F471014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 632 | 387 | 581 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0186567|Ga0436360_0186567_1506_2351 |
| Length | 281 |
| Sequence | MDGIDLDRQTAPQSWTAPQSDAVAWPHLLHRWLAGGTRVPGGAMTATTELFRDDAYLQDCSATVTAVDAAGIRLDRTVFYPMGGGQPGDSGVLRRADGREIAIADTRKGEAAGEIVHVPAAPIDDLKPGETVTAAIDWTRRYRHMRMHSCLHLLCAAVPAGVTGGSIGDGKGRLDFDAGDTVLDKAAIEEKLNALVAQNLAVTSRWIDDAEMAARPELVRTMSVKPPSGQGRVRLMEVAGTDLQPCGGTHVRATGEIGAVRVDKIESKGKRNRRVSLSLVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 8 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 9 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 10 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 13 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 14 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 15 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 16 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 17 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 18 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 19 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 20 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 21 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 22 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 23 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 24 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 25 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 26 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 27 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 28 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 29 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 30 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 31 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 32 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 33 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 34 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 35 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 36 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 37 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 38 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 39 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 40 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 41 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 44 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 45 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 220 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 356 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 357 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 359 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 367 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 375 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 376 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 377 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 378 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 379 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 380 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 381 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 382 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 383 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 384 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 385 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 386 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 387 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.46 |
| Metatranscriptomes | 0.47 |
| Isolates | 8.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.82 |
| Nodule | 1.11 |
| Rhizoplane | 6.96 |
| Rhizosphere | 68.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10016749 | 3300001989 | Bacteria | 2650 |
| 2 | JGI24735J21928_10001950 | 3300002067 | Bacteria | 7250 |
| 3 | JGI25153J46596_10000019 | 3300003215 | Bacteria | 260291 |
| 4 | rootH2_10017122 | 3300003320 | Bacteria | 6354 |
| 5 | rootH2_10144662 | 3300003320 | Bacteria | 2391 |
| 6 | rootH1_10067028 | 3300003323 | Bacteria | 1580 |
| 7 | JGI25160J50197_1001398 | 3300003354 | Bacteria | 12123 |
| 8 | Ga0055532_1000764 | 3300003758 | Bacteria | 11446 |
| 9 | Ga0055532_1003316 | 3300003758 | Bacteria | 2820 |
| 10 | Ga0055532_1003330 | 3300003758 | Bacteria | 2807 |
| 11 | Ga0055527_1000596 | 3300003760 | Bacteria | 11671 |
| 12 | Ga0055527_1003210 | 3300003760 | Bacteria | 2493 |
| 13 | Ga0055535_1001464 | 3300003761 | Bacteria | 11882 |
| 14 | Ga0055535_1001470 | 3300003761 | Bacteria | 11866 |
| 15 | Ga0055542_1001437 | 3300003762 | Bacteria | 11882 |
| 16 | Ga0055542_1001771 | 3300003762 | Bacteria | 9063 |
| 17 | Ga0055529_1000378 | 3300003763 | Bacteria | 48131 |
| 18 | Ga0055529_1003123 | 3300003763 | Bacteria | 2868 |
| 19 | Ga0055536_1014864 | 3300003781 | Bacteria | 2701 |
| 20 | Ga0055528_1001333 | 3300003790 | Bacteria | 15358 |
| 21 | Ga0055530_10018712 | 3300003791 | Bacteria | 2125 |
| 22 | Ga0065165_1001568 | 3300005262 | Bacteria | 23601 |
| 23 | Ga0070658_10018941 | 3300005327 | Bacteria | 5514 |
| 24 | Ga0070658_10044306 | 3300005327 | Bacteria | 3596 |
| 25 | Ga0070683_100207616 | 3300005329 | Bacteria | 1860 |
| 26 | Ga0070670_100124505 | 3300005331 | Bacteria | 2225 |
| 27 | Ga0068868_100529057 | 3300005338 | Bacteria | 1036 |
| 28 | Ga0070660_100000045 | 3300005339 | Bacteria | 70908 |
| 29 | Ga0070660_100000404 | 3300005339 | Bacteria | 28766 |
| 30 | Ga0070661_100179028 | 3300005344 | Bacteria | 1612 |
| 31 | Ga0070659_100000069 | 3300005366 | Bacteria | 81078 |
| 32 | Ga0070659_100144437 | 3300005366 | Bacteria | 1938 |
| 33 | Ga0070667_100077374 | 3300005367 | Bacteria | 2841 |
| 34 | Ga0070667_100127444 | 3300005367 | Bacteria | 2219 |
| 35 | Ga0070714_100023238 | 3300005435 | Bacteria | 5090 |
| 36 | Ga0070714_100081941 | 3300005435 | Bacteria | 2810 |
| 37 | Ga0070714_100174613 | 3300005435 | Bacteria | 1952 |
| 38 | Ga0070713_100091028 | 3300005436 | Bacteria | 2623 |
| 39 | Ga0070710_10002420 | 3300005437 | Bacteria | 8849 |
| 40 | Ga0070710_10166700 | 3300005437 | Bacteria | 1370 |
| 41 | Ga0070710_10221957 | 3300005437 | Bacteria | 1203 |
| 42 | Ga0070711_100007844 | 3300005439 | Bacteria | 6506 |
| 43 | Ga0070711_100187670 | 3300005439 | Bacteria | 1586 |
| 44 | Ga0070708_100220968 | 3300005445 | Bacteria | 1777 |
| 45 | Ga0070663_100110670 | 3300005455 | Bacteria | 2063 |
| 46 | Ga0070662_100233883 | 3300005457 | Bacteria | 1471 |
| 47 | Ga0070681_10077512 | 3300005458 | Bacteria | 3281 |
| 48 | Ga0070681_10078349 | 3300005458 | Bacteria | 3261 |
| 49 | Ga0070681_10535897 | 3300005458 | Bacteria | 1084 |
| 50 | Ga0070706_100098800 | 3300005467 | Bacteria | 2712 |
| 51 | Ga0070706_100307772 | 3300005467 | Bacteria | 1478 |
| 52 | Ga0070706_100446750 | 3300005467 | Bacteria | 1203 |
| 53 | Ga0070707_100019235 | 3300005468 | Bacteria | 6433 |
| 54 | Ga0070698_100155965 | 3300005471 | Bacteria | 2229 |
| 55 | Ga0070698_100488537 | 3300005471 | Bacteria | 1168 |
| 56 | Ga0070698_100770342 | 3300005471 | Bacteria | 906 |
| 57 | Ga0070699_100570067 | 3300005518 | Bacteria | 1031 |
| 58 | Ga0070679_100066596 | 3300005530 | Bacteria | 3590 |
| 59 | Ga0068853_100022323 | 3300005539 | Bacteria | 5285 |
| 60 | Ga0070696_100533464 | 3300005546 | Bacteria | 938 |
| 61 | Ga0070665_100779701 | 3300005548 | Bacteria | 969 |
| 62 | Ga0068855_100012359 | 3300005563 | Bacteria | 10313 |
| 63 | Ga0068855_100027446 | 3300005563 | Bacteria | 6810 |
| 64 | Ga0068855_100589619 | 3300005563 | Bacteria | 1200 |
| 65 | Ga0068857_100333197 | 3300005577 | Bacteria | 1403 |
| 66 | Ga0068856_100130245 | 3300005614 | Bacteria | 2520 |
| 67 | Ga0068856_100268545 | 3300005614 | Bacteria | 1722 |
| 68 | Ga0068856_100312110 | 3300005614 | Bacteria | 1590 |
| 69 | Ga0068856_100456315 | 3300005614 | Bacteria | 1299 |
| 70 | Ga0068852_100062860 | 3300005616 | Bacteria | 3230 |
| 71 | Ga0068859_100499099 | 3300005617 | Bacteria | 1312 |
| 72 | Ga0068864_100485322 | 3300005618 | Bacteria | 1187 |
| 73 | Ga0068864_100777235 | 3300005618 | Bacteria | 940 |
| 74 | Ga0068858_100624927 | 3300005842 | Bacteria | 1046 |
| 75 | Ga0068862_100031459 | 3300005844 | Bacteria | 4480 |
| 76 | Ga0081538_10017322 | 3300005981 | Bacteria | 5474 |
| 77 | Ga0070717_10010512 | 3300006028 | Bacteria | 6992 |
| 78 | Ga0070717_10072470 | 3300006028 | Bacteria | 2876 |
| 79 | Ga0075365_10087525 | 3300006038 | Bacteria | 2118 |
| 80 | Ga0075368_10015202 | 3300006042 | Bacteria | 2851 |
| 81 | Ga0075368_10062816 | 3300006042 | Bacteria | 1489 |
| 82 | Ga0075363_100191621 | 3300006048 | Bacteria | 1166 |
| 83 | Ga0070712_100013466 | 3300006175 | Bacteria | 5227 |
| 84 | Ga0070712_100282709 | 3300006175 | Bacteria | 1337 |
| 85 | Ga0075362_10023471 | 3300006177 | Bacteria | 2609 |
| 86 | Ga0075366_10101579 | 3300006195 | Bacteria | 1726 |
| 87 | Ga0075366_10163552 | 3300006195 | Bacteria | 1349 |
| 88 | Ga0075428_100429145 | 3300006844 | Bacteria | 1416 |
| 89 | Ga0075430_100017546 | 3300006846 | Bacteria | 6097 |
| 90 | Ga0075430_100495506 | 3300006846 | Bacteria | 1008 |
| 91 | Ga0075431_100154909 | 3300006847 | Bacteria | 2358 |
| 92 | Ga0075431_100345283 | 3300006847 | Bacteria | 1497 |
| 93 | Ga0075429_100436502 | 3300006880 | Unclassified | 1147 |
| 94 | Ga0097620_100499117 | 3300006931 | Bacteria | 1312 |
| 95 | Ga0099795_10049502 | 3300007788 | Bacteria | 1525 |
| 96 | Ga0099795_10082232 | 3300007788 | Bacteria | 1234 |
| 97 | Ga0105251_10002123 | 3300009011 | Bacteria | 15936 |
| 98 | Ga0105250_10010724 | 3300009092 | Bacteria | 3813 |
| 99 | Ga0105240_10006999 | 3300009093 | Bacteria | 16468 |
| 100 | Ga0105240_10009057 | 3300009093 | Bacteria | 14131 |
| 101 | Ga0105240_10060794 | 3300009093 | Bacteria | 4709 |
| 102 | Ga0105240_10068460 | 3300009093 | Bacteria | 4396 |
| 103 | Ga0105240_10115070 | 3300009093 | Bacteria | 3248 |
| 104 | Ga0105240_10158073 | 3300009093 | Bacteria | 2694 |
| 105 | Ga0105240_10348169 | 3300009093 | Bacteria | 1681 |
| 106 | Ga0111539_10481083 | 3300009094 | Bacteria | 1446 |
| 107 | Ga0111539_10535451 | 3300009094 | Bacteria | 1364 |
| 108 | Ga0105245_10248036 | 3300009098 | Bacteria | 1729 |
| 109 | Ga0114129_10224327 | 3300009147 | Bacteria | 2533 |
| 110 | Ga0105248_10019259 | 3300009177 | Bacteria | 7552 |
| 111 | Ga0105237_10015869 | 3300009545 | Bacteria | 7832 |
| 112 | Ga0105237_10087138 | 3300009545 | Bacteria | 3112 |
| 113 | Ga0105237_10295192 | 3300009545 | Bacteria | 1624 |
| 114 | Ga0105237_10748272 | 3300009545 | Bacteria | 984 |
| 115 | Ga0105237_10915333 | 3300009545 | Bacteria | 884 |
| 116 | Ga0105238_10054313 | 3300009551 | Bacteria | 4023 |
| 117 | Ga0105238_10235938 | 3300009551 | Bacteria | 1806 |
| 118 | Ga0105238_10571829 | 3300009551 | Bacteria | 1136 |
| 119 | Ga0105249_10107315 | 3300009553 | Bacteria | 2635 |
| 120 | Ga0105249_10261207 | 3300009553 | Bacteria | 1721 |
| 121 | Ga0105030_103461 | 3300009987 | Bacteria | 1360 |
| 122 | Ga0099796_10145298 | 3300010159 | Bacteria | 930 |
| 123 | Ga0105239_10001236 | 3300010375 | Bacteria | 34816 |
| 124 | Ga0105239_11003658 | 3300010375 | Bacteria | 960 |
| 125 | Ga0157373_10004810 | 3300013100 | Bacteria | 10160 |
| 126 | Ga0157373_10228649 | 3300013100 | Bacteria | 1313 |
| 127 | Ga0157370_10001406 | 3300013104 | Bacteria | 29865 |
| 128 | Ga0157370_10003087 | 3300013104 | Bacteria | 19723 |
| 129 | Ga0157370_10031109 | 3300013104 | Bacteria | 5224 |
| 130 | Ga0157369_10000915 | 3300013105 | Bacteria | 37650 |
| 131 | Ga0157369_10001268 | 3300013105 | Bacteria | 31342 |
| 132 | Ga0157369_10004199 | 3300013105 | Bacteria | 17053 |
| 133 | Ga0157374_10000318 | 3300013296 | Bacteria | 44740 |
| 134 | Ga0157378_10302455 | 3300013297 | Bacteria | 1548 |
| 135 | Ga0163162_10093316 | 3300013306 | Bacteria | 3095 |
| 136 | Ga0157372_10029152 | 3300013307 | Bacteria | 6024 |
| 137 | Ga0157372_10149106 | 3300013307 | Bacteria | 2698 |
| 138 | Ga0157372_10261283 | 3300013307 | Bacteria | 2010 |
| 139 | Ga0163163_10329241 | 3300014325 | Bacteria | 1582 |
| 140 | Ga0182008_10263461 | 3300014497 | Bacteria | 892 |
| 141 | Ga0157376_10440772 | 3300014969 | Bacteria | 1268 |
| 142 | Ga0182006_1032216 | 3300015261 | Bacteria | 2108 |
| 143 | Ga0182006_1056763 | 3300015261 | Bacteria | 1490 |
| 144 | Ga0182007_10055992 | 3300015262 | Bacteria | 1296 |
| 145 | Ga0183361_10010 | 3300016635 | Bacteria | 204902 |
| 146 | Ga0206356_10633488 | 3300020070 | Bacteria | 2413 |
| 147 | Ga0206353_10938556 | 3300020082 | Bacteria | 2393 |
| 148 | Ga0213873_10029473 | 3300021358 | Bacteria | 1353 |
| 149 | Ga0213876_10134403 | 3300021384 | Bacteria | 1315 |
| 150 | Ga0213875_10000933 | 3300021388 | Bacteria | 21085 |
| 151 | Ga0213875_10003818 | 3300021388 | Bacteria | 8469 |
| 152 | Ga0213875_10009528 | 3300021388 | Bacteria | 4917 |
| 153 | Ga0213875_10050780 | 3300021388 | Bacteria | 1943 |
| 154 | Ga0213875_10105190 | 3300021388 | Bacteria | 1318 |
| 155 | Ga0224712_10000188 | 3300022467 | Bacteria | 10883 |
| 156 | Ga0209566_101237 | 3300025225 | Bacteria | 8796 |
| 157 | Ga0209672_100033 | 3300025228 | Bacteria | 315326 |
| 158 | Ga0209672_100114 | 3300025228 | Bacteria | 90538 |
| 159 | Ga0209672_100224 | 3300025228 | Bacteria | 43765 |
| 160 | Ga0209147_100161 | 3300025229 | Bacteria | 90627 |
| 161 | Ga0209147_100168 | 3300025229 | Bacteria | 89085 |
| 162 | Ga0209147_100199 | 3300025229 | Bacteria | 67646 |
| 163 | Ga0209258_100100 | 3300025242 | Bacteria | 214027 |
| 164 | Ga0209258_100263 | 3300025242 | Bacteria | 90453 |
| 165 | Ga0209148_1000630 | 3300025254 | Bacteria | 31045 |
| 166 | Ga0209148_1001267 | 3300025254 | Bacteria | 13898 |
| 167 | Ga0209759_1002552 | 3300025256 | Bacteria | 7901 |
| 168 | Ga0209759_1023340 | 3300025256 | Bacteria | 1363 |
| 169 | Ga0209565_1010916 | 3300025263 | Bacteria | 2236 |
| 170 | Ga0209455_1000192 | 3300025272 | Bacteria | 90553 |
| 171 | Ga0209455_1000250 | 3300025272 | Bacteria | 64478 |
| 172 | Ga0209455_1002064 | 3300025272 | Bacteria | 8114 |
| 173 | Ga0209673_1000332 | 3300025273 | Bacteria | 86973 |
| 174 | Ga0209130_1014437 | 3300025284 | Bacteria | 1982 |
| 175 | Ga0209675_1002185 | 3300025291 | Bacteria | 10259 |
| 176 | Ga0209676_1000269 | 3300025292 | Bacteria | 108375 |
| 177 | Ga0209564_1001581 | 3300025295 | Bacteria | 22255 |
| 178 | Ga0209564_1004794 | 3300025295 | Bacteria | 8062 |
| 179 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 180 | Ga0209758_1013444 | 3300025297 | Bacteria | 4461 |
| 181 | Ga0209050_1007558 | 3300025298 | Bacteria | 6053 |
| 182 | Ga0209050_1010486 | 3300025298 | Bacteria | 4558 |
| 183 | Ga0207426_1000168 | 3300025302 | Bacteria | 165214 |
| 184 | Ga0209051_1049656 | 3300025303 | Bacteria | 1411 |
| 185 | Ga0209257_1000574 | 3300025304 | Bacteria | 61789 |
| 186 | Ga0207696_1027943 | 3300025711 | Bacteria | 1735 |
| 187 | Ga0207713_1007559 | 3300025735 | Bacteria | 6386 |
| 188 | Ga0207692_10014619 | 3300025898 | Bacteria | 3433 |
| 189 | Ga0207680_10108814 | 3300025903 | Bacteria | 1794 |
| 190 | Ga0207647_10000235 | 3300025904 | Bacteria | 45337 |
| 191 | Ga0207647_10000590 | 3300025904 | Bacteria | 28264 |
| 192 | Ga0207647_10005516 | 3300025904 | Bacteria | 9265 |
| 193 | Ga0207684_10078410 | 3300025910 | Bacteria | 2809 |
| 194 | Ga0207707_10062688 | 3300025912 | Bacteria | 3235 |
| 195 | Ga0207707_10454976 | 3300025912 | Bacteria | 1095 |
| 196 | Ga0207707_10532593 | 3300025912 | Bacteria | 999 |
| 197 | Ga0207695_10004347 | 3300025913 | Bacteria | 19403 |
| 198 | Ga0207695_10036589 | 3300025913 | Bacteria | 5306 |
| 199 | Ga0207695_10051646 | 3300025913 | Bacteria | 4314 |
| 200 | Ga0207695_10138268 | 3300025913 | Bacteria | 2387 |
| 201 | Ga0207695_10177497 | 3300025913 | Bacteria | 2052 |
| 202 | Ga0207671_10047271 | 3300025914 | Bacteria | 3185 |
| 203 | Ga0207671_10190430 | 3300025914 | Bacteria | 1599 |
| 204 | Ga0207693_10001194 | 3300025915 | Bacteria | 23199 |
| 205 | Ga0207693_10088368 | 3300025915 | Bacteria | 2429 |
| 206 | Ga0207693_10150011 | 3300025915 | Bacteria | 1833 |
| 207 | Ga0207693_10416272 | 3300025915 | Bacteria | 1050 |
| 208 | Ga0207663_10208662 | 3300025916 | Bacteria | 1414 |
| 209 | Ga0207657_10000068 | 3300025919 | Bacteria | 96575 |
| 210 | Ga0207657_10001021 | 3300025919 | Bacteria | 29707 |
| 211 | Ga0207646_10004718 | 3300025922 | Bacteria | 14684 |
| 212 | Ga0207694_10181790 | 3300025924 | Bacteria | 1705 |
| 213 | Ga0207650_10020407 | 3300025925 | Bacteria | 4673 |
| 214 | Ga0207650_10584957 | 3300025925 | Bacteria | 938 |
| 215 | Ga0207700_10087296 | 3300025928 | Bacteria | 2453 |
| 216 | Ga0207700_10137589 | 3300025928 | Bacteria | 2003 |
| 217 | Ga0207664_10189519 | 3300025929 | Bacteria | 1769 |
| 218 | Ga0207664_10254399 | 3300025929 | Bacteria | 1534 |
| 219 | Ga0207644_10238798 | 3300025931 | Bacteria | 1446 |
| 220 | Ga0207690_10000027 | 3300025932 | Bacteria | 162225 |
| 221 | Ga0207690_10157782 | 3300025932 | Bacteria | 1688 |
| 222 | Ga0207709_10611413 | 3300025935 | Bacteria | 864 |
| 223 | Ga0207665_10014121 | 3300025939 | Bacteria | 5253 |
| 224 | Ga0207711_10026069 | 3300025941 | Bacteria | 4903 |
| 225 | Ga0207689_10136782 | 3300025942 | Bacteria | 2018 |
| 226 | Ga0207679_10176225 | 3300025945 | Bacteria | 1765 |
| 227 | Ga0207667_10024533 | 3300025949 | Bacteria | 6619 |
| 228 | Ga0207667_10282489 | 3300025949 | Bacteria | 1696 |
| 229 | Ga0207667_10295381 | 3300025949 | Bacteria | 1655 |
| 230 | Ga0207667_10696218 | 3300025949 | Bacteria | 1019 |
| 231 | Ga0207712_10132822 | 3300025961 | Bacteria | 1899 |
| 232 | Ga0207640_10824464 | 3300025981 | Bacteria | 805 |
| 233 | Ga0207658_10058163 | 3300025986 | Bacteria | 2876 |
| 234 | Ga0207658_10162632 | 3300025986 | Bacteria | 1831 |
| 235 | Ga0207677_10365379 | 3300026023 | Bacteria | 1214 |
| 236 | Ga0207677_10585220 | 3300026023 | Bacteria | 977 |
| 237 | Ga0207639_10042728 | 3300026041 | Bacteria | 3398 |
| 238 | Ga0207678_10000386 | 3300026067 | Bacteria | 40106 |
| 239 | Ga0207702_10234875 | 3300026078 | Bacteria | 1715 |
| 240 | Ga0207676_10298636 | 3300026095 | Bacteria | 1470 |
| 241 | Ga0207676_10610410 | 3300026095 | Bacteria | 1049 |
| 242 | Ga0207674_10114973 | 3300026116 | Bacteria | 2662 |
| 243 | Ga0207674_10235164 | 3300026116 | Bacteria | 1780 |
| 244 | Ga0207698_10019463 | 3300026142 | Bacteria | 4648 |
| 245 | Ga0209371_1000405 | 3300027312 | Bacteria | 44970 |
| 246 | Ga0209813_10039629 | 3300027866 | Bacteria | 1428 |
| 247 | Ga0268265_10093043 | 3300028380 | Bacteria | 2414 |
| 248 | Ga0268265_10516178 | 3300028380 | Bacteria | 1129 |
| 249 | Ga0265338_10000557 | 3300028800 | Bacteria | 65338 |
| 250 | Ga0268256_1000345 | 3300030500 | Bacteria | 44970 |
| 251 | Ga0265332_10046725 | 3300031238 | Bacteria | 1864 |
| 252 | Ga0265325_10050137 | 3300031241 | Bacteria | 2151 |
| 253 | Ga0265340_10033340 | 3300031247 | Bacteria | 2564 |
| 254 | Ga0265340_10035988 | 3300031247 | Bacteria | 2456 |
| 255 | Ga0265340_10204420 | 3300031247 | Bacteria | 888 |
| 256 | Ga0265339_10103505 | 3300031249 | Bacteria | 1479 |
| 257 | Ga0265331_10004759 | 3300031250 | Bacteria | 8373 |
| 258 | Ga0265331_10094212 | 3300031250 | Bacteria | 1383 |
| 259 | Ga0265316_10304301 | 3300031344 | Bacteria | 1161 |
| 260 | Ga0307509_10230028 | 3300031507 | Bacteria | 1658 |
| 261 | Ga0265313_10000453 | 3300031595 | Bacteria | 43360 |
| 262 | Ga0265314_10230484 | 3300031711 | Bacteria | 1075 |
| 263 | Ga0265342_10033712 | 3300031712 | Bacteria | 3145 |
| 264 | Ga0307406_10231640 | 3300031901 | Bacteria | 1380 |
| 265 | Ga0307407_10252116 | 3300031903 | Bacteria | 1210 |
| 266 | Ga0307409_100460152 | 3300031995 | Bacteria | 1230 |
| 267 | Ga0307416_100357110 | 3300032002 | Bacteria | 1482 |
| 268 | Ga0307416_100770832 | 3300032002 | Bacteria | 1056 |
| 269 | Ga0373923_0178048 | 3300035111 | Bacteria | 976 |
| 270 | Ga0373953_0089600 | 3300035117 | Bacteria | 1286 |
| 271 | Ga0316574_0005800 | 3300035398 | Bacteria | 6623 |
| 272 | Ga0316574_0021391 | 3300035398 | Bacteria | 3840 |
| 273 | Ga0316574_0024027 | 3300035398 | Bacteria | 3644 |
| 274 | Ga0373931_0251611 | 3300035691 | Bacteria | 1075 |
| 275 | Ga0373935_0330773 | 3300035692 | Bacteria | 1083 |
| 276 | Ga0373927_0097605 | 3300035695 | Bacteria | 1910 |
| 277 | Ga0373947_0106257 | 3300035725 | Bacteria | 1769 |
| 278 | Ga0373937_0626681 | 3300036401 | Bacteria | 1021 |
| 279 | Ga0316584_0157396 | 3300036712 | Unclassified | 1689 |
| 280 | Ga0316584_0221922 | 3300036712 | Bacteria | 1388 |
| 281 | Ga0373925_0049212 | 3300037068 | Bacteria | 3142 |
| 282 | Ga0373925_0074859 | 3300037068 | Bacteria | 2565 |
| 283 | Ga0373925_0152609 | 3300037068 | Bacteria | 1815 |
| 284 | Ga0373925_0328960 | 3300037068 | Bacteria | 1238 |
| 285 | Ga0373925_0574338 | 3300037068 | Bacteria | 928 |
| 286 | Ga0395900_0000635 | 3300037418 | Bacteria | 47215 |
| 287 | Ga0395900_0115375 | 3300037418 | Bacteria | 2756 |
| 288 | Ga0395900_0302667 | 3300037418 | Bacteria | 1585 |
| 289 | Ga0395898_0001892 | 3300037466 | Bacteria | 26705 |
| 290 | Ga0395898_0024305 | 3300037466 | Bacteria | 6111 |
| 291 | Ga0395898_0043167 | 3300037466 | Bacteria | 4444 |
| 292 | Ga0395905_0000012 | 3300037471 | Bacteria | 420861 |
| 293 | Ga0395905_0027618 | 3300037471 | Bacteria | 5352 |
| 294 | Ga0395905_0043010 | 3300037471 | Bacteria | 4238 |
| 295 | Ga0436364_0169683 | 3300037853 | Bacteria | 86149 |
| 296 | Ga0436364_0393226 | 3300037853 | Bacteria | 35432 |
| 297 | Ga0436364_0534702 | 3300037853 | Bacteria | 1518 |
