F470992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 632 | 318 | 632 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_11755453|Ga0105241_117554531 |
| Length | 114 |
| Sequence | MSADRMRRVNEAVREVLSDAVKLLKDPRVGFVTVTDVRTSPDLRHAKVFVSVLGSEQERAATMDGLASAHGVLQAAVNRELRMKRTPTLDFVYHDTAERADRLERMLADMEQPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 86 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 181 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 189 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 267 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 8.23 |
| Rhizosphere | 87.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10015002 | 3300003659 | Bacteria | 1683 |
| 2 | Ga0070676_10870389 | 3300005328 | Bacteria | 669 |
| 3 | Ga0070683_100316614 | 3300005329 | Bacteria | 1485 |
| 4 | Ga0070683_100878503 | 3300005329 | Unclassified | 860 |
| 5 | Ga0068869_100266591 | 3300005334 | Bacteria | 1373 |
| 6 | Ga0068869_100680320 | 3300005334 | Unclassified | 876 |
| 7 | Ga0068869_101152264 | 3300005334 | Bacteria | 680 |
| 8 | Ga0068869_101958055 | 3300005334 | Bacteria | 525 |
| 9 | Ga0070680_101986540 | 3300005336 | Unclassified | 504 |
| 10 | Ga0068868_100026801 | 3300005338 | Bacteria | 4394 |
| 11 | Ga0068868_100380787 | 3300005338 | Bacteria | 1214 |
| 12 | Ga0068868_100563877 | 3300005338 | Bacteria | 1005 |
| 13 | Ga0068868_100839825 | 3300005338 | Bacteria | 831 |
| 14 | Ga0070660_100112750 | 3300005339 | Bacteria | 2165 |
| 15 | Ga0070660_101343221 | 3300005339 | Bacteria | 607 |
| 16 | Ga0070689_101625001 | 3300005340 | Bacteria | 587 |
| 17 | Ga0070661_100325646 | 3300005344 | Bacteria | 1201 |
| 18 | Ga0070661_100400758 | 3300005344 | Bacteria | 1085 |
| 19 | Ga0070661_100806128 | 3300005344 | Bacteria | 771 |
| 20 | Ga0070692_10143735 | 3300005345 | Bacteria | 1353 |
| 21 | Ga0070668_100293002 | 3300005347 | Bacteria | 1363 |
| 22 | Ga0070668_100803647 | 3300005347 | Bacteria | 836 |
| 23 | Ga0070669_100063759 | 3300005353 | Bacteria | 2713 |
| 24 | Ga0070669_100233670 | 3300005353 | Bacteria | 1458 |
| 25 | Ga0070669_100864457 | 3300005353 | Bacteria | 771 |
| 26 | Ga0070674_100450765 | 3300005356 | Bacteria | 1062 |
| 27 | Ga0070674_101942422 | 3300005356 | Bacteria | 535 |
| 28 | Ga0070673_100669566 | 3300005364 | Bacteria | 951 |
| 29 | Ga0070659_100001291 | 3300005366 | Bacteria | 18154 |
| 30 | Ga0070659_100148371 | 3300005366 | Bacteria | 1912 |
| 31 | Ga0070659_100499116 | 3300005366 | Bacteria | 1037 |
| 32 | Ga0070659_100692533 | 3300005366 | Bacteria | 881 |
| 33 | Ga0070659_100843173 | 3300005366 | Bacteria | 799 |
| 34 | Ga0070659_100984434 | 3300005366 | Bacteria | 740 |
| 35 | Ga0070667_101060114 | 3300005367 | Bacteria | 757 |
| 36 | Ga0070709_11403648 | 3300005434 | Unclassified | 565 |
| 37 | Ga0070714_100030323 | 3300005435 | Bacteria | 4500 |
| 38 | Ga0070714_100172337 | 3300005435 | Bacteria | 1964 |
| 39 | Ga0070714_100175770 | 3300005435 | Bacteria | 1945 |
| 40 | Ga0070714_100856214 | 3300005435 | Bacteria | 882 |
| 41 | Ga0070714_102166056 | 3300005435 | Unclassified | 541 |
| 42 | Ga0070713_100139778 | 3300005436 | Bacteria | 2144 |
| 43 | Ga0070713_100660759 | 3300005436 | Bacteria | 996 |
| 44 | Ga0070713_101352783 | 3300005436 | Unclassified | 690 |
| 45 | Ga0070710_10061767 | 3300005437 | Bacteria | 2135 |
| 46 | Ga0070710_10565250 | 3300005437 | Unclassified | 787 |
| 47 | Ga0070710_10733617 | 3300005437 | Unclassified | 700 |
| 48 | Ga0070701_10300059 | 3300005438 | Bacteria | 987 |
| 49 | Ga0070701_10354983 | 3300005438 | Unclassified | 917 |
| 50 | Ga0070701_10482080 | 3300005438 | Bacteria | 802 |
| 51 | Ga0070711_100028025 | 3300005439 | Bacteria | 3702 |
| 52 | Ga0070711_100801577 | 3300005439 | Bacteria | 799 |
| 53 | Ga0070705_100003636 | 3300005440 | Bacteria | 7548 |
| 54 | Ga0070700_100186125 | 3300005441 | Bacteria | 1449 |
| 55 | Ga0070694_101116812 | 3300005444 | Unclassified | 658 |
| 56 | Ga0070708_101405723 | 3300005445 | Bacteria | 651 |
| 57 | Ga0070663_101085892 | 3300005455 | Bacteria | 699 |
| 58 | Ga0070663_102074929 | 3300005455 | Bacteria | 512 |
| 59 | Ga0070678_101198659 | 3300005456 | Bacteria | 704 |
| 60 | Ga0070662_100049793 | 3300005457 | Bacteria | 3022 |
| 61 | Ga0070662_100213214 | 3300005457 | Bacteria | 1537 |
| 62 | Ga0070662_100482829 | 3300005457 | Bacteria | 1032 |
| 63 | Ga0068867_100180407 | 3300005459 | Bacteria | 1678 |
| 64 | Ga0068867_100322171 | 3300005459 | Bacteria | 1281 |
| 65 | Ga0070684_100166434 | 3300005535 | Bacteria | 2001 |
| 66 | Ga0070684_100811943 | 3300005535 | Bacteria | 875 |
| 67 | Ga0070697_100985412 | 3300005536 | Bacteria | 749 |
| 68 | Ga0070672_100858029 | 3300005543 | Bacteria | 801 |
| 69 | Ga0070686_100274291 | 3300005544 | Bacteria | 1241 |
| 70 | Ga0070686_101591316 | 3300005544 | Bacteria | 553 |
| 71 | Ga0070695_100426192 | 3300005545 | Unclassified | 1011 |
| 72 | Ga0070693_100909828 | 3300005547 | Bacteria | 660 |
| 73 | Ga0070693_101300283 | 3300005547 | Unclassified | 562 |
| 74 | Ga0070665_100149577 | 3300005548 | Bacteria | 2338 |
| 75 | Ga0070704_100293977 | 3300005549 | Bacteria | 1351 |
| 76 | Ga0070704_101684568 | 3300005549 | Unclassified | 586 |
| 77 | Ga0070664_100033731 | 3300005564 | Bacteria | 4290 |
| 78 | Ga0070664_100431824 | 3300005564 | Bacteria | 1207 |
| 79 | Ga0070664_100434965 | 3300005564 | Bacteria | 1203 |
| 80 | Ga0070664_101400759 | 3300005564 | Bacteria | 661 |
| 81 | Ga0068857_100134302 | 3300005577 | Bacteria | 2234 |
| 82 | Ga0068857_100211718 | 3300005577 | Bacteria | 1769 |
| 83 | Ga0068854_100409567 | 3300005578 | Bacteria | 1124 |
| 84 | Ga0068854_100437044 | 3300005578 | Bacteria | 1090 |
| 85 | Ga0068856_100104790 | 3300005614 | Bacteria | 2823 |
| 86 | Ga0068856_101113527 | 3300005614 | Bacteria | 807 |
| 87 | Ga0068856_101534788 | 3300005614 | Bacteria | 680 |
| 88 | Ga0068856_101870159 | 3300005614 | Bacteria | 611 |
| 89 | Ga0068856_102467832 | 3300005614 | Unclassified | 527 |
| 90 | Ga0070702_100005728 | 3300005615 | Bacteria | 5817 |
| 91 | Ga0070702_100785989 | 3300005615 | Bacteria | 735 |
| 92 | Ga0070702_101862884 | 3300005615 | Bacteria | 504 |
| 93 | Ga0068852_100212996 | 3300005616 | Bacteria | 1834 |
| 94 | Ga0068852_100534027 | 3300005616 | Bacteria | 1172 |
| 95 | Ga0068852_101489052 | 3300005616 | Unclassified | 699 |
| 96 | Ga0068852_101587235 | 3300005616 | Bacteria | 677 |
| 97 | Ga0068859_100559774 | 3300005617 | Bacteria | 1237 |
| 98 | Ga0068859_100652156 | 3300005617 | Bacteria | 1145 |
| 99 | Ga0068864_100456665 | 3300005618 | Bacteria | 1222 |
| 100 | Ga0068866_10066783 | 3300005718 | Bacteria | 1886 |
| 101 | Ga0068866_10292550 | 3300005718 | Unclassified | 1014 |
| 102 | Ga0068866_10376082 | 3300005718 | Bacteria | 910 |
| 103 | Ga0068861_100047929 | 3300005719 | Bacteria | 3227 |
| 104 | Ga0068861_100208453 | 3300005719 | Bacteria | 1645 |
| 105 | Ga0068861_102155239 | 3300005719 | Unclassified | 558 |
| 106 | Ga0068870_10601573 | 3300005840 | Bacteria | 747 |
| 107 | Ga0068863_100766542 | 3300005841 | Bacteria | 961 |
| 108 | Ga0068863_100862516 | 3300005841 | Bacteria | 905 |
| 109 | Ga0068863_101021383 | 3300005841 | Bacteria | 830 |
| 110 | Ga0068858_101155261 | 3300005842 | Bacteria | 761 |
| 111 | Ga0068862_100410166 | 3300005844 | Bacteria | 1269 |
| 112 | Ga0081455_10002456 | 3300005937 | Bacteria | 22063 |
| 113 | Ga0081455_10093906 | 3300005937 | Bacteria | 2424 |
| 114 | Ga0081455_10136625 | 3300005937 | Bacteria | 1909 |
| 115 | Ga0081455_10488256 | 3300005937 | Bacteria | 831 |
| 116 | Ga0081538_10007594 | 3300005981 | Bacteria | 9353 |
| 117 | Ga0081538_10082828 | 3300005981 | Bacteria | 1699 |
| 118 | Ga0081540_1002479 | 3300005983 | Bacteria | 15034 |
| 119 | Ga0081540_1059534 | 3300005983 | Bacteria | 1833 |
| 120 | Ga0081539_10008072 | 3300005985 | Bacteria | 9317 |
| 121 | Ga0070717_10000019 | 3300006028 | Bacteria | 178051 |
| 122 | Ga0070717_10645308 | 3300006028 | Bacteria | 961 |
| 123 | Ga0070717_11436225 | 3300006028 | Unclassified | 626 |
| 124 | Ga0075365_10453002 | 3300006038 | Bacteria | 906 |
| 125 | Ga0075432_10197346 | 3300006058 | Bacteria | 795 |
| 126 | Ga0075432_10609814 | 3300006058 | Bacteria | 500 |
| 127 | Ga0070715_10248258 | 3300006163 | Bacteria | 929 |
| 128 | Ga0070716_100048773 | 3300006173 | Bacteria | 2396 |
| 129 | Ga0070712_100017563 | 3300006175 | Bacteria | 4633 |
| 130 | Ga0070712_100190652 | 3300006175 | Bacteria | 1604 |
| 131 | Ga0075428_100143651 | 3300006844 | Bacteria | 2594 |
| 132 | Ga0075430_100023879 | 3300006846 | Bacteria | 5206 |
| 133 | Ga0075431_100035801 | 3300006847 | Bacteria | 5111 |
| 134 | Ga0075431_100484749 | 3300006847 | Bacteria | 1229 |
| 135 | Ga0075434_102019241 | 3300006871 | Bacteria | 582 |
| 136 | Ga0075429_100009960 | 3300006880 | Bacteria | 8236 |
| 137 | Ga0068865_100402804 | 3300006881 | Bacteria | 1121 |
| 138 | Ga0068865_101315613 | 3300006881 | Unclassified | 643 |
| 139 | Ga0068865_101899332 | 3300006881 | Bacteria | 539 |
| 140 | Ga0068865_102128456 | 3300006881 | Unclassified | 510 |
| 141 | Ga0097620_100559802 | 3300006931 | Bacteria | 1237 |
| 142 | Ga0097620_100652153 | 3300006931 | Bacteria | 1145 |
| 143 | Ga0075435_100576793 | 3300007076 | Bacteria | 975 |
| 144 | Ga0075435_100924675 | 3300007076 | Unclassified | 761 |
| 145 | Ga0105240_10122371 | 3300009093 | Bacteria | 3131 |
| 146 | Ga0105240_12536605 | 3300009093 | Unclassified | 530 |
| 147 | Ga0111539_10605093 | 3300009094 | Bacteria | 1276 |
| 148 | Ga0111539_11698353 | 3300009094 | Bacteria | 732 |
| 149 | Ga0111539_12329515 | 3300009094 | Unclassified | 621 |
| 150 | Ga0105245_10019447 | 3300009098 | Bacteria | 5950 |
| 151 | Ga0105245_10116838 | 3300009098 | Bacteria | 2488 |
| 152 | Ga0105245_10166028 | 3300009098 | Bacteria | 2099 |
| 153 | Ga0105245_10985577 | 3300009098 | Bacteria | 887 |
| 154 | Ga0105245_11162312 | 3300009098 | Bacteria | 819 |
| 155 | Ga0105245_13129100 | 3300009098 | Bacteria | 513 |
| 156 | Ga0105247_10153187 | 3300009101 | Bacteria | 1520 |
| 157 | Ga0105247_10490994 | 3300009101 | Bacteria | 893 |
| 158 | Ga0114129_10265746 | 3300009147 | Bacteria | 2297 |
| 159 | Ga0105243_10083402 | 3300009148 | Bacteria | 2615 |
| 160 | Ga0105243_10126617 | 3300009148 | Bacteria | 2162 |
| 161 | Ga0105243_10987886 | 3300009148 | Bacteria | 843 |
| 162 | Ga0105243_12277700 | 3300009148 | Unclassified | 579 |
| 163 | Ga0105241_11066946 | 3300009174 | Unclassified | 759 |
| 164 | Ga0105241_11755453 | 3300009174 | Bacteria | 604 |
| 165 | Ga0105242_10003748 | 3300009176 | Bacteria | 11810 |
| 166 | Ga0105242_10414922 | 3300009176 | Bacteria | 1260 |
| 167 | Ga0105242_10935462 | 3300009176 | Bacteria | 870 |
| 168 | Ga0105248_11488131 | 3300009177 | Bacteria | 766 |
| 169 | Ga0105237_12111398 | 3300009545 | Bacteria | 572 |
| 170 | Ga0105238_10813446 | 3300009551 | Bacteria | 950 |
| 171 | Ga0105249_10152728 | 3300009553 | Bacteria | 2224 |
| 172 | Ga0105249_11320746 | 3300009553 | Bacteria | 793 |
| 173 | Ga0105249_12718523 | 3300009553 | Bacteria | 567 |
| 174 | Ga0105249_12839180 | 3300009553 | Bacteria | 556 |
| 175 | Ga0105239_11031001 | 3300010375 | Unclassified | 946 |
| 176 | Ga0105239_11452629 | 3300010375 | Unclassified | 792 |
| 177 | Ga0105246_10040064 | 3300011119 | Bacteria | 3160 |
| 178 | Ga0105246_10118851 | 3300011119 | Bacteria | 1955 |
| 179 | Ga0157321_1038485 | 3300012487 | Bacteria | 517 |
| 180 | Ga0157323_1041619 | 3300012495 | Bacteria | 529 |
| 181 | Ga0157373_11259909 | 3300013100 | Unclassified | 559 |
| 182 | Ga0157371_10878615 | 3300013102 | Bacteria | 679 |
| 183 | Ga0157369_11610525 | 3300013105 | Bacteria | 660 |
| 184 | Ga0157378_11993696 | 3300013297 | Unclassified | 630 |
| 185 | Ga0163162_11406603 | 3300013306 | Bacteria | 794 |
| 186 | Ga0157372_10410900 | 3300013307 | Bacteria | 1577 |
| 187 | Ga0157372_10667058 | 3300013307 | Bacteria | 1211 |
| 188 | Ga0157372_13222670 | 3300013307 | Bacteria | 520 |
| 189 | Ga0157375_11276997 | 3300013308 | Bacteria | 863 |
| 190 | Ga0157375_11530306 | 3300013308 | Unclassified | 788 |
| 191 | Ga0157375_13345931 | 3300013308 | Unclassified | 534 |
| 192 | Ga0163163_10992998 | 3300014325 | Bacteria | 903 |
| 193 | Ga0163163_11799166 | 3300014325 | Bacteria | 673 |
| 194 | Ga0157380_10348765 | 3300014326 | Bacteria | 1384 |
| 195 | Ga0157380_10430707 | 3300014326 | Bacteria | 1261 |
| 196 | Ga0157380_12417556 | 3300014326 | Bacteria | 591 |
| 197 | Ga0182008_10137868 | 3300014497 | Bacteria | 1219 |
| 198 | Ga0182008_10202468 | 3300014497 | Bacteria | 1010 |
| 199 | Ga0157377_10631643 | 3300014745 | Bacteria | 768 |
| 200 | Ga0157379_10003495 | 3300014968 | Bacteria | 13314 |
| 201 | Ga0157376_10850266 | 3300014969 | Bacteria | 928 |
| 202 | Ga0163161_10713870 | 3300017792 | Bacteria | 836 |
| 203 | Ga0206353_11254423 | 3300020082 | Bacteria | 1241 |
| 204 | Ga0213874_10018401 | 3300021377 | Bacteria | 1887 |
| 205 | Ga0213874_10038510 | 3300021377 | Bacteria | 1419 |
| 206 | Ga0213874_10278177 | 3300021377 | Unclassified | 624 |
| 207 | Ga0213874_10467612 | 3300021377 | Unclassified | 500 |
| 208 | Ga0213876_10015018 | 3300021384 | Bacteria | 4104 |
| 209 | Ga0213876_10017120 | 3300021384 | Bacteria | 3827 |
| 210 | Ga0213875_10011653 | 3300021388 | Bacteria | 4368 |
| 211 | Ga0213875_10024360 | 3300021388 | Bacteria | 2887 |
| 212 | Ga0207692_10427142 | 3300025898 | Bacteria | 830 |
| 213 | Ga0207692_10428981 | 3300025898 | Unclassified | 829 |
| 214 | Ga0207692_10895745 | 3300025898 | Bacteria | 583 |
| 215 | Ga0207642_10024985 | 3300025899 | Bacteria | 2410 |
| 216 | Ga0207688_10018945 | 3300025901 | Bacteria | 3745 |
| 217 | Ga0207688_10270993 | 3300025901 | Bacteria | 1032 |
| 218 | Ga0207688_10853890 | 3300025901 | Bacteria | 577 |
| 219 | Ga0207699_10199976 | 3300025906 | Bacteria | 1353 |
| 220 | Ga0207699_10992390 | 3300025906 | Unclassified | 621 |
| 221 | Ga0207699_11330602 | 3300025906 | Unclassified | 532 |
| 222 | Ga0207645_10034910 | 3300025907 | Bacteria | 3229 |
| 223 | Ga0207695_10035094 | 3300025913 | Bacteria | 5444 |
| 224 | Ga0207693_10000017 | 3300025915 | Bacteria | 139308 |
| 225 | Ga0207693_10008897 | 3300025915 | Bacteria | 8203 |
| 226 | Ga0207693_10197597 | 3300025915 | Bacteria | 1582 |
| 227 | Ga0207693_10597626 | 3300025915 | Bacteria | 859 |
| 228 | Ga0207663_10196188 | 3300025916 | Bacteria | 1453 |
| 229 | Ga0207663_10295216 | 3300025916 | Bacteria | 1209 |
| 230 | Ga0207662_10896355 | 3300025918 | Bacteria | 628 |
| 231 | Ga0207657_10173108 | 3300025919 | Bacteria | 1748 |
| 232 | Ga0207649_10638901 | 3300025920 | Bacteria | 821 |
| 233 | Ga0207649_11304552 | 3300025920 | Bacteria | 574 |
| 234 | Ga0207681_10004254 | 3300025923 | Bacteria | 8837 |
| 235 | Ga0207681_10837647 | 3300025923 | Bacteria | 769 |
| 236 | Ga0207687_10189845 | 3300025927 | Bacteria | 1598 |
| 237 | Ga0207687_10773495 | 3300025927 | Bacteria | 818 |
| 238 | Ga0207687_10872944 | 3300025927 | Unclassified | 769 |
| 239 | Ga0207700_10713213 | 3300025928 | Bacteria | 896 |
| 240 | Ga0207700_11015812 | 3300025928 | Unclassified | 742 |
| 241 | Ga0207664_10089694 | 3300025929 | Bacteria | 2518 |
| 242 | Ga0207664_10103740 | 3300025929 | Bacteria | 2353 |
| 243 | Ga0207664_10107821 | 3300025929 | Bacteria | 2311 |
| 244 | Ga0207690_10000061 | 3300025932 | Bacteria | 98910 |
| 245 | Ga0207690_10253094 | 3300025932 | Bacteria | 1361 |
| 246 | Ga0207690_10634207 | 3300025932 | Bacteria | 874 |
| 247 | Ga0207706_10041686 | 3300025933 | Bacteria | 4069 |
| 248 | Ga0207706_10755822 | 3300025933 | Bacteria | 828 |
| 249 | Ga0207686_10375023 | 3300025934 | Bacteria | 1077 |
| 250 | Ga0207686_10428683 | 3300025934 | Bacteria | 1013 |
| 251 | Ga0207709_10571420 | 3300025935 | Bacteria | 892 |
| 252 | Ga0207709_11032772 | 3300025935 | Bacteria | 673 |
| 253 | Ga0207709_11077373 | 3300025935 | Bacteria | 659 |
| 254 | Ga0207709_11107119 | 3300025935 | Bacteria | 650 |
| 255 | Ga0207669_10673705 | 3300025937 | Bacteria | 848 |
| 256 | Ga0207704_11163090 | 3300025938 | Bacteria | 657 |
| 257 | Ga0207704_11251900 | 3300025938 | Bacteria | 633 |
| 258 | Ga0207665_10039880 | 3300025939 | Bacteria | 3132 |
| 259 | Ga0207665_11364378 | 3300025939 | Unclassified | 565 |
| 260 | Ga0207691_10424153 | 3300025940 | Bacteria | 1133 |
| 261 | Ga0207689_10383692 | 3300025942 | Bacteria | 1170 |
| 262 | Ga0207689_10459246 | 3300025942 | Bacteria | 1065 |
| 263 | Ga0207689_10593340 | 3300025942 | Unclassified | 932 |
| 264 | Ga0207661_10574834 | 3300025944 | Bacteria | 1033 |
| 265 | Ga0207661_10754000 | 3300025944 | Unclassified | 896 |
| 266 | Ga0207661_10772017 | 3300025944 | Bacteria | 885 |
| 267 | Ga0207679_10079850 | 3300025945 | Bacteria | 2496 |
| 268 | Ga0207679_10861566 | 3300025945 | Bacteria | 828 |
| 269 | Ga0207679_11868187 | 3300025945 | Unclassified | 548 |
| 270 | Ga0207679_11882860 | 3300025945 | Bacteria | 546 |
| 271 | Ga0207712_10584663 | 3300025961 | Bacteria | 964 |
| 272 | Ga0207668_10559343 | 3300025972 | Bacteria | 992 |
| 273 | Ga0207640_10155430 | 3300025981 | Bacteria | 1685 |
| 274 | Ga0207640_10340732 | 3300025981 | Bacteria | 1201 |
| 275 | Ga0207640_10664354 | 3300025981 | Bacteria | 889 |
| 276 | Ga0207640_10781346 | 3300025981 | Bacteria | 826 |
| 277 | Ga0207640_11971220 | 3300025981 | Bacteria | 529 |
| 278 | Ga0207677_10696132 | 3300026023 | Bacteria | 901 |
| 279 | Ga0207677_10823894 | 3300026023 | Bacteria | 832 |
| 280 | Ga0207703_10258439 | 3300026035 | Bacteria | 1573 |
| 281 | Ga0207703_11152725 | 3300026035 | Bacteria | 745 |
| 282 | Ga0207678_10113326 | 3300026067 | Bacteria | 2314 |
| 283 | Ga0207678_10136306 | 3300026067 | Bacteria | 2094 |
| 284 | Ga0207678_10561378 | 3300026067 | Bacteria | 999 |
| 285 | Ga0207678_10571448 | 3300026067 | Bacteria | 990 |
| 286 | Ga0207708_10027228 | 3300026075 | Bacteria | 4328 |
| 287 | Ga0207708_10113581 | 3300026075 | Bacteria | 2105 |
| 288 | Ga0207702_10051574 | 3300026078 | Bacteria | 3478 |
| 289 | Ga0207702_10258612 | 3300026078 | Bacteria | 1638 |
| 290 | Ga0207702_10973485 | 3300026078 | Unclassified | 841 |
| 291 | Ga0207702_11343288 | 3300026078 | Unclassified | 709 |
| 292 | Ga0207641_10369115 | 3300026088 | Bacteria | 1372 |
| 293 | Ga0207648_10085987 | 3300026089 | Bacteria | 2743 |
| 294 | Ga0207648_10582169 | 3300026089 | Bacteria | 1030 |
| 295 | Ga0207676_10318792 | 3300026095 | Bacteria | 1426 |
| 296 | Ga0207676_10397276 | 3300026095 | Bacteria | 1287 |
| 297 | Ga0207676_11546448 | 3300026095 | Bacteria | 661 |
| 298 | Ga0207674_10153416 | 3300026116 | Bacteria | 2259 |
| 299 | Ga0207674_10222943 | 3300026116 | Bacteria | 1834 |
| 300 | Ga0207674_10864087 | 3300026116 | Bacteria | 872 |
| 301 | Ga0207675_100022184 | 3300026118 | Bacteria | 5912 |
| 302 | Ga0207675_100653356 | 3300026118 | Bacteria | 1058 |
| 303 | Ga0207675_101414560 | 3300026118 | Bacteria | 716 |
| 304 | Ga0207683_10130758 | 3300026121 | Bacteria | 2258 |
| 305 | Ga0207698_10234543 | 3300026142 | Bacteria | 1668 |
| 306 | Ga0207698_10589550 | 3300026142 | Bacteria | 1095 |
| 307 | Ga0207698_10636098 | 3300026142 | Bacteria | 1055 |
| 308 | Ga0207698_10859223 | 3300026142 | Bacteria | 913 |
| 309 | Ga0207698_11066725 | 3300026142 | Unclassified | 820 |
| 310 | Ga0207428_10549193 | 3300027907 | Bacteria | 836 |
| 311 | Ga0207428_10818547 | 3300027907 | Bacteria | 661 |
| 312 | Ga0268265_11120436 | 3300028380 | Bacteria | 782 |
| 313 | Ga0265338_10074044 | 3300028800 | Bacteria | 2899 |
| 314 | Ga0307408_100345906 | 3300031548 | Bacteria | 1260 |
| 315 | Ga0307408_100856804 | 3300031548 | Bacteria | 829 |
| 316 | Ga0307408_100994476 | 3300031548 | Bacteria | 773 |
| 317 | Ga0307405_10030476 | 3300031731 | Bacteria | 3164 |
| 318 | Ga0307405_10881403 | 3300031731 | Bacteria | 756 |
| 319 | Ga0307413_10187275 | 3300031824 | Bacteria | 1482 |
| 320 | Ga0307410_10474826 | 3300031852 | Bacteria | 1025 |
| 321 | Ga0307410_10490022 | 3300031852 | Bacteria | 1010 |
| 322 | Ga0307410_11384391 | 3300031852 | Bacteria | 617 |
| 323 | Ga0326468_10004933 | 3300031889 | Bacteria | 1182 |
| 324 | Ga0307406_10201277 | 3300031901 | Bacteria | 1466 |
| 325 | Ga0307406_11507981 | 3300031901 | Bacteria | 592 |
| 326 | Ga0307407_10157396 | 3300031903 | Bacteria | 1483 |
| 327 | Ga0307412_10320413 | 3300031911 | Bacteria | 1233 |
| 328 | Ga0307412_10689299 | 3300031911 | Bacteria | 876 |
| 329 | Ga0307409_100025284 | 3300031995 | Bacteria | 4161 |
| 330 | Ga0307409_100273742 | 3300031995 | Bacteria | 1556 |
| 331 | Ga0307409_100549990 | 3300031995 | Bacteria | 1133 |
| 332 | Ga0307409_100568157 | 3300031995 | Bacteria | 1116 |
| 333 | Ga0307409_100758223 | 3300031995 | Bacteria | 975 |
| 334 | Ga0307409_101292936 | 3300031995 | Bacteria | 754 |
| 335 | Ga0307409_101509063 | 3300031995 | Bacteria | 699 |
| 336 | Ga0307416_100085961 | 3300032002 | Bacteria | 2679 |
| 337 | Ga0307416_100172523 | 3300032002 | Bacteria | 2015 |
| 338 | Ga0307416_100642553 | 3300032002 | Bacteria | 1145 |
| 339 | Ga0307416_100731750 | 3300032002 | Bacteria | 1081 |
| 340 | Ga0307416_103725721 | 3300032002 | Bacteria | 510 |
| 341 | Ga0307414_10637093 | 3300032004 | Bacteria | 960 |
| 342 | Ga0307414_10788800 | 3300032004 | Bacteria | 866 |
| 343 | Ga0307411_10024381 | 3300032005 | Bacteria | 3605 |
| 344 | Ga0307411_10518041 | 3300032005 | Bacteria | 1012 |
| 345 | Ga0307411_12048751 | 3300032005 | Bacteria | 535 |
| 346 | Ga0307415_100010639 | 3300032126 | Bacteria | 5219 |
| 347 | Ga0307415_100027856 | 3300032126 | Bacteria | 3586 |
| 348 | Ga0307415_100530126 | 3300032126 | Bacteria | 1035 |
| 349 | Ga0307415_102062046 | 3300032126 | Bacteria | 556 |
| 350 | Ga0373941_0502722 | 3300035115 | Bacteria | 516 |
| 351 | Ga0373953_0072191 | 3300035117 | Bacteria | 1425 |
| 352 | Ga0373943_0445205 | 3300035170 | Unclassified | 752 |
| 353 | Ga0373955_0027472 | 3300035172 | Bacteria | 2943 |
| 354 | Ga0373924_0017046 | 3300035410 | Bacteria | 2782 |
| 355 | Ga0373933_0026577 | 3300035724 | Bacteria | 3325 |
| 356 | Ga0373947_0032518 | 3300035725 | Bacteria | 3075 |
| 357 | Ga0373937_0138829 | 3300036401 | Bacteria | 2273 |
| 358 | Ga0373925_1747136 | 3300037068 | Bacteria | 508 |
| 359 | Ga0395900_0254235 | 3300037418 | Bacteria | 1757 |
| 360 | Ga0395900_0263531 | 3300037418 | Bacteria | 1720 |
| 361 | Ga0395898_0237749 | 3300037466 | Bacteria | 1737 |
| 362 | Ga0436364_0316558 | 3300037853 | Bacteria | 683 |
| 363 | Ga0436364_0419300 | 3300037853 | Unclassified | 533 |
| 364 | Ga0436364_0953233 | 3300037853 | Bacteria | 2786 |
| 365 | Ga0436364_1211610 | 3300037853 | Bacteria | 6876 |
| 366 | Ga0395901_0338210 | 3300038443 | Bacteria | 1555 |
| 367 | