105240_10006999 Ga0105240_1000699910 243
401 3300009093 Ga0105240_10009057 Ga0105240_1000905715 243
402 3300009093 Ga0105240_10060794 Ga0105240_100607943 243
403 3300009093 Ga0105240_10068460 Ga0105240_100684602 243
404 3300009093 Ga0105240_10115070 Ga0105240_101150703 243
405 3300009177 Ga0105248_10019259 Ga0105248_100192596 243
406 3300009545 Ga0105237_10015869 Ga0105237_100158695 243
407 3300009545 Ga0105237_10087138 Ga0105237_100871382 243
408 3300009545 Ga0105237_10748272 Ga0105237_107482722 243
409 3300009551 Ga0105238_10054313 Ga0105238_100543133 243
410 3300009551 Ga0105238_10235938 Ga0105238_102359381 243
411 3300009551 Ga0105238_10571829 Ga0105238_105718291 243
412 3300010375 Ga0105239_10001236 Ga0105239_100012368 243
413 3300013100 Ga0157373_10004810 Ga0157373_100048105 243
414 3300013100 Ga0157373_10228649 Ga0157373_102286492 243
415 3300013104 Ga0157370_10001406 Ga0157370_1000140614 243
416 3300013104 Ga0157370_10003087 Ga0157370_1000308716 243
417 3300013105 Ga0157369_10000915 Ga0157369_100009155 243
418 3300013105 Ga0157369_10001268 Ga0157369_1000126828 243
419 3300013105 Ga0157369_10004199 Ga0157369_100041998 243
420 3300013296 Ga0157374_10000318 Ga0157374_1000031831 243
421 3300013307 Ga0157372_10029152 Ga0157372_100291524 243
422 3300013307 Ga0157372_10149106 Ga0157372_101491062 243
423 3300013307 Ga0157372_10261283 Ga0157372_102612832 243
424 3300014497 Ga0182008_10263461 Ga0182008_102634611 243
425 3300014969 Ga0157376_10440772 Ga0157376_104407722 243
426 3300015261 Ga0182006_1032216 Ga0182006_10322162 243
427 3300015261 Ga0182006_1056763 Ga0182006_10567632 243
428 3300015262 Ga0182007_10055992 Ga0182007_100559922 243
429 3300016635 Ga0183361_10010 Ga0183361_10010141 243
430 3300020070 Ga0206356_10633488 Ga0206356_106334882 243
431 3300020082 Ga0206353_10938556 Ga0206353_109385563 243
432 3300022467 Ga0224712_10000188 Ga0224712_100001885 243
433 3300025225 Ga0209566_101237 Ga0209566_1012375 243
434 3300025228 Ga0209672_100033 Ga0209672_10003361 243
435 3300025228 Ga0209672_100114 Ga0209672_10011433 243
436 3300025228 Ga0209672_100224 Ga0209672_10022419 243
437 3300025229 Ga0209147_100161 Ga0209147_10016133 243
438 3300025229 Ga0209147_100168 Ga0209147_10016872 243
439 3300025229 Ga0209147_100199 Ga0209147_1001996 243
440 3300025242 Ga0209258_100100 Ga0209258_10010061 243
441 3300025242 Ga0209258_100263 Ga0209258_10026333 243
442 3300025254 Ga0209148_1000630 Ga0209148_100063014 243
443 3300025254 Ga0209148_1001267 Ga0209148_100126710 243
444 3300025256 Ga0209759_1002552 Ga0209759_10025529 243
445 3300025256 Ga0209759_1023340 Ga0209759_10233401 243
446 3300025263 Ga0209565_1010916 Ga0209565_10109163 243
447 3300025272 Ga0209455_1000192 Ga0209455_100019233 243
448 3300025272 Ga0209455_1002064 Ga0209455_10020646 243
449 3300025273 Ga0209673_1000332 Ga0209673_100033262 243
450 3300025284 Ga0209130_1014437 Ga0209130_10144371 243
451 3300025295 Ga0209564_1001581 Ga0209564_10015812 243
452 3300025295 Ga0209564_1004794 Ga0209564_10047942 243
453 3300025302 Ga0207426_1000168 Ga0207426_1000168137 243
454 3300025711 Ga0207696_1027943 Ga0207696_10279433 243
455 3300025735 Ga0207713_1007559 Ga0207713_10075596 243
456 3300025904 Ga0207647_10000235 Ga0207647_1000023522 243
457 3300025904 Ga0207647_10000590 Ga0207647_1000059011 243
458 3300025904 Ga0207647_10005516 Ga0207647_100055163 243
459 3300025913 Ga0207695_10004347 Ga0207695_1000434714 243
460 3300025913 Ga0207695_10036589 Ga0207695_100365894 243
461 3300025913 Ga0207695_10051646 Ga0207695_100516464 243
462 3300025913 Ga0207695_10177497 Ga0207695_101774972 243
463 3300025914 Ga0207671_10047271 Ga0207671_100472713 243
464 3300025919 Ga0207657_10000068 Ga0207657_1000006861 243
465 3300025919 Ga0207657_10001021 Ga0207657_100010215 243
466 3300025924 Ga0207694_10181790 Ga0207694_101817903 243
467 3300025932 Ga0207690_10000027 Ga0207690_1000002761 243
468 3300025932 Ga0207690_10157782 Ga0207690_101577822 243
469 3300025941 Ga0207711_10026069 Ga0207711_100260694 243
470 3300025945 Ga0207679_10176225 Ga0207679_101762251 243
471 3300025949 Ga0207667_10024533 Ga0207667_100245332 243
472 3300025949 Ga0207667_10282489 Ga0207667_102824892 243
473 3300025949 Ga0207667_10295381 Ga0207667_102953812 243
474 3300026067 Ga0207678_10000386 Ga0207678_1000038615 243
475 3300026078 Ga0207702_10234875 Ga0207702_102348752 243
476 3300026116 Ga0207674_10235164 Ga0207674_102351642 243
477 3300026142 Ga0207698_10019463 Ga0207698_100194632 243
478 3300027312 Ga0209371_1000405 Ga0209371_100040530 243
479 3300028800 Ga0265338_10000557 Ga0265338_1000055761 243
480 3300030500 Ga0268256_1000345 Ga0268256_100034519 243
481 3300031238 Ga0265332_10046725 Ga0265332_100467252 243
482 3300031247 Ga0265340_10033340 Ga0265340_100333402 243
483 3300037418 Ga0395900_0000635 Ga0395900_0000635_37193_37924 243
484 3300037418 Ga0395900_0115375 Ga0395900_0115375_381_1115 243
485 3300037418 Ga0395900_0302667 Ga0395900_0302667_92_823 243
486 3300037466 Ga0395898_0001892 Ga0395898_0001892_8355_9086 243
487 3300037466 Ga0395898_0024305 Ga0395898_0024305_5039_5770 243
488 3300037466 Ga0395898_0043167 Ga0395898_0043167_1787_2521 243
489 3300037471 Ga0395905_0000012 Ga0395905_0000012_14158_14889 243
490 3300037471 Ga0395905_0043010 Ga0395905_0043010_1895_2626 243
491 3300038443 Ga0395901_0000002 Ga0395901_0000002_704936_705667 243
492 3300038443 Ga0395901_0000079 Ga0395901_0000079_124563_125294 243
493 3300038443 Ga0395901_0062632 Ga0395901_0062632_2142_2873 243
494 3300038443 Ga0395901_0265894 Ga0395901_0265894_843_1574 243
495 3300038443 Ga0395901_0268033 Ga0395901_0268033_835_1566 243
496 3300039447 Ga0436361_0723959 Ga0436361_0723959_3462_4193 243
497 3300042005 Ga0439448_0001158 Ga0439448_0001158_3938_4672 243
498 3300044656 Ga0466969_0018240 Ga0466969_0018240_2374_3108 243
499 3300044656 Ga0466969_0024770 Ga0466969_0024770_780_1511 243
500 3300044658 Ga0466972_0103974 Ga0466972_0103974_460_1191 243
501 3300044659 Ga0466973_0042623 Ga0466973_0042623_3262_3993 243
502 3300044683 Ga0466965_0000552 Ga0466965_0000552_1887_2618 243
503 3300044683 Ga0466965_0018142 Ga0466965_0018142_846_1577 243
504 3300044683 Ga0466965_0126631 Ga0466965_0126631_460_1194 243
505 3300044684 Ga0466966_0003017 Ga0466966_0003017_6722_7453 243
506 3300044684 Ga0466966_0005413 Ga0466966_0005413_1246_1977 243
507 3300044684 Ga0466966_0026815 Ga0466966_0026815_499_1233 243
508 3300044684 Ga0466966_0057976 Ga0466966_0057976_204_935 243
509 3300044693 Ga0466961_0004320 Ga0466961_0004320_5718_6452 243
510 3300044693 Ga0466961_0005705 Ga0466961_0005705_4430_5161 243
511 3300044694 Ga0466963_0000989 Ga0466963_0000989_3034_3765 243
512 3300044694 Ga0466963_0001909 Ga0466963_0001909_1877_2608 243
513 3300044719 Ga0466971_0005454 Ga0466971_0005454_981_1712 243
514 3300044765 Ga0466970_0035633 Ga0466970_0035633_1683_2414 243
515 3300044765 Ga0466970_0077386 Ga0466970_0077386_847_1578 243
516 3300044842 Ga0466957_0000377 Ga0466957_0000377_13282_14013 243
517 3300045049 Ga0466959_0001316 Ga0466959_0001316_5488_6222 243
518 3300045836 Ga0466958_0003652 Ga0466958_0003652_6718_7449 243
519 3300046454 Ga0495592_0277003 Ga0495592_0277003_197_928 243
520 3300046455 Ga0495603_0000924 Ga0495603_0000924_10138_10869 243
521 3300046455 Ga0495603_0017279 Ga0495603_0017279_965_1696 243
522 3300046457 Ga0495590_0000706 Ga0495590_0000706_9244_9975 243
523 3300046457 Ga0495590_0045035 Ga0495590_0045035_432_1163 243
524 3300046459 Ga0495629_0000774 Ga0495629_0000774_13880_14611 243
525 3300046463 Ga0495653_0041438 Ga0495653_0041438_2115_2846 243
526 3300046471 Ga0495650_0002070 Ga0495650_0002070_13967_14698 243
527 3300046471 Ga0495650_0094711 Ga0495650_0094711_307_1038 243
528 3300046472 Ga0495580_0008325 Ga0495580_0008325_5081_5812 243
529 3300046472 Ga0495580_0013673 Ga0495580_0013673_3746_4477 243
530 3300046472 Ga0495580_0285682 Ga0495580_0285682_294_1025 243
531 3300046476 Ga0495662_0036471 Ga0495662_0036471_1131_1862 243
532 3300046477 Ga0495664_0002778 Ga0495664_0002778_8487_9218 243
533 3300046491 Ga0495584_0025551 Ga0495584_0025551_1269_2012 243
534 3300046492 Ga0495585_0129372 Ga0495585_0129372_564_1295 243
535 3300046507 Ga0495606_0002948 Ga0495606_0002948_9298_10029 243
536 3300046507 Ga0495606_0036166 Ga0495606_0036166_1364_2155 243
537 3300046507 Ga0495606_0053361 Ga0495606_0053361_234_977 243
538 3300046507 Ga0495606_0135743 Ga0495606_0135743_145_876 243
539 3300046516 Ga0495628_0320477 Ga0495628_0320477_143_874 243
540 3300046524 Ga0495648_0055509 Ga0495648_0055509_879_1610 243
541 3300046528 Ga0495642_0144202 Ga0495642_0144202_261_992 243
542 3300046529 Ga0495652_0071993 Ga0495652_0071993_904_1635 243
543 3300046530 Ga0495654_0018564 Ga0495654_0018564_414_1145 243
544 3300046531 Ga0495665_0010913 Ga0495665_0010913_2808_3539 243
545 3300046531 Ga0495665_0022130 Ga0495665_0022130_751_1482 243
546 3300046535 Ga0495586_0098491 Ga0495586_0098491_663_1394 243
547 3300046542 Ga0495597_0004104 Ga0495597_0004104_2846_3589 243
548 3300046543 Ga0495645_0007762 Ga0495645_0007762_2643_3374 243
549 3300046543 Ga0495645_0058610 Ga0495645_0058610_1404_2135 243
550 3300046648 Ga0495611_0031701 Ga0495611_0031701_178_909 243
551 3300046674 Ga0495588_0014205 Ga0495588_0014205_1360_2091 243
552 3300046680 Ga0495646_0115462 Ga0495646_0115462_246_977 243
553 3300046684 Ga0495669_0020892 Ga0495669_0020892_836_1627 243
554 3300046684 Ga0495669_0109982 Ga0495669_0109982_259_990 243
555 3300046692 Ga0495671_0018661 Ga0495671_0018661_1395_2126 243
556 3300046694 Ga0495649_0008350 Ga0495649_0008350_3394_4185 243
557 3300046794 Ga0495589_0029786 Ga0495589_0029786_1376_2167 243
558 3300046794 Ga0495589_0052667 Ga0495589_0052667_1138_1869 243
559 3300046794 Ga0495589_0096473 Ga0495589_0096473_683_1414 243
560 3300046809 Ga0495600_0054630 Ga0495600_0054630_1443_2174 243
561 3300047315 Ga0495581_0001974 Ga0495581_0001974_9818_10549 243
562 3300047317 Ga0495604_0086967 Ga0495604_0086967_920_1651 243
563 3300047319 Ga0495674_0008236 Ga0495674_0008236_6554_7285 243
564 3300047319 Ga0495674_0013834 Ga0495674_0013834_4565_5296 243
565 3300047319 Ga0495674_0163930 Ga0495674_0163930_548_1279 243
566 3300047323 Ga0495683_0002040 Ga0495683_0002040_9810_10553 243
567 3300047323 Ga0495683_0012429 Ga0495683_0012429_1426_2217 243
568 3300047323 Ga0495683_0034712 Ga0495683_0034712_1796_2527 243
569 3300047443 Ga0495687_000025 Ga0495687_000025_95061_95792 243
570 3300047444 Ga0495675_0042986 Ga0495675_0042986_628_1359 243
571 3300047673 Ga0495593_0025150 Ga0495593_0025150_35_766 243
572 3300048088 Ga0495602_0011140 Ga0495602_0011140_6294_7025 243
573 3300048088 Ga0495602_0064861 Ga0495602_0064861_1213_1944 243
574 3300048089 Ga0495614_0018957 Ga0495614_0018957_1370_2101 243
575 3300048091 Ga0495626_0122937 Ga0495626_0122937_48_791 243
576 3300048903 Ga0496100_0000791 Ga0496100_0000791_5073_5804 243
577 3300048903 Ga0496100_0090560 Ga0496100_0090560_244_975 243
578 3300048903 Ga0496100_0517583 Ga0496100_0517583_118_849 243
579 3300048904 Ga0496101_0002729 Ga0496101_0002729_3999_4742 243
580 3300048904 Ga0496101_0005842 Ga0496101_0005842_3159_3890 243
581 3300048904 Ga0496101_0134029 Ga0496101_0134029_710_1441 243
582 3300048904 Ga0496101_0308613 Ga0496101_0308613_61_792 243
583 3300048905 Ga0496102_0008235 Ga0496102_0008235_5026_5757 243
584 3300048905 Ga0496102_0148342 Ga0496102_0148342_457_1200 243
585 3300048906 Ga0496103_0002256 Ga0496103_0002256_3569_4300 243
586 3300048906 Ga0496103_0004743 Ga0496103_0004743_5168_5911 243
587 3300048907 Ga0496104_0050043 Ga0496104_0050043_2358_3089 243
588 3300048907 Ga0496104_0379973 Ga0496104_0379973_248_979 243
589 3300048908 Ga0496105_0040038 Ga0496105_0040038_3119_3850 243
590 3300048908 Ga0496105_0187294 Ga0496105_0187294_373_1116 243
591 3300048908 Ga0496105_0396969 Ga0496105_0396969_21_752 243
592 3300048909 Ga0496106_0000053 Ga0496106_0000053_17439_18170 243
593 3300048909 Ga0496106_0043788 Ga0496106_0043788_1881_2624 243
594 3300048909 Ga0496106_0074774 Ga0496106_0074774_849_1580 243
595 3300048910 Ga0496107_0015100 Ga0496107_0015100_1160_1903 243
596 3300048910 Ga0496107_0120339 Ga0496107_0120339_224_955 243
597 3300048912 Ga0496109_0268345 Ga0496109_0268345_692_1435 243
598 3300048913 Ga0496110_0006687 Ga0496110_0006687_5864_6607 243
599 3300048913 Ga0496110_0370856 Ga0496110_0370856_182_913 243
600 3300048914 Ga0496111_0008603 Ga0496111_0008603_3279_4022 243
601 3300048914 Ga0496111_0247274 Ga0496111_0247274_197_928 243
602 3300048915 Ga0496112_0011544 Ga0496112_0011544_5074_5805 243
603 3300048915 Ga0496112_0025678 Ga0496112_0025678_3904_4647 243
604 3300048916 Ga0496113_0024627 Ga0496113_0024627_484_1215 243
605 3300048916 Ga0496113_0505574 Ga0496113_0505574_114_845 243
606 3300048917 Ga0496114_0001299 Ga0496114_0001299_4100_4831 243
607 3300048918 Ga0496115_0025883 Ga0496115_0025883_1555_2286 243
608 3300048918 Ga0496115_0047431 Ga0496115_0047431_1353_2084 243
609 3300048919 Ga0496116_0020686 Ga0496116_0020686_2356_3099 243
610 3300048919 Ga0496116_0050663 Ga0496116_0050663_1590_2321 243
611 3300048919 Ga0496116_0085578 Ga0496116_0085578_774_1613 243
612 3300048919 Ga0496116_0237236 Ga0496116_0237236_19_750 243
613 3300048920 Ga0496117_0002599 Ga0496117_0002599_18550_19281 243
614 3300048920 Ga0496117_0078535 Ga0496117_0078535_586_1329 243
615 3300048921 Ga0496118_0011356 Ga0496118_0011356_3041_3772 243
616 3300048922 Ga0496119_0119083 Ga0496119_0119083_275_1006 243
617 3300048923 Ga0496120_0194029 Ga0496120_0194029_206_937 243
618 3300048924 Ga0496121_0000585 Ga0496121_0000585_49391_50122 243
619 3300048924 Ga0496121_0003743 Ga0496121_0003743_6635_7366 243
620 3300048924 Ga0496121_0009234 Ga0496121_0009234_3666_4409 243
621 3300048924 Ga0496121_0016230 Ga0496121_0016230_4815_5546 243
622 3300048924 Ga0496121_0215272 Ga0496121_0215272_169_900 243
623 3300048924 Ga0496121_0221336 Ga0496121_0221336_544_1275 243
624 3300048926 Ga0496123_0012440 Ga0496123_0012440_5934_6677 243
625 3300048928 Ga0496125_0012344 Ga0496125_0012344_3900_4643 243
626 3300048929 Ga0496126_0006736 Ga0496126_0006736_7585_8316 243
627 3300048929 Ga0496126_0125160 Ga0496126_0125160_1262_1993 243
628 3300048929 Ga0496126_0249978 Ga0496126_0249978_116_847 243
629 3300061719 Ga0466962_0008250 Ga0466962_0008250_3742_4473 243
630 3300061719 Ga0466962_0010777 Ga0466962_0010777_3300_4031 243
631 iso_pu_bacteria 2856287931 2856294010 243
632 iso_pu_bacteria 2857357740 2857362553 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

233

276

0.94

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

43

140

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1b-assembly1.cif.gz_A crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii 0.906 2 243
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.8941 1 243
2zze-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form 0.8906 1 243
2e1b-assembly1.cif.gz_A crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii 0.8898 2 243
2zzg-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.8866 1 243
ID Description Score Start End Superfamily
af_Q57984_485_578_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9227 1 100 2.40.30.130
2ztgA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9071 1 100 2.40.30.130
2zzeB03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8961 1 98 2.40.30.130
af_P40825_614_789_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8879 101 243 3.30.980.10
2e1bA02 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8717 101 243 3.30.980.10
ID Description Score Start End GO Terms
AF-A0A2Z6TGN1-F1-model_v4 deleted 0.9925 1 243
AF-A0A3N8LL89-F1-model_v4 Alanyl-tRNA editing protein 0.9868 1 243 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A3N8LL89-F1-model_v4 Alanyl-tRNA editing protein 0.9828 1 243 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A2A5W6S6-F1-model_v4 Threonyl/alanyl tRNA synthetase SAD domain-containing protein 0.975 109 243 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872
AF-A0A084Y4U1-F1-model_v4 Alanine--tRNA ligase (EC 6.1.1.7) 0.9748 2 243 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map