| 298 | Ga0436364_0654159 | 3300037853 | Bacteria | 5237 |
| 299 | Ga0436364_1146099 | 3300037853 | Bacteria | 15147 |
| 300 | Ga0436364_1391815 | 3300037853 | Bacteria | 1092 |
| 301 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 302 | Ga0395901_0000079 | 3300038443 | Bacteria | 134462 |
| 303 | Ga0395901_0062632 | 3300038443 | Bacteria | 3870 |
| 304 | Ga0395901_0265894 | 3300038443 | Bacteria | 1784 |
| 305 | Ga0395901_0268033 | 3300038443 | Bacteria | 1776 |
| 306 | Ga0395901_0551379 | 3300038443 | Bacteria | 1168 |
| 307 | Ga0400489_75299 | 3300039093 | Bacteria | 2245 |
| 308 | Ga0400487_61945 | 3300039110 | Bacteria | 3180 |
| 309 | Ga0436365_0614583 | 3300039437 | Bacteria | 2232 |
| 310 | Ga0436365_1280460 | 3300039437 | Bacteria | 1409 |
| 311 | Ga0436360_0186567 | 3300039438 | Bacteria | 3552 |
| 312 | Ga0436360_0732647 | 3300039438 | Bacteria | 2661 |
| 313 | Ga0436360_0966976 | 3300039438 | Bacteria | 1048 |
| 314 | Ga0436361_0228888 | 3300039447 | Bacteria | 17557 |
| 315 | Ga0436361_0302900 | 3300039447 | Bacteria | 2822 |
| 316 | Ga0436361_0723959 | 3300039447 | Bacteria | 5657 |
| 317 | Ga0436363_0337490 | 3300039450 | Bacteria | 865 |
| 318 | Ga0436363_0810913 | 3300039450 | Bacteria | 1363 |
| 319 | Ga0436362_0302354 | 3300039453 | Bacteria | 2907 |
| 320 | Ga0436362_0907642 | 3300039453 | Bacteria | 4029 |
| 321 | Ga0436362_1155506 | 3300039453 | Bacteria | 1902 |
| 322 | Ga0436362_1204423 | 3300039453 | Bacteria | 1184 |
| 323 | Ga0439448_0001158 | 3300042005 | Bacteria | 6689 |
| 324 | Ga0451577_0498466 | 3300042876 | Bacteria | 1106 |
| 325 | Ga0466969_0018240 | 3300044656 | Bacteria | 3657 |
| 326 | Ga0466969_0024770 | 3300044656 | Bacteria | 3086 |
| 327 | Ga0466972_0103974 | 3300044658 | Bacteria | 1343 |
| 328 | Ga0466973_0042623 | 3300044659 | Bacteria | 4265 |
| 329 | Ga0466965_0000552 | 3300044683 | Bacteria | 13479 |
| 330 | Ga0466965_0018142 | 3300044683 | Bacteria | 3370 |
| 331 | Ga0466965_0126631 | 3300044683 | Bacteria | 1322 |
| 332 | Ga0466966_0003017 | 3300044684 | Bacteria | 11103 |
| 333 | Ga0466966_0005413 | 3300044684 | Bacteria | 8392 |
| 334 | Ga0466966_0026815 | 3300044684 | Bacteria | 3760 |
| 335 | Ga0466966_0057976 | 3300044684 | Bacteria | 2448 |
| 336 | Ga0466961_0004320 | 3300044693 | Bacteria | 8897 |
| 337 | Ga0466961_0005705 | 3300044693 | Bacteria | 7875 |
| 338 | Ga0466963_0000989 | 3300044694 | Bacteria | 14647 |
| 339 | Ga0466963_0001909 | 3300044694 | Bacteria | 11405 |
| 340 | Ga0466971_0005454 | 3300044719 | Bacteria | 5520 |
| 341 | Ga0466970_0035633 | 3300044765 | Bacteria | 2636 |
| 342 | Ga0466970_0077386 | 3300044765 | Bacteria | 1793 |
| 343 | Ga0466957_0000377 | 3300044842 | Bacteria | 21850 |
| 344 | Ga0466960_0013141 | 3300044901 | Bacteria | 3511 |
| 345 | Ga0466959_0001316 | 3300045049 | Bacteria | 15078 |
| 346 | Ga0451576_0127963 | 3300045051 | Bacteria | 2647 |
| 347 | Ga0466958_0003652 | 3300045836 | Bacteria | 8030 |
| 348 | Ga0466967_0235960 | 3300045976 | Bacteria | 1743 |
| 349 | Ga0466967_0250170 | 3300045976 | Bacteria | 1693 |
| 350 | Ga0495592_0277003 | 3300046454 | Bacteria | 1098 |
| 351 | Ga0495603_0000924 | 3300046455 | Bacteria | 16860 |
| 352 | Ga0495603_0017279 | 3300046455 | Bacteria | 4367 |
| 353 | Ga0495590_0000706 | 3300046457 | Bacteria | 15268 |
| 354 | Ga0495590_0045035 | 3300046457 | Bacteria | 1539 |
| 355 | Ga0495629_0000774 | 3300046459 | Bacteria | 25829 |
| 356 | Ga0495653_0041438 | 3300046463 | Bacteria | 3594 |
| 357 | Ga0495653_0074231 | 3300046463 | Bacteria | 2535 |
| 358 | Ga0495650_0002070 | 3300046471 | Bacteria | 17390 |
| 359 | Ga0495650_0094711 | 3300046471 | Bacteria | 1130 |
| 360 | Ga0495580_0008325 | 3300046472 | Bacteria | 8248 |
| 361 | Ga0495580_0013673 | 3300046472 | Bacteria | 6186 |
| 362 | Ga0495580_0186232 | 3300046472 | Bacteria | 1433 |
| 363 | Ga0495580_0285682 | 3300046472 | Bacteria | 1125 |
| 364 | Ga0495580_0386652 | 3300046472 | Bacteria | 945 |
| 365 | Ga0495662_0036471 | 3300046476 | Bacteria | 2373 |
| 366 | Ga0495664_0002778 | 3300046477 | Bacteria | 9421 |
| 367 | Ga0495584_0025551 | 3300046491 | Bacteria | 2994 |
| 368 | Ga0495585_0129372 | 3300046492 | Bacteria | 1330 |
| 369 | Ga0495606_0002948 | 3300046507 | Bacteria | 18768 |
| 370 | Ga0495606_0036166 | 3300046507 | Bacteria | 3366 |
| 371 | Ga0495606_0053361 | 3300046507 | Bacteria | 2623 |
| 372 | Ga0495606_0135743 | 3300046507 | Bacteria | 1457 |
| 373 | Ga0495628_0320477 | 3300046516 | Bacteria | 1144 |
| 374 | Ga0495648_0055509 | 3300046524 | Bacteria | 2387 |
| 375 | Ga0495642_0144202 | 3300046528 | Bacteria | 1029 |
| 376 | Ga0495652_0071993 | 3300046529 | Bacteria | 2882 |
| 377 | Ga0495654_0018564 | 3300046530 | Bacteria | 3643 |
| 378 | Ga0495665_0010913 | 3300046531 | Bacteria | 4915 |
| 379 | Ga0495665_0022130 | 3300046531 | Bacteria | 3418 |
| 380 | Ga0495640_0055468 | 3300046533 | Bacteria | 2711 |
| 381 | Ga0495586_0098491 | 3300046535 | Bacteria | 1621 |
| 382 | Ga0495586_0179592 | 3300046535 | Bacteria | 1197 |
| 383 | Ga0495597_0004104 | 3300046542 | Bacteria | 8116 |
| 384 | Ga0495645_0007762 | 3300046543 | Bacteria | 7461 |
| 385 | Ga0495645_0058610 | 3300046543 | Bacteria | 2793 |
| 386 | Ga0495667_0016713 | 3300046559 | Bacteria | 4955 |
| 387 | Ga0495611_0031701 | 3300046648 | Bacteria | 2328 |
| 388 | Ga0495588_0014205 | 3300046674 | Bacteria | 3808 |
| 389 | Ga0495599_0413017 | 3300046678 | Bacteria | 803 |
| 390 | Ga0495646_0115462 | 3300046680 | Bacteria | 1524 |
| 391 | Ga0495669_0020892 | 3300046684 | Bacteria | 2836 |
| 392 | Ga0495669_0109982 | 3300046684 | Bacteria | 1286 |
| 393 | Ga0495671_0018661 | 3300046692 | Bacteria | 3678 |
| 394 | Ga0495649_0008350 | 3300046694 | Bacteria | 6232 |
| 395 | Ga0495589_0029786 | 3300046794 | Bacteria | 2752 |
| 396 | Ga0495589_0052667 | 3300046794 | Bacteria | 2010 |
| 397 | Ga0495589_0096473 | 3300046794 | Bacteria | 1433 |
| 398 | Ga0495600_0054630 | 3300046809 | Bacteria | 2609 |
| 399 | Ga0495581_0001974 | 3300047315 | Bacteria | 11503 |
| 400 | Ga0495604_0086967 | 3300047317 | Bacteria | 2329 |
| 401 | Ga0495674_0008236 | 3300047319 | Bacteria | 9946 |
| 402 | Ga0495674_0013834 | 3300047319 | Bacteria | 7574 |
| 403 | Ga0495674_0163930 | 3300047319 | Bacteria | 1858 |
| 404 | Ga0495680_0151216 | 3300047322 | Bacteria | 1692 |
| 405 | Ga0495680_0277758 | 3300047322 | Bacteria | 1181 |
| 406 | Ga0495683_0002040 | 3300047323 | Bacteria | 12513 |
| 407 | Ga0495683_0012429 | 3300047323 | Bacteria | 4468 |
| 408 | Ga0495683_0034712 | 3300047323 | Bacteria | 2564 |
| 409 | Ga0495687_000025 | 3300047443 | Bacteria | 310498 |
| 410 | Ga0495675_0042986 | 3300047444 | Bacteria | 2879 |
| 411 | Ga0495593_0025150 | 3300047673 | Bacteria | 3295 |
| 412 | Ga0495602_0011140 | 3300048088 | Bacteria | 9309 |
| 413 | Ga0495602_0064861 | 3300048088 | Bacteria | 3155 |
| 414 | Ga0495614_0018957 | 3300048089 | Bacteria | 2979 |
| 415 | Ga0495626_0122937 | 3300048091 | Bacteria | 1114 |
| 416 | Ga0496100_0000791 | 3300048903 | Bacteria | 15063 |
| 417 | Ga0496100_0090560 | 3300048903 | Bacteria | 2086 |
| 418 | Ga0496100_0517583 | 3300048903 | Bacteria | 920 |
| 419 | Ga0496101_0002729 | 3300048904 | Bacteria | 10835 |
| 420 | Ga0496101_0005842 | 3300048904 | Bacteria | 7871 |
| 421 | Ga0496101_0134029 | 3300048904 | Bacteria | 1883 |
| 422 | Ga0496101_0308613 | 3300048904 | Bacteria | 1240 |
| 423 | Ga0496102_0008235 | 3300048905 | Bacteria | 8926 |
| 424 | Ga0496102_0035606 | 3300048905 | Bacteria | 4482 |
| 425 | Ga0496102_0148342 | 3300048905 | Bacteria | 2202 |
| 426 | Ga0496103_0002256 | 3300048906 | Bacteria | 12202 |
| 427 | Ga0496103_0004743 | 3300048906 | Bacteria | 8223 |
| 428 | Ga0496104_0050043 | 3300048907 | Bacteria | 3942 |
| 429 | Ga0496104_0379973 | 3300048907 | Bacteria | 1325 |
| 430 | Ga0496105_0040038 | 3300048908 | Bacteria | 3863 |
| 431 | Ga0496105_0187294 | 3300048908 | Bacteria | 1693 |
| 432 | Ga0496105_0396969 | 3300048908 | Bacteria | 1095 |
| 433 | Ga0496106_0000053 | 3300048909 | Bacteria | 93929 |
| 434 | Ga0496106_0031278 | 3300048909 | Bacteria | 3965 |
| 435 | Ga0496106_0043788 | 3300048909 | Bacteria | 3359 |
| 436 | Ga0496106_0074774 | 3300048909 | Bacteria | 2594 |
| 437 | Ga0496107_0015100 | 3300048910 | Bacteria | 5411 |
| 438 | Ga0496107_0120339 | 3300048910 | Bacteria | 1934 |
| 439 | Ga0496109_0268345 | 3300048912 | Bacteria | 1608 |
| 440 | Ga0496110_0006687 | 3300048913 | Bacteria | 9162 |
| 441 | Ga0496110_0370856 | 3300048913 | Bacteria | 1304 |
| 442 | Ga0496111_0008603 | 3300048914 | Bacteria | 6767 |
| 443 | Ga0496111_0247274 | 3300048914 | Bacteria | 1324 |
| 444 | Ga0496112_0011544 | 3300048915 | Bacteria | 8074 |
| 445 | Ga0496112_0025678 | 3300048915 | Bacteria | 5659 |
| 446 | Ga0496112_0121102 | 3300048915 | Bacteria | 2586 |
| 447 | Ga0496112_0336044 | 3300048915 | Bacteria | 1454 |
| 448 | Ga0496113_0024627 | 3300048916 | Bacteria | 4280 |
| 449 | Ga0496113_0085022 | 3300048916 | Bacteria | 2430 |
| 450 | Ga0496113_0200721 | 3300048916 | Bacteria | 1585 |
| 451 | Ga0496113_0505574 | 3300048916 | Bacteria | 970 |
| 452 | Ga0496113_0637215 | 3300048916 | Bacteria | 853 |
| 453 | Ga0496114_0001299 | 3300048917 | Bacteria | 18897 |
| 454 | Ga0496115_0025883 | 3300048918 | Bacteria | 4572 |
| 455 | Ga0496115_0047431 | 3300048918 | Bacteria | 3436 |
| 456 | Ga0496116_0020686 | 3300048919 | Bacteria | 4989 |
| 457 | Ga0496116_0050663 | 3300048919 | Bacteria | 2765 |
| 458 | Ga0496116_0085578 | 3300048919 | Bacteria | 1937 |
| 459 | Ga0496116_0237236 | 3300048919 | Bacteria | 919 |
| 460 | Ga0496117_0002599 | 3300048920 | Bacteria | 22450 |
| 461 | Ga0496117_0078535 | 3300048920 | Bacteria | 2178 |
| 462 | Ga0496118_0011356 | 3300048921 | Bacteria | 8705 |
| 463 | Ga0496119_0119083 | 3300048922 | Bacteria | 1454 |
| 464 | Ga0496120_0194029 | 3300048923 | Bacteria | 988 |
| 465 | Ga0496121_0000585 | 3300048924 | Bacteria | 68389 |
| 466 | Ga0496121_0003743 | 3300048924 | Bacteria | 21303 |
| 467 | Ga0496121_0009234 | 3300048924 | Bacteria | 11389 |
| 468 | Ga0496121_0016230 | 3300048924 | Bacteria | 7706 |
| 469 | Ga0496121_0215272 | 3300048924 | Bacteria | 1358 |
| 470 | Ga0496121_0221336 | 3300048924 | Bacteria | 1333 |
| 471 | Ga0496123_0012440 | 3300048926 | Bacteria | 7255 |
| 472 | Ga0496125_0012344 | 3300048928 | Bacteria | 8488 |
| 473 | Ga0496126_0006736 | 3300048929 | Bacteria | 12756 |
| 474 | Ga0496126_0125160 | 3300048929 | Bacteria | 2226 |
| 475 | Ga0496126_0249978 | 3300048929 | Bacteria | 1478 |
| 476 | Ga0501031_0057249 | 3300049568 | Bacteria | 2540 |
| 477 | Ga0501032_0001025 | 3300049569 | Bacteria | 22442 |
| 478 | Ga0501032_0061429 | 3300049569 | Bacteria | 2519 |
| 479 | Ga0501033_0004528 | 3300049570 | Bacteria | 11125 |
| 480 | Ga0501033_0272029 | 3300049570 | Bacteria | 1197 |
| 481 | Ga0501034_0089476 | 3300049571 | Bacteria | 3076 |
| 482 | Ga0501034_0407800 | 3300049571 | Bacteria | 1281 |
| 483 | Ga0501036_0001419 | 3300049572 | Bacteria | 18419 |
| 484 | Ga0501036_0085282 | 3300049572 | Bacteria | 2669 |
| 485 | Ga0501037_0003506 | 3300049573 | Bacteria | 11384 |
| 486 | Ga0501038_0003266 | 3300049574 | Bacteria | 15128 |
| 487 | Ga0501038_0140124 | 3300049574 | Bacteria | 1979 |
| 488 | Ga0501038_0396205 | 3300049574 | Bacteria | 1069 |
| 489 | Ga0501039_0002791 | 3300049575 | Bacteria | 13048 |
| 490 | Ga0501039_0057189 | 3300049575 | Bacteria | 3020 |
| 491 | Ga0501040_0045383 | 3300049576 | Bacteria | 2997 |
| 492 | Ga0501042_0036652 | 3300049578 | Bacteria | 3480 |
| 493 | Ga0501043_0000339 | 3300049579 | Bacteria | 42404 |
| 494 | Ga0501043_0050266 | 3300049579 | Bacteria | 3277 |
| 495 | Ga0501043_0189972 | 3300049579 | Bacteria | 1598 |
| 496 | Ga0501046_0000671 | 3300049580 | Bacteria | 33150 |
| 497 | Ga0501046_0051026 | 3300049580 | Bacteria | 3266 |
| 498 | Ga0501047_0001976 | 3300049581 | Bacteria | 19681 |
| 499 | Ga0501048_0013230 | 3300049582 | Bacteria | 6123 |
| 500 | Ga0501067_0014845 | 3300049583 | Bacteria | 4310 |
| 501 | Ga0501068_0000979 | 3300049584 | Bacteria | 15009 |
| 502 | Ga0501068_0054939 | 3300049584 | Bacteria | 2413 |
| 503 | Ga0501069_0000349 | 3300049585 | Bacteria | 20802 |
| 504 | Ga0501070_0003463 | 3300049586 | Bacteria | 13689 |
| 505 | Ga0501070_0003907 | 3300049586 | Bacteria | 12859 |
| 506 | Ga0501071_0022662 | 3300049587 | Bacteria | 4380 |
| 507 | Ga0501071_0048542 | 3300049587 | Bacteria | 3054 |
| 508 | Ga0501072_0013637 | 3300049588 | Bacteria | 6222 |
| 509 | Ga0501072_0095321 | 3300049588 | Bacteria | 2365 |
| 510 | Ga0501073_0002667 | 3300049589 | Bacteria | 13363 |
| 511 | Ga0501073_0025562 | 3300049589 | Bacteria | 4232 |
| 512 | Ga0501073_0457168 | 3300049589 | Bacteria | 883 |
| 513 | Ga0501074_0000220 | 3300049590 | Bacteria | 31534 |
| 514 | Ga0501074_0060829 | 3300049590 | Bacteria | 2721 |
| 515 | Ga0501075_0038974 | 3300049591 | Bacteria | 3554 |
| 516 | Ga0501076_0031675 | 3300049592 | Bacteria | 4126 |
| 517 | Ga0501077_0031384 | 3300049593 | Bacteria | 3380 |
| 518 | Ga0501079_0033771 | 3300049741 | Bacteria | 3936 |
| 519 | Ga0501079_0184530 | 3300049741 | Bacteria | 1628 |
| 520 | Ga0501079_0442586 | 3300049741 | Bacteria | 1020 |
| 521 | Ga0501080_0000471 | 3300049742 | Bacteria | 31285 |
| 522 | Ga0501080_0058767 | 3300049742 | Bacteria | 3579 |
| 523 | Ga0501080_0072578 | 3300049742 | Bacteria | 3202 |
| 524 | Ga0501080_0433094 | 3300049742 | Bacteria | 1180 |
| 525 | Ga0501081_0057266 | 3300049743 | Bacteria | 2694 |
| 526 | Ga0501083_0000746 | 3300049744 | Bacteria | 21235 |
| 527 | Ga0501083_0009943 | 3300049744 | Bacteria | 6715 |
| 528 | Ga0501083_0073553 | 3300049744 | Bacteria | 2272 |
| 529 | Ga0501083_0094333 | 3300049744 | Bacteria | 1975 |
| 530 | Ga0501035_0001114 | 3300049822 | Bacteria | 28107 |
| 531 | Ga0501035_0057126 | 3300049822 | Bacteria | 3480 |
| 532 | Ga0501044_0002829 | 3300049823 | Bacteria | 19746 |
| 533 | Ga0501044_0006665 | 3300049823 | Bacteria | 12729 |
| 534 | Ga0501044_0180637 | 3300049823 | Bacteria | 2077 |
| 535 | Ga0501045_0053629 | 3300049824 | Bacteria | 2946 |
| 536 | nmdc:mga03683_90481_c1 | 3300050489 | Bacteria | 1333 |
| 537 | nmdc:mga0yw44_616492_c1 | 3300050492 | Bacteria | 737 |
| 538 | nmdc:mga0k408_101739_c1 | 3300050493 | Bacteria | 1694 |
| 539 | nmdc:mga0k408_287567_c1 | 3300050493 | Bacteria | 981 |
| 540 | nmdc:mga05p37_80389_c1 | 3300050507 | Bacteria | 4015 |
| 541 | nmdc:mga0qj67_215733_c1 | 3300050509 | Bacteria | 1558 |
| 542 | nmdc:mga06r32_419249_c1 | 3300050510 | Bacteria | 1320 |
| 543 | nmdc:mga08y16_517676_c1 | 3300050511 | Bacteria | 1210 |
| 544 | nmdc:mga08x19_22005_c1 | 3300050514 | Bacteria | 3943 |
| 545 | nmdc:mga08x19_231225_c1 | 3300050514 | Bacteria | 1272 |
| 546 | nmdc:mga0sz30_4790_c1 | 3300050516 | Bacteria | 4922 |
| 547 | Ga0495601_0033068 | 3300053077 | Bacteria | 3221 |
| 548 | Ga0495595_0012215 | 3300053084 | Bacteria | 3605 |
| 549 | Ga0495619_0023272 | 3300053085 | Bacteria | 3970 |
| 550 | Ga0500578_0120951 | 3300053086 | Bacteria | 1646 |
| 551 | Ga0500646_0021763 | 3300053090 | Bacteria | 1710 |
| 552 | Ga0500646_0036670 | 3300053090 | Bacteria | 1367 |
| 553 | Ga0500651_0067078 | 3300053093 | Bacteria | 2234 |
| 554 | Ga0500566_0078925 | 3300053094 | Bacteria | 1836 |
| 555 | Ga0500641_0000418 | 3300053096 | Bacteria | 15650 |
| 556 | Ga0500641_0011956 | 3300053096 | Bacteria | 3161 |
| 557 | Ga0500555_016134 | 3300053103 | Bacteria | 2153 |
| 558 | Ga0500594_0031775 | 3300053118 | Bacteria | 1394 |
| 559 | Ga0500594_0042543 | 3300053118 | Bacteria | 1249 |
| 560 | Ga0500595_001208 | 3300053119 | Bacteria | 14277 |
| 561 | Ga0500642_0000211 | 3300053130 | Bacteria | 23725 |
| 562 | Ga0500642_0009703 | 3300053130 | Bacteria | 3357 |
| 563 | Ga0500658_0048747 | 3300053134 | Bacteria | 1723 |
| 564 | Ga0500568_0006454 | 3300053139 | Bacteria | 5882 |
| 565 | Ga0500577_0015195 | 3300053142 | Bacteria | 2400 |
| 566 | Ga0500588_0173547 | 3300053146 | Bacteria | 790 |
| 567 | Ga0500604_0002385 | 3300053151 | Bacteria | 5137 |
| 568 | Ga0500604_0004752 | 3300053151 | Bacteria | 3599 |
| 569 | Ga0500604_0016842 | 3300053151 | Bacteria | 2016 |
| 570 | Ga0500616_0001275 | 3300053153 | Bacteria | 25176 |
| 571 | Ga0500645_011319 | 3300053730 | Bacteria | 2918 |
| 572 | Ga0500609_002846 | 3300053731 | Bacteria | 2467 |
| 573 | Ga0501084_0017748 | 3300054114 | Bacteria | 5922 |
| 574 | Ga0501082_0001076 | 3300060353 | Bacteria | 24166 |
| 575 | Ga0501082_0243089 | 3300060353 | Bacteria | 1566 |
| 576 | Ga0501082_0253371 | 3300060353 | Bacteria | 1531 |
| 577 | Ga0501082_0557460 | 3300060353 | Bacteria | 1002 |
| 578 | Ga0501082_0762183 | 3300060353 | Bacteria | 847 |
| 579 | Ga0466962_0008250 | 3300061719 | Bacteria | 4992 |
| 580 | Ga0466962_0010777 | 3300061719 | Bacteria | 4392 |
| 581 | Ga0530510_0027453 | 3300061734 | Bacteria | 4078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100022323 | Ga0068853_1000223232 | 214 |
| 2 | 3300026041 | Ga0207639_10042728 | Ga0207639_100427283 | 214 |
| 3 | 3300053118 | Ga0500594_0042543 | Ga0500594_0042543_16_672 | 216 |
| 4 | 3300042876 | Ga0451577_0498466 | Ga0451577_0498466_331_1038 | 219 |
| 5 | 3300053093 | Ga0500651_0067078 | Ga0500651_0067078_809_1552 | 219 |
| 6 | 3300053142 | Ga0500577_0015195 | Ga0500577_0015195_1494_2237 | 219 |
| 7 | 3300053103 | Ga0500555_016134 | Ga0500555_016134_545_1288 | 221 |
| 8 | 3300053146 | Ga0500588_0173547 | Ga0500588_0173547_13_756 | 221 |
| 9 | 3300053094 | Ga0500566_0078925 | Ga0500566_0078925_960_1703 | 222 |
| 10 | 3300053119 | Ga0500595_001208 | Ga0500595_001208_3187_3930 | 222 |
| 11 | 3300031247 | Ga0265340_10204420 | Ga0265340_102044201 | 224 |
| 12 | 3300038443 | Ga0395901_0551379 | Ga0395901_0551379_343_1062 | 224 |
| 13 | 3300053096 | Ga0500641_0000418 | Ga0500641_0000418_8734_9435 | 224 |
| 14 | 3300009553 | Ga0105249_10107315 | Ga0105249_101073153 | 225 |
| 15 | 3300025961 | Ga0207712_10132822 | Ga0207712_101328222 | 225 |
| 16 | 3300046463 | Ga0495653_0074231 | Ga0495653_0074231_1799_2476 | 225 |
| 17 | 3300047322 | Ga0495680_0277758 | Ga0495680_0277758_40_717 | 225 |
| 18 | 3300006038 | Ga0075365_10087525 | Ga0075365_100875252 | 226 |
| 19 | 3300006042 | Ga0075368_10062816 | Ga0075368_100628162 | 226 |
| 20 | 3300027866 | Ga0209813_10039629 | Ga0209813_100396292 | 226 |
| 21 | 3300035691 | Ga0373931_0251611 | Ga0373931_0251611_119_829 | 226 |
| 22 | 3300037068 | Ga0373925_0152609 | Ga0373925_0152609_12_713 | 226 |
| 23 | 3300039447 | Ga0436361_0302900 | Ga0436361_0302900_1733_2437 | 226 |
| 24 | 3300045051 | Ga0451576_0127963 | Ga0451576_0127963_1599_2309 | 226 |
| 25 | 3300050489 | nmdc:mga03683_90481_c1 | nmdc:mga03683_90481_c1_479_1180 | 226 |
| 26 | 3300050516 | nmdc:mga0sz30_4790_c1 | nmdc:mga0sz30_4790_c1_1016_1717 | 226 |
| 27 | 3300005437 | Ga0070710_10221957 | Ga0070710_102219571 | 227 |
| 28 | 3300005467 | Ga0070706_100446750 | Ga0070706_1004467501 | 227 |
| 29 | 3300005471 | Ga0070698_100155965 | Ga0070698_1001559653 | 227 |
| 30 | 3300005518 | Ga0070699_100570067 | Ga0070699_1005700672 | 227 |
| 31 | 3300007788 | Ga0099795_10049502 | Ga0099795_100495021 | 227 |
| 32 | 3300014325 | Ga0163163_10329241 | Ga0163163_103292412 | 227 |
| 33 | 3300025915 | Ga0207693_10416272 | Ga0207693_104162722 | 227 |
| 34 | 3300025928 | Ga0207700_10137589 | Ga0207700_101375893 | 227 |
| 35 | 3300035117 | Ga0373953_0089600 | Ga0373953_0089600_216_944 | 227 |
| 36 | 3300049574 | Ga0501038_0396205 | Ga0501038_0396205_261_971 | 227 |
| 37 | 3300049588 | Ga0501072_0095321 | Ga0501072_0095321_492_1202 | 227 |
| 38 | 3300049589 | Ga0501073_0457168 | Ga0501073_0457168_106_816 | 227 |
| 39 | 3300049741 | Ga0501079_0184530 | Ga0501079_0184530_741_1451 | 227 |
| 40 | 3300060353 | Ga0501082_0557460 | Ga0501082_0557460_97_807 | 227 |
| 41 | 3300005439 | Ga0070711_100187670 | Ga0070711_1001876703 | 228 |
| 42 | 3300025915 | Ga0207693_10088368 | Ga0207693_100883681 | 228 |
| 43 | iso_pu_bacteria | 8054002106 | 8054002490 | 228 |
| 44 | 3300006175 | Ga0070712_100282709 | Ga0070712_1002827092 | 229 |
| 45 | 3300021358 | Ga0213873_10029473 | Ga0213873_100294731 | 229 |
| 46 | 3300021384 | Ga0213876_10134403 | Ga0213876_101344032 | 229 |
| 47 | 3300039437 | Ga0436365_0614583 | Ga0436365_0614583_375_1097 | 229 |
| 48 | 3300039453 | Ga0436362_0907642 | Ga0436362_0907642_2761_3483 | 229 |
| 49 | 3300049570 | Ga0501033_0272029 | Ga0501033_0272029_49_768 | 229 |
| 50 | 3300049579 | Ga0501043_0189972 | Ga0501043_0189972_344_1063 | 229 |
| 51 | 3300049589 | Ga0501073_0025562 | Ga0501073_0025562_520_1239 | 229 |
| 52 | 3300049744 | Ga0501083_0009943 | Ga0501083_0009943_2607_3326 | 229 |
| 53 | 3300006844 | Ga0075428_100429145 | Ga0075428_1004291452 | 230 |
| 54 | 3300006847 | Ga0075431_100345283 | Ga0075431_1003452832 | 230 |
| 55 | 3300050492 | nmdc:mga0yw44_616492_c1 | nmdc:mga0yw44_616492_c1_14_709 | 230 |
| 56 | 3300050510 | nmdc:mga06r32_419249_c1 | nmdc:mga06r32_419249_c1_153_887 | 230 |
| 57 | 3300005458 | Ga0070681_10077512 | Ga0070681_100775124 | 232 |
| 58 | 3300005530 | Ga0070679_100066596 | Ga0070679_1000665962 | 232 |
| 59 | 3300005981 | Ga0081538_10017322 | Ga0081538_100173225 | 232 |
| 60 | 3300009093 | Ga0105240_10158073 | Ga0105240_101580732 | 232 |
| 61 | 3300009987 | Ga0105030_103461 | Ga0105030_1034612 | 232 |
| 62 | 3300013104 | Ga0157370_10031109 | Ga0157370_100311096 | 232 |
| 63 | 3300025912 | Ga0207707_10062688 | Ga0207707_100626882 | 232 |
| 64 | 3300025913 | Ga0207695_10138268 | Ga0207695_101382681 | 232 |
| 65 | 3300028380 | Ga0268265_10516178 | Ga0268265_105161781 | 232 |
| 66 | 3300035398 | Ga0316574_0005800 | Ga0316574_0005800_5401_6105 | 232 |
| 67 | 3300035398 | Ga0316574_0021391 | Ga0316574_0021391_759_1463 | 232 |
| 68 | 3300036712 | Ga0316584_0221922 | Ga0316584_0221922_132_833 | 232 |
| 69 | 3300039437 | Ga0436365_1280460 | Ga0436365_1280460_532_1233 | 232 |
| 70 | 3300046472 | Ga0495580_0186232 | Ga0495580_0186232_581_1285 | 232 |
| 71 | 3300049569 | Ga0501032_0061429 | Ga0501032_0061429_382_1086 | 232 |
| 72 | 3300049572 | Ga0501036_0085282 | Ga0501036_0085282_1895_2599 | 232 |
| 73 | 3300049575 | Ga0501039_0057189 | Ga0501039_0057189_2241_2945 | 232 |
| 74 | 3300049576 | Ga0501040_0045383 | Ga0501040_0045383_357_1061 | 232 |
| 75 | 3300049578 | Ga0501042_0036652 | Ga0501042_0036652_1234_1938 | 232 |
| 76 | 3300049579 | Ga0501043_0050266 | Ga0501043_0050266_329_1033 | 232 |
| 77 | 3300049580 | Ga0501046_0051026 | Ga0501046_0051026_969_1673 | 232 |
| 78 | 3300049582 | Ga0501048_0013230 | Ga0501048_0013230_4468_5172 | 232 |
| 79 | 3300049584 | Ga0501068_0054939 | Ga0501068_0054939_1198_1902 | 232 |
| 80 | 3300049587 | Ga0501071_0022662 | Ga0501071_0022662_1029_1733 | 232 |
| 81 | 3300049588 | Ga0501072_0013637 | Ga0501072_0013637_2245_2949 | 232 |
| 82 | 3300049590 | Ga0501074_0060829 | Ga0501074_0060829_1701_2405 | 232 |
| 83 | 3300049591 | Ga0501075_0038974 | Ga0501075_0038974_2263_2967 | 232 |
| 84 | 3300049592 | Ga0501076_0031675 | Ga0501076_0031675_2210_2914 | 232 |
| 85 | 3300049593 | Ga0501077_0031384 | Ga0501077_0031384_717_1421 | 232 |
| 86 | 3300049741 | Ga0501079_0033771 | Ga0501079_0033771_1312_2016 | 232 |
| 87 | 3300049742 | Ga0501080_0072578 | Ga0501080_0072578_390_1094 | 232 |
| 88 | 3300049743 | Ga0501081_0057266 | Ga0501081_0057266_1647_2351 | 232 |
| 89 | 3300049744 | Ga0501083_0073553 | Ga0501083_0073553_366_1070 | 232 |
| 90 | 3300049824 | Ga0501045_0053629 | Ga0501045_0053629_561_1265 | 232 |
| 91 | 3300053090 | Ga0500646_0036670 | Ga0500646_0036670_542_1252 | 232 |
| 92 | 3300054114 | Ga0501084_0017748 | Ga0501084_0017748_2043_2747 | 232 |
| 93 | 3300060353 | Ga0501082_0253371 | Ga0501082_0253371_264_968 | 232 |
| 94 | 3300061734 | Ga0530510_0027453 | Ga0530510_0027453_2202_2906 | 232 |
| 95 | 3300005331 | Ga0070670_100124505 | Ga0070670_1001245052 | 233 |
| 96 | 3300005367 | Ga0070667_100077374 | Ga0070667_1000773743 | 233 |
| 97 | 3300005458 | Ga0070681_10535897 | Ga0070681_105358972 | 233 |
| 98 | 3300005614 | Ga0068856_100130245 | Ga0068856_1001302452 | 233 |
| 99 | 3300009147 | Ga0114129_10224327 | Ga0114129_102243274 | 233 |
| 100 | 3300009545 | Ga0105237_10915333 | Ga0105237_109153332 | 233 |
| 101 | 3300010375 | Ga0105239_11003658 | Ga0105239_110036582 | 233 |
| 102 | 3300013297 | Ga0157378_10302455 | Ga0157378_103024552 | 233 |
| 103 | 3300025272 | Ga0209455_1000250 | Ga0209455_100025050 | 233 |
| 104 | 3300025912 | Ga0207707_10454976 | Ga0207707_104549762 | 233 |
| 105 | 3300025912 | Ga0207707_10532593 | Ga0207707_105325932 | 233 |
| 106 | 3300025925 | Ga0207650_10020407 | Ga0207650_100204073 | 233 |
| 107 | 3300025986 | Ga0207658_10162632 | Ga0207658_101626322 | 233 |
| 108 | 3300026023 | Ga0207677_10365379 | Ga0207677_103653792 | 233 |
| 109 | 3300026095 | Ga0207676_10298636 | Ga0207676_102986362 | 233 |
| 110 | 3300026116 | Ga0207674_10114973 | Ga0207674_101149733 | 233 |
| 111 | 3300031241 | Ga0265325_10050137 | Ga0265325_100501373 | 233 |
| 112 | 3300031247 | Ga0265340_10035988 | Ga0265340_100359882 | 233 |
| 113 | 3300031249 | Ga0265339_10103505 | Ga0265339_101035052 | 233 |
| 114 | 3300031250 | Ga0265331_10004759 | Ga0265331_100047593 | 233 |
| 115 | 3300031250 | Ga0265331_10094212 | Ga0265331_100942122 | 233 |
| 116 | 3300031344 | Ga0265316_10304301 | Ga0265316_103043012 | 233 |
| 117 | 3300031595 | Ga0265313_10000453 | Ga0265313_1000045310 | 233 |
| 118 | 3300031711 | Ga0265314_10230484 | Ga0265314_102304842 | 233 |
| 119 | 3300031712 | Ga0265342_10033712 | Ga0265342_100337122 | 233 |
| 120 | 3300035111 | Ga0373923_0178048 | Ga0373923_0178048_95_805 | 233 |
| 121 | 3300035398 | Ga0316574_0024027 | Ga0316574_0024027_2143_2853 | 233 |
| 122 | 3300036401 | Ga0373937_0626681 | Ga0373937_0626681_183_893 | 233 |
| 123 | 3300036712 | Ga0316584_0157396 | Ga0316584_0157396_141_851 | 233 |
| 124 | 3300037471 | Ga0395905_0027618 | Ga0395905_0027618_914_1621 | 233 |
| 125 | 3300039110 | Ga0400487_61945 | Ga0400487_61945_371_1081 | 233 |
| 126 | 3300044901 | Ga0466960_0013141 | Ga0466960_0013141_2231_2935 | 233 |
| 127 | 3300046472 | Ga0495580_0386652 | Ga0495580_0386652_117_827 | 233 |
| 128 | 3300048905 | Ga0496102_0035606 | Ga0496102_0035606_2257_2970 | 233 |
| 129 | 3300048909 | Ga0496106_0031278 | Ga0496106_0031278_98_811 | 233 |
| 130 | 3300048915 | Ga0496112_0121102 | Ga0496112_0121102_1811_2524 | 233 |
| 131 | 3300048916 | Ga0496113_0085022 | Ga0496113_0085022_842_1555 | 233 |
| 132 | 3300048916 | Ga0496113_0637215 | Ga0496113_0637215_58_768 | 233 |
| 133 | 3300049568 | Ga0501031_0057249 | Ga0501031_0057249_992_1699 | 233 |
| 134 | 3300049569 | Ga0501032_0001025 | Ga0501032_0001025_18274_18981 | 233 |
| 135 | 3300049570 | Ga0501033_0004528 | Ga0501033_0004528_10367_11074 | 233 |
| 136 | 3300049571 | Ga0501034_0089476 | Ga0501034_0089476_1300_2007 | 233 |
| 137 | 3300049572 | Ga0501036_0001419 | Ga0501036_0001419_11836_12543 | 233 |
| 138 | 3300049573 | Ga0501037_0003506 | Ga0501037_0003506_4176_4883 | 233 |
| 139 | 3300049574 | Ga0501038_0003266 | Ga0501038_0003266_10466_11173 | 233 |
| 140 | 3300049575 | Ga0501039_0002791 | Ga0501039_0002791_4081_4788 | 233 |
| 141 | 3300049579 | Ga0501043_0000339 | Ga0501043_0000339_7811_8518 | 233 |
| 142 | 3300049580 | Ga0501046_0000671 | Ga0501046_0000671_17730_18437 | 233 |
| 143 | 3300049581 | Ga0501047_0001976 | Ga0501047_0001976_17380_18087 | 233 |
| 144 | 3300049583 | Ga0501067_0014845 | Ga0501067_0014845_1073_1780 | 233 |
| 145 | 3300049584 | Ga0501068_0000979 | Ga0501068_0000979_11375_12082 | 233 |
| 146 | 3300049585 | Ga0501069_0000349 | Ga0501069_0000349_9258_9965 | 233 |
| 147 | 3300049586 | Ga0501070_0003907 | Ga0501070_0003907_2426_3133 | 233 |
| 148 | 3300049589 | Ga0501073_0002667 | Ga0501073_0002667_10088_10795 | 233 |
| 149 | 3300049590 | Ga0501074_0000220 | Ga0501074_0000220_870_1577 | 233 |
| 150 | 3300049742 | Ga0501080_0000471 | Ga0501080_0000471_17542_18249 | 233 |
| 151 | 3300049744 | Ga0501083_0000746 | Ga0501083_0000746_4399_5106 | 233 |
| 152 | 3300049822 | Ga0501035_0001114 | Ga0501035_0001114_10339_11046 | 233 |
| 153 | 3300049823 | Ga0501044_0002829 | Ga0501044_0002829_8701_9408 | 233 |
| 154 | 3300050507 | nmdc:mga05p37_80389_c1 | nmdc:mga05p37_80389_c1_3040_3753 | 233 |
| 155 | 3300050514 | nmdc:mga08x19_231225_c1 | nmdc:mga08x19_231225_c1_25_738 | 233 |
| 156 | 3300053730 | Ga0500645_011319 | Ga0500645_011319_1907_2611 | 233 |
| 157 | 3300060353 | Ga0501082_0001076 | Ga0501082_0001076_9528_10235 | 233 |
| 158 | 3300003781 | Ga0055536_1014864 | Ga0055536_10148642 | 234 |
| 159 | 3300005329 | Ga0070683_100207616 | Ga0070683_1002076161 | 234 |
| 160 | 3300005338 | Ga0068868_100529057 | Ga0068868_1005290572 | 234 |
| 161 | 3300005367 | Ga0070667_100127444 | Ga0070667_1001274442 | 234 |
| 162 | 3300005435 | Ga0070714_100023238 | Ga0070714_1000232385 | 234 |
| 163 | 3300005435 | Ga0070714_100081941 | Ga0070714_1000819414 | 234 |
| 164 | 3300005435 | Ga0070714_100174613 | Ga0070714_1001746131 | 234 |
| 165 | 3300005436 | Ga0070713_100091028 | Ga0070713_1000910283 | 234 |
| 166 | 3300005437 | Ga0070710_10002420 | Ga0070710_100024203 | 234 |
| 167 | 3300005437 | Ga0070710_10166700 | Ga0070710_101667001 | 234 |
| 168 | 3300005439 | Ga0070711_100007844 | Ga0070711_1000078442 | 234 |
| 169 | 3300005445 | Ga0070708_100220968 | Ga0070708_1002209682 | 234 |
| 170 | 3300005458 | Ga0070681_10078349 | Ga0070681_100783492 | 234 |
| 171 | 3300005467 | Ga0070706_100098800 | Ga0070706_1000988002 | 234 |
| 172 | 3300005467 | Ga0070706_100307772 | Ga0070706_1003077722 | 234 |
| 173 | 3300005468 | Ga0070707_100019235 | Ga0070707_1000192354 | 234 |
| 174 | 3300005471 | Ga0070698_100488537 | Ga0070698_1004885371 | 234 |
| 175 | 3300005471 | Ga0070698_100770342 | Ga0070698_1007703422 | 234 |
| 176 | 3300005546 | Ga0070696_100533464 | Ga0070696_1005334641 | 234 |
| 177 | 3300005548 | Ga0070665_100779701 | Ga0070665_1007797011 | 234 |
| 178 | 3300005563 | Ga0068855_100589619 | Ga0068855_1005896192 | 234 |
| 179 | 3300005614 | Ga0068856_100312110 | Ga0068856_1003121102 | 234 |
| 180 | 3300005617 | Ga0068859_100499099 | Ga0068859_1004990991 | 234 |
| 181 | 3300005618 | Ga0068864_100485322 | Ga0068864_1004853221 | 234 |
| 182 | 3300005618 | Ga0068864_100777235 | Ga0068864_1007772352 | 234 |
| 183 | 3300005842 | Ga0068858_100624927 | Ga0068858_1006249272 | 234 |
| 184 | 3300006028 | Ga0070717_10010512 | Ga0070717_100105125 | 234 |
| 185 | 3300006028 | Ga0070717_10072470 | Ga0070717_100724703 | 234 |
| 186 | 3300006042 | Ga0075368_10015202 | Ga0075368_100152023 | 234 |
| 187 | 3300006048 | Ga0075363_100191621 | Ga0075363_1001916212 | 234 |
| 188 | 3300006175 | Ga0070712_100013466 | Ga0070712_1000134663 | 234 |
| 189 | 3300006177 | Ga0075362_10023471 | Ga0075362_100234712 | 234 |
| 190 | 3300006195 | Ga0075366_10101579 | Ga0075366_101015792 | 234 |
| 191 | 3300006846 | Ga0075430_100017546 | Ga0075430_1000175462 | 234 |
| 192 | 3300006846 | Ga0075430_100495506 | Ga0075430_1004955062 | 234 |
| 193 | 3300006847 | Ga0075431_100154909 | Ga0075431_1001549093 | 234 |
| 194 | 3300006880 | Ga0075429_100436502 | Ga0075429_1004365022 | 234 |
| 195 | 3300006931 | Ga0097620_100499117 | Ga0097620_1004991171 | 234 |
| 196 | 3300007788 | Ga0099795_10082232 | Ga0099795_100822321 | 234 |
| 197 | 3300009094 | Ga0111539_10481083 | Ga0111539_104810832 | 234 |
| 198 | 3300009098 | Ga0105245_10248036 | Ga0105245_102480362 | 234 |
| 199 | 3300009545 | Ga0105237_10295192 | Ga0105237_102951922 | 234 |
| 200 | 3300009553 | Ga0105249_10261207 | Ga0105249_102612072 | 234 |
| 201 | 3300010159 | Ga0099796_10145298 | Ga0099796_101452981 | 234 |
| 202 | 3300013306 | Ga0163162_10093316 | Ga0163162_100933161 | 234 |
| 203 | 3300021388 | Ga0213875_10000933 | Ga0213875_1000093310 | 234 |
| 204 | 3300021388 | Ga0213875_10003818 | Ga0213875_100038185 | 234 |
| 205 | 3300021388 | Ga0213875_10009528 | Ga0213875_100095282 | 234 |
| 206 | 3300021388 | Ga0213875_10050780 | Ga0213875_100507802 | 234 |
| 207 | 3300021388 | Ga0213875_10105190 | Ga0213875_101051901 | 234 |
| 208 | 3300025291 | Ga0209675_1002185 | Ga0209675_10021855 | 234 |
| 209 | 3300025292 | Ga0209676_1000269 | Ga0209676_100026946 | 234 |
| 210 | 3300025298 | Ga0209050_1010486 | Ga0209050_10104866 | 234 |
| 211 | 3300025898 | Ga0207692_10014619 | Ga0207692_100146194 | 234 |
| 212 | 3300025903 | Ga0207680_10108814 | Ga0207680_101088142 | 234 |
| 213 | 3300025910 | Ga0207684_10078410 | Ga0207684_100784104 | 234 |
| 214 | 3300025914 | Ga0207671_10190430 | Ga0207671_101904301 | 234 |
| 215 | 3300025915 | Ga0207693_10001194 | Ga0207693_1000119420 | 234 |
| 216 | 3300025915 | Ga0207693_10150011 | Ga0207693_101500113 | 234 |
| 217 | 3300025916 | Ga0207663_10208662 | Ga0207663_102086622 | 234 |
| 218 | 3300025922 | Ga0207646_10004718 | Ga0207646_100047188 | 234 |
| 219 | 3300025925 | Ga0207650_10584957 | Ga0207650_105849571 | 234 |
| 220 | 3300025928 | Ga0207700_10087296 | Ga0207700_100872963 | 234 |
| 221 | 3300025929 | Ga0207664_10189519 | Ga0207664_101895192 | 234 |
| 222 | 3300025929 | Ga0207664_10254399 | Ga0207664_102543992 | 234 |
| 223 | 3300025931 | Ga0207644_10238798 | Ga0207644_102387982 | 234 |
| 224 | 3300025935 | Ga0207709_10611413 | Ga0207709_106114131 | 234 |
| 225 | 3300025939 | Ga0207665_10014121 | Ga0207665_100141212 | 234 |
| 226 | 3300025942 | Ga0207689_10136782 | Ga0207689_101367823 | 234 |
| 227 | 3300025949 | Ga0207667_10696218 | Ga0207667_106962182 | 234 |
| 228 | 3300025986 | Ga0207658_10058163 | Ga0207658_100581634 | 234 |
| 229 | 3300026023 | Ga0207677_10585220 | Ga0207677_105852201 | 234 |
| 230 | 3300026095 | Ga0207676_10610410 | Ga0207676_106104101 | 234 |
| 231 | 3300031507 | Ga0307509_10230028 | Ga0307509_102300281 | 234 |
| 232 | 3300031901 | Ga0307406_10231640 | Ga0307406_102316402 | 234 |
| 233 | 3300031903 | Ga0307407_10252116 | Ga0307407_102521162 | 234 |
| 234 | 3300031995 | Ga0307409_100460152 | Ga0307409_1004601522 | 234 |
| 235 | 3300032002 | Ga0307416_100357110 | Ga0307416_1003571101 | 234 |
| 236 | 3300032002 | Ga0307416_100770832 | Ga0307416_1007708322 | 234 |
| 237 | 3300035692 | Ga0373935_0330773 | Ga0373935_0330773_96_818 | 234 |
| 238 | 3300035695 | Ga0373927_0097605 | Ga0373927_0097605_889_1611 | 234 |
| 239 | 3300035725 | Ga0373947_0106257 | Ga0373947_0106257_513_1235 | 234 |
| 240 | 3300037068 | Ga0373925_0049212 | Ga0373925_0049212_336_1058 | 234 |
| 241 | 3300037068 | Ga0373925_0074859 | Ga0373925_0074859_1818_2540 | 234 |
| 242 | 3300037068 | Ga0373925_0328960 | Ga0373925_0328960_226_948 | 234 |
| 243 | 3300037068 | Ga0373925_0574338 | Ga0373925_0574338_67_789 | 234 |
| 244 | 3300037853 | Ga0436364_0169683 | Ga0436364_0169683_85111_85821 | 234 |
| 245 | 3300037853 | Ga0436364_0393226 | Ga0436364_0393226_12883_13593 | 234 |
| 246 | 3300037853 | Ga0436364_0534702 | Ga0436364_0534702_107_829 | 234 |
| 247 | 3300037853 | Ga0436364_0654159 | Ga0436364_0654159_3390_4100 | 234 |
| 248 | 3300037853 | Ga0436364_1146099 | Ga0436364_1146099_3445_4155 | 234 |
| 249 | 3300037853 | Ga0436364_1391815 | Ga0436364_1391815_73_783 | 234 |
| 250 | 3300039438 | Ga0436360_0186567 | Ga0436360_0186567_1506_2351 | 234 |
| 251 | 3300039438 | Ga0436360_0732647 | Ga0436360_0732647_52_786 | 234 |
| 252 | 3300039438 | Ga0436360_0966976 | Ga0436360_0966976_256_966 | 234 |
| 253 | 3300039450 | Ga0436363_0337490 | Ga0436363_0337490_27_737 | 234 |
| 254 | 3300039450 | Ga0436363_0810913 | Ga0436363_0810913_444_1154 | 234 |
| 255 | 3300039453 | Ga0436362_0302354 | Ga0436362_0302354_2041_2751 | 234 |
| 256 | 3300039453 | Ga0436362_1155506 | Ga0436362_1155506_448_1155 | 234 |
| 257 | 3300039453 | Ga0436362_1204423 | Ga0436362_1204423_367_1077 | 234 |
| 258 | 3300045976 | Ga0466967_0235960 | Ga0466967_0235960_365_1075 | 234 |
| 259 | 3300045976 | Ga0466967_0250170 | Ga0466967_0250170_357_1079 | 234 |
| 260 | 3300046533 | Ga0495640_0055468 | Ga0495640_0055468_873_1583 | 234 |
| 261 | 3300046535 | Ga0495586_0179592 | Ga0495586_0179592_262_972 | 234 |
| 262 | 3300046559 | Ga0495667_0016713 | Ga0495667_0016713_1557_2267 | 234 |
| 263 | 3300046678 | Ga0495599_0413017 | Ga0495599_0413017_81_791 | 234 |
| 264 | 3300047322 | Ga0495680_0151216 | Ga0495680_0151216_553_1263 | 234 |
| 265 | 3300048915 | Ga0496112_0336044 | Ga0496112_0336044_24_746 | 234 |
| 266 | 3300048916 | Ga0496113_0200721 | Ga0496113_0200721_141_863 | 234 |
| 267 | 3300049587 | Ga0501071_0048542 | Ga0501071_0048542_1342_2049 | 234 |
| 268 | 3300049741 | Ga0501079_0442586 | Ga0501079_0442586_38_745 | 234 |
| 269 | 3300049742 | Ga0501080_0433094 | Ga0501080_0433094_365_1081 | 234 |
| 270 | 3300049744 | Ga0501083_0094333 | Ga0501083_0094333_784_1512 | 234 |
| 271 | 3300050493 | nmdc:mga0k408_287567_c1 | nmdc:mga0k408_287567_c1_228_953 | 234 |
| 272 | 3300050509 | nmdc:mga0qj67_215733_c1 | nmdc:mga0qj67_215733_c1_709_1431 | 234 |
| 273 | 3300050514 | nmdc:mga08x19_22005_c1 | nmdc:mga08x19_22005_c1_330_1052 | 234 |
| 274 | 3300053077 | Ga0495601_0033068 | Ga0495601_0033068_1632_2342 | 234 |
| 275 | 3300053084 | Ga0495595_0012215 | Ga0495595_0012215_862_1572 | 234 |
| 276 | 3300053085 | Ga0495619_0023272 | Ga0495619_0023272_581_1291 | 234 |
| 277 | 3300053090 | Ga0500646_0021763 | Ga0500646_0021763_562_1278 | 234 |
| 278 | 3300053118 | Ga0500594_0031775 | Ga0500594_0031775_586_1302 | 234 |
| 279 | 3300053130 | Ga0500642_0009703 | Ga0500642_0009703_252_965 | 234 |
| 280 | 3300053151 | Ga0500604_0002385 | Ga0500604_0002385_944_1660 | 234 |
| 281 | 3300060353 | Ga0501082_0243089 | Ga0501082_0243089_707_1435 | 234 |
| 282 | 3300060353 | Ga0501082_0762183 | Ga0501082_0762183_77_784 | 234 |
| 283 | 3300003215 | JGI25153J46596_10000019 | JGI25153J46596_1000001960 | 235 |
| 284 | 3300003791 | Ga0055530_10018712 | Ga0055530_100187122 | 235 |
| 285 | 3300005844 | Ga0068862_100031459 | Ga0068862_1000314594 | 235 |
| 286 | 3300006195 | Ga0075366_10163552 | Ga0075366_101635522 | 235 |
| 287 | 3300009093 | Ga0105240_10348169 | Ga0105240_103481692 | 235 |
| 288 | 3300025297 | Ga0209758_1000028 | Ga0209758_1000028261 | 235 |
| 289 | 3300025297 | Ga0209758_1013444 | Ga0209758_10134443 | 235 |
| 290 | 3300025298 | Ga0209050_1007558 | Ga0209050_10075582 | 235 |
| 291 | 3300025303 | Ga0209051_1049656 | Ga0209051_10496562 | 235 |
| 292 | 3300025304 | Ga0209257_1000574 | Ga0209257_100057450 | 235 |
| 293 | 3300028380 | Ga0268265_10093043 | Ga0268265_100930431 | 235 |
| 294 | 3300039093 | Ga0400489_75299 | Ga0400489_75299_729_1460 | 235 |
| 295 | 3300039447 | Ga0436361_0228888 | Ga0436361_0228888_16730_17449 | 235 |
| 296 | 3300049571 | Ga0501034_0407800 | Ga0501034_0407800_29_745 | 235 |
| 297 | 3300049574 | Ga0501038_0140124 | Ga0501038_0140124_360_1076 | 235 |
| 298 | 3300049586 | Ga0501070_0003463 | Ga0501070_0003463_7956_8672 | 235 |
| 299 | 3300049742 | Ga0501080_0058767 | Ga0501080_0058767_2296_3012 | 235 |
| 300 | 3300049822 | Ga0501035_0057126 | Ga0501035_0057126_2042_2758 | 235 |
| 301 | 3300049823 | Ga0501044_0006665 | Ga0501044_0006665_9184_9900 | 235 |
| 302 | 3300049823 | Ga0501044_0180637 | Ga0501044_0180637_220_936 | 235 |
| 303 | 3300050493 | nmdc:mga0k408_101739_c1 | nmdc:mga0k408_101739_c1_564_1274 | 235 |
| 304 | 3300053086 | Ga0500578_0120951 | Ga0500578_0120951_102_821 | 235 |
| 305 | 3300053096 | Ga0500641_0011956 | Ga0500641_0011956_1936_2652 | 235 |
| 306 | 3300053130 | Ga0500642_0000211 | Ga0500642_0000211_5664_6380 | 235 |
| 307 | 3300053134 | Ga0500658_0048747 | Ga0500658_0048747_88_804 | 235 |
| 308 | 3300053139 | Ga0500568_0006454 | Ga0500568_0006454_2363_3079 | 235 |
| 309 | 3300053151 | Ga0500604_0004752 | Ga0500604_0004752_1922_2638 | 235 |
| 310 | 3300053151 | Ga0500604_0016842 | Ga0500604_0016842_811_1533 | 235 |
| 311 | 3300053153 | Ga0500616_0001275 | Ga0500616_0001275_22882_23598 | 235 |
| 312 | 3300053731 | Ga0500609_002846 | Ga0500609_002846_1090_1812 | 235 |
| 313 | 3300009094 | Ga0111539_10535451 | Ga0111539_105354512 | 237 |
| 314 | 3300050511 | nmdc:mga08y16_517676_c1 | nmdc:mga08y16_517676_c1_199_945 | 237 |
| 315 | iso_pu_bacteria | 2513237166 | 2514048566 | 239 |
| 316 | iso_pu_bacteria | 2515154123 | 2515688815 | 239 |
| 317 | iso_pu_bacteria | 2519103095 | 2519459346 | 239 |
| 318 | iso_pu_bacteria | 2562617112 | 2563062510 | 239 |
| 319 | iso_pu_bacteria | 2582581311 | 2585294260 | 239 |
| 320 | iso_pu_bacteria | 2599185239 | 2599738392 | 239 |
| 321 | iso_pu_bacteria | 2599185240 | 2599746517 | 239 |
| 322 | iso_pu_bacteria | 2599185355 | 2600208423 | 239 |
| 323 | iso_pu_bacteria | 2600255067 | 2600813027 | 239 |
| 324 | iso_pu_bacteria | 2675903129 | 2676745383 | 239 |
| 325 | iso_pu_bacteria | 2711768613 | 2713477632 | 239 |
| 326 | iso_pu_bacteria | 2791355137 | 2792833783 | 239 |
| 327 | iso_pu_bacteria | 2816332253 | 2817261633 | 239 |
| 328 | iso_pu_bacteria | 2816332256 | 2817279315 | 239 |
| 329 | iso_pu_bacteria | 2816332286 | 2817454486 | 239 |
| 330 | iso_pu_bacteria | 2818991452 | 2819633481 | 239 |
| 331 | iso_pu_bacteria | 2863421361 | 2863425656 | 239 |
| 332 | iso_pu_bacteria | 2870068957 | 2870070665 | 239 |
| 333 | iso_pu_bacteria | 2904564687 | 2904569861 | 239 |
| 334 | iso_pu_bacteria | 2904571731 | 2904577119 | 239 |
| 335 | iso_pu_bacteria | 2904615490 | 2904619723 | 239 |
| 336 | iso_pu_bacteria | 2928157003 | 2928161600 | 239 |
| 337 | iso_pu_bacteria | 2928163908 | 2928168428 | 239 |
| 338 | iso_pu_bacteria | 2928170801 | 2928174845 | 239 |
| 339 | iso_pu_bacteria | 2928536128 | 2928542431 | 239 |
| 340 | iso_pu_bacteria | 2981990288 | 2981993588 | 239 |
| 341 | iso_pu_bacteria | 641736154 | 642419009 | 239 |
| 342 | iso_pu_bacteria | 642555112 | 642593829 | 239 |
| 343 | iso_pu_bacteria | 8018845410 | 8018850850 | 239 |
| 344 | iso_pu_bacteria | 8020807995 | 8020810030 | 239 |
| 345 | iso_pu_bacteria | 8020938398 | 8020941021 | 239 |
| 346 | iso_pu_bacteria | 8020945358 | 8020952382 | 239 |
| 347 | iso_pu_bacteria | 8020953355 | 8020958273 | 239 |
| 348 | iso_pu_bacteria | 8021120328 | 8021125228 | 239 |
| 349 | iso_pu_bacteria | 8039098773 | 8039103529 | 239 |
| 350 | iso_pu_bacteria | 8040167225 | 8040170376 | 239 |
| 351 | iso_pu_bacteria | 8040173305 | 8040175828 | 239 |
| 352 | iso_pu_bacteria | 2501025501 | 2501075795 | 240 |
| 353 | iso_pu_bacteria | 2501025502 | 2501076818 | 240 |
| 354 | iso_pu_bacteria | 2501025504 | 2501411296 | 240 |
| 355 | iso_pu_bacteria | 2510917013 | 2511089004 | 240 |
| 356 | iso_pu_bacteria | 2510917014 | 2511100062 | 240 |
| 357 | iso_pu_bacteria | 2510917015 | 2511104034 | 240 |
| 358 | iso_pu_bacteria | 2513237082 | 2513552672 | 240 |
| 359 | iso_pu_bacteria | 2513237083 | 2513565611 | 240 |
| 360 | iso_pu_bacteria | 2515154189 | 2516021253 | 240 |
| 361 | iso_pu_bacteria | 2883087390 | 2883094077 | 240 |
| 362 | iso_pu_bacteria | 8003955200 | 8003958698 | 240 |
| 363 | 3300025981 | Ga0207640_10824464 | Ga0207640_108244641 | 242 |
| 364 | 3300001989 | JGI24739J22299_10016749 | JGI24739J22299_100167493 | 243 |
| 365 | 3300002067 | JGI24735J21928_10001950 | JGI24735J21928_100019507 | 243 |
| 366 | 3300003320 | rootH2_10017122 | rootH2_100171222 | 243 |
| 367 | 3300003320 | rootH2_10144662 | rootH2_101446623 | 243 |
| 368 | 3300003323 | rootH1_10067028 | rootH1_100670282 | 243 |
| 369 | 3300003354 | JGI25160J50197_1001398 | JGI25160J50197_10013987 | 243 |
| 370 | 3300003758 | Ga0055532_1000764 | Ga0055532_10007646 | 243 |
| 371 | 3300003758 | Ga0055532_1003316 | Ga0055532_10033163 | 243 |
| 372 | 3300003758 | Ga0055532_1003330 | Ga0055532_10033303 | 243 |
| 373 | 3300003760 | Ga0055527_1000596 | Ga0055527_10005966 | 243 |
| 374 | 3300003760 | Ga0055527_1003210 | Ga0055527_10032103 | 243 |
| 375 | 3300003761 | Ga0055535_1001464 | Ga0055535_10014646 | 243 |
| 376 | 3300003761 | Ga0055535_1001470 | Ga0055535_10014706 | 243 |
| 377 | 3300003762 | Ga0055542_1001437 | Ga0055542_10014376 | 243 |
| 378 | 3300003762 | Ga0055542_1001771 | Ga0055542_10017714 | 243 |
| 379 | 3300003763 | Ga0055529_1000378 | Ga0055529_100037832 | 243 |
| 380 | 3300003763 | Ga0055529_1003123 | Ga0055529_10031233 | 243 |
| 381 | 3300003790 | Ga0055528_1001333 | Ga0055528_100133316 | 243 |
| 382 | 3300005262 | Ga0065165_1001568 | Ga0065165_100156818 | 243 |
| 383 | 3300005327 | Ga0070658_10018941 | Ga0070658_100189413 | 243 |
| 384 | 3300005327 | Ga0070658_10044306 | Ga0070658_100443063 | 243 |
| 385 | 3300005339 | Ga0070660_100000045 | Ga0070660_10000004535 | 243 |
| 386 | 3300005339 | Ga0070660_100000404 | Ga0070660_10000040421 | 243 |
| 387 | 3300005344 | Ga0070661_100179028 | Ga0070661_1001790282 | 243 |
| 388 | 3300005366 | Ga0070659_100000069 | Ga0070659_10000006920 | 243 |
| 389 | 3300005366 | Ga0070659_100144437 | Ga0070659_1001444372 | 243 |
| 390 | 3300005455 | Ga0070663_100110670 | Ga0070663_1001106702 | 243 |
| 391 | 3300005457 | Ga0070662_100233883 | Ga0070662_1002338832 | 243 |
| 392 | 3300005563 | Ga0068855_100012359 | Ga0068855_1000123599 | 243 |
| 393 | 3300005563 | Ga0068855_100027446 | Ga0068855_1000274463 | 243 |
| 394 | 3300005577 | Ga0068857_100333197 | Ga0068857_1003331972 | 243 |
| 395 | 3300005614 | Ga0068856_100268545 | Ga0068856_1002685452 | 243 |
| 396 | 3300005614 | Ga0068856_100456315 | Ga0068856_1004563152 | 243 |
| 397 | 3300005616 | Ga0068852_100062860 | Ga0068852_1000628603 | 243 |
| 398 | 3300009011 | Ga0105251_10002123 | Ga0105251_1000212312 | 243 |
| 399 | 3300009092 | Ga0105250_10010724 | Ga0105250_100107243 | 243 |
| 400 | 3300009093 | Ga0105240_10006999 | Ga0105240_1000699910 | 243 |
| 401 | 3300009093 | Ga0105240_10009057 | Ga0105240_1000905715 | 243 |
| 402 | 3300009093 | Ga0105240_10060794 | Ga0105240_100607943 | 243 |
| 403 | 3300009093 | Ga0105240_10068460 | Ga0105240_100684602 | 243 |
| 404 | 3300009093 | Ga0105240_10115070 | Ga0105240_101150703 | 243 |
| 405 | 3300009177 | Ga0105248_10019259 | Ga0105248_100192596 | 243 |
| 406 | 3300009545 | Ga0105237_10015869 | Ga0105237_100158695 | 243 |
| 407 | 3300009545 | Ga0105237_10087138 | Ga0105237_100871382 | 243 |
| 408 | 3300009545 | Ga0105237_10748272 | Ga0105237_107482722 | 243 |
| 409 | 3300009551 | Ga0105238_10054313 | Ga0105238_100543133 | 243 |
| 410 | 3300009551 | Ga0105238_10235938 | Ga0105238_102359381 | 243 |
| 411 | 3300009551 | Ga0105238_10571829 | Ga0105238_105718291 | 243 |
| 412 | 3300010375 | Ga0105239_10001236 | Ga0105239_100012368 | 243 |
| 413 | 3300013100 | Ga0157373_10004810 | Ga0157373_100048105 | 243 |
| 414 | 3300013100 | Ga0157373_10228649 | Ga0157373_102286492 | 243 |
| 415 | 3300013104 | Ga0157370_10001406 | Ga0157370_1000140614 | 243 |
| 416 | 3300013104 | Ga0157370_10003087 | Ga0157370_1000308716 | 243 |
| 417 | 3300013105 | Ga0157369_10000915 | Ga0157369_100009155 | 243 |
| 418 | 3300013105 | Ga0157369_10001268 | Ga0157369_1000126828 | 243 |
| 419 | 3300013105 | Ga0157369_10004199 | Ga0157369_100041998 | 243 |
| 420 | 3300013296 | Ga0157374_10000318 | Ga0157374_1000031831 | 243 |
| 421 | 3300013307 | Ga0157372_10029152 | Ga0157372_100291524 | 243 |
| 422 | 3300013307 | Ga0157372_10149106 | Ga0157372_101491062 | 243 |
| 423 | 3300013307 | Ga0157372_10261283 | Ga0157372_102612832 | 243 |
| 424 | 3300014497 | Ga0182008_10263461 | Ga0182008_102634611 | 243 |
| 425 | 3300014969 | Ga0157376_10440772 | Ga0157376_104407722 | 243 |
| 426 | 3300015261 | Ga0182006_1032216 | Ga0182006_10322162 | 243 |
| 427 | 3300015261 | Ga0182006_1056763 | Ga0182006_10567632 | 243 |
| 428 | 3300015262 | Ga0182007_10055992 | Ga0182007_100559922 | 243 |
| 429 | 3300016635 | Ga0183361_10010 | Ga0183361_10010141 | 243 |
| 430 | 3300020070 | Ga0206356_10633488 | Ga0206356_106334882 | 243 |
| 431 | 3300020082 | Ga0206353_10938556 | Ga0206353_109385563 | 243 |
| 432 | 3300022467 | Ga0224712_10000188 | Ga0224712_100001885 | 243 |
| 433 | 3300025225 | Ga0209566_101237 | Ga0209566_1012375 | 243 |
| 434 | 3300025228 | Ga0209672_100033 | Ga0209672_10003361 | 243 |
| 435 | 3300025228 | Ga0209672_100114 | Ga0209672_10011433 | 243 |
| 436 | 3300025228 | Ga0209672_100224 | Ga0209672_10022419 | 243 |
| 437 | 3300025229 | Ga0209147_100161 | Ga0209147_10016133 | 243 |
| 438 | 3300025229 | Ga0209147_100168 | Ga0209147_10016872 | 243 |
| 439 | 3300025229 | Ga0209147_100199 | Ga0209147_1001996 | 243 |
| 440 | 3300025242 | Ga0209258_100100 | Ga0209258_10010061 | 243 |
| 441 | 3300025242 | Ga0209258_100263 | Ga0209258_10026333 | 243 |
| 442 | 3300025254 | Ga0209148_1000630 | Ga0209148_100063014 | 243 |
| 443 | 3300025254 | Ga0209148_1001267 | Ga0209148_100126710 | 243 |
| 444 | 3300025256 | Ga0209759_1002552 | Ga0209759_10025529 | 243 |
| 445 | 3300025256 | Ga0209759_1023340 | Ga0209759_10233401 | 243 |
| 446 | 3300025263 | Ga0209565_1010916 | Ga0209565_10109163 | 243 |
| 447 | 3300025272 | Ga0209455_1000192 | Ga0209455_100019233 | 243 |
| 448 | 3300025272 | Ga0209455_1002064 | Ga0209455_10020646 | 243 |
| 449 | 3300025273 | Ga0209673_1000332 | Ga0209673_100033262 | 243 |
| 450 | 3300025284 | Ga0209130_1014437 | Ga0209130_10144371 | 243 |
| 451 | 3300025295 | Ga0209564_1001581 | Ga0209564_10015812 | 243 |
| 452 | 3300025295 | Ga0209564_1004794 | Ga0209564_10047942 | 243 |
| 453 | 3300025302 | Ga0207426_1000168 | Ga0207426_1000168137 | 243 |
| 454 | 3300025711 | Ga0207696_1027943 | Ga0207696_10279433 | 243 |
| 455 | 3300025735 | Ga0207713_1007559 | Ga0207713_10075596 | 243 |
| 456 | 3300025904 | Ga0207647_10000235 | Ga0207647_1000023522 | 243 |
| 457 | 3300025904 | Ga0207647_10000590 | Ga0207647_1000059011 | 243 |
| 458 | 3300025904 | Ga0207647_10005516 | Ga0207647_100055163 | 243 |
| 459 | 3300025913 | Ga0207695_10004347 | Ga0207695_1000434714 | 243 |
| 460 | 3300025913 | Ga0207695_10036589 | Ga0207695_100365894 | 243 |
| 461 | 3300025913 | Ga0207695_10051646 | Ga0207695_100516464 | 243 |
| 462 | 3300025913 | Ga0207695_10177497 | Ga0207695_101774972 | 243 |
| 463 | 3300025914 | Ga0207671_10047271 | Ga0207671_100472713 | 243 |
| 464 | 3300025919 | Ga0207657_10000068 | Ga0207657_1000006861 | 243 |
| 465 | 3300025919 | Ga0207657_10001021 | Ga0207657_100010215 | 243 |
| 466 | 3300025924 | Ga0207694_10181790 | Ga0207694_101817903 | 243 |
| 467 | 3300025932 | Ga0207690_10000027 | Ga0207690_1000002761 | 243 |
| 468 | 3300025932 | Ga0207690_10157782 | Ga0207690_101577822 | 243 |
| 469 | 3300025941 | Ga0207711_10026069 | Ga0207711_100260694 | 243 |
| 470 | 3300025945 | Ga0207679_10176225 | Ga0207679_101762251 | 243 |
| 471 | 3300025949 | Ga0207667_10024533 | Ga0207667_100245332 | 243 |
| 472 | 3300025949 | Ga0207667_10282489 | Ga0207667_102824892 | 243 |
| 473 | 3300025949 | Ga0207667_10295381 | Ga0207667_102953812 | 243 |
| 474 | 3300026067 | Ga0207678_10000386 | Ga0207678_1000038615 | 243 |
| 475 | 3300026078 | Ga0207702_10234875 | Ga0207702_102348752 | 243 |
| 476 | 3300026116 | Ga0207674_10235164 | Ga0207674_102351642 | 243 |
| 477 | 3300026142 | Ga0207698_10019463 | Ga0207698_100194632 | 243 |
| 478 | 3300027312 | Ga0209371_1000405 | Ga0209371_100040530 | 243 |
| 479 | 3300028800 | Ga0265338_10000557 | Ga0265338_1000055761 | 243 |
| 480 | 3300030500 | Ga0268256_1000345 | Ga0268256_100034519 | 243 |
| 481 | 3300031238 | Ga0265332_10046725 | Ga0265332_100467252 | 243 |
| 482 | 3300031247 | Ga0265340_10033340 | Ga0265340_100333402 | 243 |
| 483 | 3300037418 | Ga0395900_0000635 | Ga0395900_0000635_37193_37924 | 243 |
| 484 | 3300037418 | Ga0395900_0115375 | Ga0395900_0115375_381_1115 | 243 |
| 485 | 3300037418 | Ga0395900_0302667 | Ga0395900_0302667_92_823 | 243 |
| 486 | 3300037466 | Ga0395898_0001892 | Ga0395898_0001892_8355_9086 | 243 |
| 487 | 3300037466 | Ga0395898_0024305 | Ga0395898_0024305_5039_5770 | 243 |
| 488 | 3300037466 | Ga0395898_0043167 | Ga0395898_0043167_1787_2521 | 243 |
| 489 | 3300037471 | Ga0395905_0000012 | Ga0395905_0000012_14158_14889 | 243 |
| 490 | 3300037471 | Ga0395905_0043010 | Ga0395905_0043010_1895_2626 | 243 |
| 491 | 3300038443 | Ga0395901_0000002 | Ga0395901_0000002_704936_705667 | 243 |
| 492 | 3300038443 | Ga0395901_0000079 | Ga0395901_0000079_124563_125294 | 243 |
| 493 | 3300038443 | Ga0395901_0062632 | Ga0395901_0062632_2142_2873 | 243 |
| 494 | 3300038443 | Ga0395901_0265894 | Ga0395901_0265894_843_1574 | 243 |
| 495 | 3300038443 | Ga0395901_0268033 | Ga0395901_0268033_835_1566 | 243 |
| 496 | 3300039447 | Ga0436361_0723959 | Ga0436361_0723959_3462_4193 | 243 |
| 497 | 3300042005 | Ga0439448_0001158 | Ga0439448_0001158_3938_4672 | 243 |
| 498 | 3300044656 | Ga0466969_0018240 | Ga0466969_0018240_2374_3108 | 243 |
| 499 | 3300044656 | Ga0466969_0024770 | Ga0466969_0024770_780_1511 | 243 |
| 500 | 3300044658 | Ga0466972_0103974 | Ga0466972_0103974_460_1191 | 243 |
| 501 | 3300044659 | Ga0466973_0042623 | Ga0466973_0042623_3262_3993 | 243 |
| 502 | 3300044683 | Ga0466965_0000552 | Ga0466965_0000552_1887_2618 | 243 |
| 503 | 3300044683 | Ga0466965_0018142 | Ga0466965_0018142_846_1577 | 243 |
| 504 | 3300044683 | Ga0466965_0126631 | Ga0466965_0126631_460_1194 | 243 |
| 505 | 3300044684 | Ga0466966_0003017 | Ga0466966_0003017_6722_7453 | 243 |
| 506 | 3300044684 | Ga0466966_0005413 | Ga0466966_0005413_1246_1977 | 243 |
| 507 | 3300044684 | Ga0466966_0026815 | Ga0466966_0026815_499_1233 | 243 |
| 508 | 3300044684 | Ga0466966_0057976 | Ga0466966_0057976_204_935 | 243 |
| 509 | 3300044693 | Ga0466961_0004320 | Ga0466961_0004320_5718_6452 | 243 |
| 510 | 3300044693 | Ga0466961_0005705 | Ga0466961_0005705_4430_5161 | 243 |
| 511 | 3300044694 | Ga0466963_0000989 | Ga0466963_0000989_3034_3765 | 243 |
| 512 | 3300044694 | Ga0466963_0001909 | Ga0466963_0001909_1877_2608 | 243 |
| 513 | 3300044719 | Ga0466971_0005454 | Ga0466971_0005454_981_1712 | 243 |
| 514 | 3300044765 | Ga0466970_0035633 | Ga0466970_0035633_1683_2414 | 243 |
| 515 | 3300044765 | Ga0466970_0077386 | Ga0466970_0077386_847_1578 | 243 |
| 516 | 3300044842 | Ga0466957_0000377 | Ga0466957_0000377_13282_14013 | 243 |
| 517 | 3300045049 | Ga0466959_0001316 | Ga0466959_0001316_5488_6222 | 243 |
| 518 | 3300045836 | Ga0466958_0003652 | Ga0466958_0003652_6718_7449 | 243 |
| 519 | 3300046454 | Ga0495592_0277003 | Ga0495592_0277003_197_928 | 243 |
| 520 | 3300046455 | Ga0495603_0000924 | Ga0495603_0000924_10138_10869 | 243 |
| 521 | 3300046455 | Ga0495603_0017279 | Ga0495603_0017279_965_1696 | 243 |
| 522 | 3300046457 | Ga0495590_0000706 | Ga0495590_0000706_9244_9975 | 243 |
| 523 | 3300046457 | Ga0495590_0045035 | Ga0495590_0045035_432_1163 | 243 |
| 524 | 3300046459 | Ga0495629_0000774 | Ga0495629_0000774_13880_14611 | 243 |
| 525 | 3300046463 | Ga0495653_0041438 | Ga0495653_0041438_2115_2846 | 243 |
| 526 | 3300046471 | Ga0495650_0002070 | Ga0495650_0002070_13967_14698 | 243 |
| 527 | 3300046471 | Ga0495650_0094711 | Ga0495650_0094711_307_1038 | 243 |
| 528 | 3300046472 | Ga0495580_0008325 | Ga0495580_0008325_5081_5812 | 243 |
| 529 | 3300046472 | Ga0495580_0013673 | Ga0495580_0013673_3746_4477 | 243 |
| 530 | 3300046472 | Ga0495580_0285682 | Ga0495580_0285682_294_1025 | 243 |
| 531 | 3300046476 | Ga0495662_0036471 | Ga0495662_0036471_1131_1862 | 243 |
| 532 | 3300046477 | Ga0495664_0002778 | Ga0495664_0002778_8487_9218 | 243 |
| 533 | 3300046491 | Ga0495584_0025551 | Ga0495584_0025551_1269_2012 | 243 |
| 534 | 3300046492 | Ga0495585_0129372 | Ga0495585_0129372_564_1295 | 243 |
| 535 | 3300046507 | Ga0495606_0002948 | Ga0495606_0002948_9298_10029 | 243 |
| 536 | 3300046507 | Ga0495606_0036166 | Ga0495606_0036166_1364_2155 | 243 |
| 537 | 3300046507 | Ga0495606_0053361 | Ga0495606_0053361_234_977 | 243 |
| 538 | 3300046507 | Ga0495606_0135743 | Ga0495606_0135743_145_876 | 243 |
| 539 | 3300046516 | Ga0495628_0320477 | Ga0495628_0320477_143_874 | 243 |
| 540 | 3300046524 | Ga0495648_0055509 | Ga0495648_0055509_879_1610 | 243 |
| 541 | 3300046528 | Ga0495642_0144202 | Ga0495642_0144202_261_992 | 243 |
| 542 | 3300046529 | Ga0495652_0071993 | Ga0495652_0071993_904_1635 | 243 |
| 543 | 3300046530 | Ga0495654_0018564 | Ga0495654_0018564_414_1145 | 243 |
| 544 | 3300046531 | Ga0495665_0010913 | Ga0495665_0010913_2808_3539 | 243 |
| 545 | 3300046531 | Ga0495665_0022130 | Ga0495665_0022130_751_1482 | 243 |
| 546 | 3300046535 | Ga0495586_0098491 | Ga0495586_0098491_663_1394 | 243 |
| 547 | 3300046542 | Ga0495597_0004104 | Ga0495597_0004104_2846_3589 | 243 |
| 548 | 3300046543 | Ga0495645_0007762 | Ga0495645_0007762_2643_3374 | 243 |
| 549 | 3300046543 | Ga0495645_0058610 | Ga0495645_0058610_1404_2135 | 243 |
| 550 | 3300046648 | Ga0495611_0031701 | Ga0495611_0031701_178_909 | 243 |
| 551 | 3300046674 | Ga0495588_0014205 | Ga0495588_0014205_1360_2091 | 243 |
| 552 | 3300046680 | Ga0495646_0115462 | Ga0495646_0115462_246_977 | 243 |
| 553 | 3300046684 | Ga0495669_0020892 | Ga0495669_0020892_836_1627 | 243 |
| 554 | 3300046684 | Ga0495669_0109982 | Ga0495669_0109982_259_990 | 243 |
| 555 | 3300046692 | Ga0495671_0018661 | Ga0495671_0018661_1395_2126 | 243 |
| 556 | 3300046694 | Ga0495649_0008350 | Ga0495649_0008350_3394_4185 | 243 |
| 557 | 3300046794 | Ga0495589_0029786 | Ga0495589_0029786_1376_2167 | 243 |
| 558 | 3300046794 | Ga0495589_0052667 | Ga0495589_0052667_1138_1869 | 243 |
| 559 | 3300046794 | Ga0495589_0096473 | Ga0495589_0096473_683_1414 | 243 |
| 560 | 3300046809 | Ga0495600_0054630 | Ga0495600_0054630_1443_2174 | 243 |
| 561 | 3300047315 | Ga0495581_0001974 | Ga0495581_0001974_9818_10549 | 243 |
| 562 | 3300047317 | Ga0495604_0086967 | Ga0495604_0086967_920_1651 | 243 |
| 563 | 3300047319 | Ga0495674_0008236 | Ga0495674_0008236_6554_7285 | 243 |
| 564 | 3300047319 | Ga0495674_0013834 | Ga0495674_0013834_4565_5296 | 243 |
| 565 | 3300047319 | Ga0495674_0163930 | Ga0495674_0163930_548_1279 | 243 |
| 566 | 3300047323 | Ga0495683_0002040 | Ga0495683_0002040_9810_10553 | 243 |
| 567 | 3300047323 | Ga0495683_0012429 | Ga0495683_0012429_1426_2217 | 243 |
| 568 | 3300047323 | Ga0495683_0034712 | Ga0495683_0034712_1796_2527 | 243 |
| 569 | 3300047443 | Ga0495687_000025 | Ga0495687_000025_95061_95792 | 243 |
| 570 | 3300047444 | Ga0495675_0042986 | Ga0495675_0042986_628_1359 | 243 |
| 571 | 3300047673 | Ga0495593_0025150 | Ga0495593_0025150_35_766 | 243 |
| 572 | 3300048088 | Ga0495602_0011140 | Ga0495602_0011140_6294_7025 | 243 |
| 573 | 3300048088 | Ga0495602_0064861 | Ga0495602_0064861_1213_1944 | 243 |
| 574 | 3300048089 | Ga0495614_0018957 | Ga0495614_0018957_1370_2101 | 243 |
| 575 | 3300048091 | Ga0495626_0122937 | Ga0495626_0122937_48_791 | 243 |
| 576 | 3300048903 | Ga0496100_0000791 | Ga0496100_0000791_5073_5804 | 243 |
| 577 | 3300048903 | Ga0496100_0090560 | Ga0496100_0090560_244_975 | 243 |
| 578 | 3300048903 | Ga0496100_0517583 | Ga0496100_0517583_118_849 | 243 |
| 579 | 3300048904 | Ga0496101_0002729 | Ga0496101_0002729_3999_4742 | 243 |
| 580 | 3300048904 | Ga0496101_0005842 | Ga0496101_0005842_3159_3890 | 243 |
| 581 | 3300048904 | Ga0496101_0134029 | Ga0496101_0134029_710_1441 | 243 |
| 582 | 3300048904 | Ga0496101_0308613 | Ga0496101_0308613_61_792 | 243 |
| 583 | 3300048905 | Ga0496102_0008235 | Ga0496102_0008235_5026_5757 | 243 |
| 584 | 3300048905 | Ga0496102_0148342 | Ga0496102_0148342_457_1200 | 243 |
| 585 | 3300048906 | Ga0496103_0002256 | Ga0496103_0002256_3569_4300 | 243 |
| 586 | 3300048906 | Ga0496103_0004743 | Ga0496103_0004743_5168_5911 | 243 |
| 587 | 3300048907 | Ga0496104_0050043 | Ga0496104_0050043_2358_3089 | 243 |
| 588 | 3300048907 | Ga0496104_0379973 | Ga0496104_0379973_248_979 | 243 |
| 589 | 3300048908 | Ga0496105_0040038 | Ga0496105_0040038_3119_3850 | 243 |
| 590 | 3300048908 | Ga0496105_0187294 | Ga0496105_0187294_373_1116 | 243 |
| 591 | 3300048908 | Ga0496105_0396969 | Ga0496105_0396969_21_752 | 243 |
| 592 | 3300048909 | Ga0496106_0000053 | Ga0496106_0000053_17439_18170 | 243 |
| 593 | 3300048909 | Ga0496106_0043788 | Ga0496106_0043788_1881_2624 | 243 |
| 594 | 3300048909 | Ga0496106_0074774 | Ga0496106_0074774_849_1580 | 243 |
| 595 | 3300048910 | Ga0496107_0015100 | Ga0496107_0015100_1160_1903 | 243 |
| 596 | 3300048910 | Ga0496107_0120339 | Ga0496107_0120339_224_955 | 243 |
| 597 | 3300048912 | Ga0496109_0268345 | Ga0496109_0268345_692_1435 | 243 |
| 598 | 3300048913 | Ga0496110_0006687 | Ga0496110_0006687_5864_6607 | 243 |
| 599 | 3300048913 | Ga0496110_0370856 | Ga0496110_0370856_182_913 | 243 |
| 600 | 3300048914 | Ga0496111_0008603 | Ga0496111_0008603_3279_4022 | 243 |
| 601 | 3300048914 | Ga0496111_0247274 | Ga0496111_0247274_197_928 | 243 |
| 602 | 3300048915 | Ga0496112_0011544 | Ga0496112_0011544_5074_5805 | 243 |
| 603 | 3300048915 | Ga0496112_0025678 | Ga0496112_0025678_3904_4647 | 243 |
| 604 | 3300048916 | Ga0496113_0024627 | Ga0496113_0024627_484_1215 | 243 |
| 605 | 3300048916 | Ga0496113_0505574 | Ga0496113_0505574_114_845 | 243 |
| 606 | 3300048917 | Ga0496114_0001299 | Ga0496114_0001299_4100_4831 | 243 |
| 607 | 3300048918 | Ga0496115_0025883 | Ga0496115_0025883_1555_2286 | 243 |
| 608 | 3300048918 | Ga0496115_0047431 | Ga0496115_0047431_1353_2084 | 243 |
| 609 | 3300048919 | Ga0496116_0020686 | Ga0496116_0020686_2356_3099 | 243 |
| 610 | 3300048919 | Ga0496116_0050663 | Ga0496116_0050663_1590_2321 | 243 |
| 611 | 3300048919 | Ga0496116_0085578 | Ga0496116_0085578_774_1613 | 243 |
| 612 | 3300048919 | Ga0496116_0237236 | Ga0496116_0237236_19_750 | 243 |
| 613 | 3300048920 | Ga0496117_0002599 | Ga0496117_0002599_18550_19281 | 243 |
| 614 | 3300048920 | Ga0496117_0078535 | Ga0496117_0078535_586_1329 | 243 |
| 615 | 3300048921 | Ga0496118_0011356 | Ga0496118_0011356_3041_3772 | 243 |
| 616 | 3300048922 | Ga0496119_0119083 | Ga0496119_0119083_275_1006 | 243 |
| 617 | 3300048923 | Ga0496120_0194029 | Ga0496120_0194029_206_937 | 243 |
| 618 | 3300048924 | Ga0496121_0000585 | Ga0496121_0000585_49391_50122 | 243 |
| 619 | 3300048924 | Ga0496121_0003743 | Ga0496121_0003743_6635_7366 | 243 |
| 620 | 3300048924 | Ga0496121_0009234 | Ga0496121_0009234_3666_4409 | 243 |
| 621 | 3300048924 | Ga0496121_0016230 | Ga0496121_0016230_4815_5546 | 243 |
| 622 | 3300048924 | Ga0496121_0215272 | Ga0496121_0215272_169_900 | 243 |
| 623 | 3300048924 | Ga0496121_0221336 | Ga0496121_0221336_544_1275 | 243 |
| 624 | 3300048926 | Ga0496123_0012440 | Ga0496123_0012440_5934_6677 | 243 |
| 625 | 3300048928 | Ga0496125_0012344 | Ga0496125_0012344_3900_4643 | 243 |
| 626 | 3300048929 | Ga0496126_0006736 | Ga0496126_0006736_7585_8316 | 243 |
| 627 | 3300048929 | Ga0496126_0125160 | Ga0496126_0125160_1262_1993 | 243 |
| 628 | 3300048929 | Ga0496126_0249978 | Ga0496126_0249978_116_847 | 243 |
| 629 | 3300061719 | Ga0466962_0008250 | Ga0466962_0008250_3742_4473 | 243 |
| 630 | 3300061719 | Ga0466962_0010777 | Ga0466962_0010777_3300_4031 | 243 |
| 631 | iso_pu_bacteria | 2856287931 | 2856294010 | 243 |
| 632 | iso_pu_bacteria | 2857357740 | 2857362553 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e1b-assembly1.cif.gz_A | crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii | 0.906 | 2 | 243 |
| 2zzf-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase without oligomerization domain | 0.8941 | 1 | 243 |
| 2zze-assembly2.cif.gz_B | crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form | 0.8906 | 1 | 243 |
| 2e1b-assembly1.cif.gz_A | crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii | 0.8898 | 2 | 243 |
| 2zzg-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.8866 | 1 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57984_485_578_2.40.30.130 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9227 | 1 | 100 | 2.40.30.130 |
| 2ztgA03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9071 | 1 | 100 | 2.40.30.130 |
| 2zzeB03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.8961 | 1 | 98 | 2.40.30.130 |
| af_P40825_614_789_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.8879 | 101 | 243 | 3.30.980.10 |
| 2e1bA02 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.8717 | 101 | 243 | 3.30.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z6TGN1-F1-model_v4 | deleted | 0.9925 | 1 | 243 |
|
| AF-A0A3N8LL89-F1-model_v4 | Alanyl-tRNA editing protein | 0.9868 | 1 | 243 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A3N8LL89-F1-model_v4 | Alanyl-tRNA editing protein | 0.9828 | 1 | 243 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A2A5W6S6-F1-model_v4 | Threonyl/alanyl tRNA synthetase SAD domain-containing protein | 0.975 | 109 | 243 |
GO:0002161
GO:0004812 GO:0005524 GO:0043039 GO:0046872 |
| AF-A0A084Y4U1-F1-model_v4 | Alanine--tRNA ligase (EC 6.1.1.7) | 0.9748 | 2 | 243 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar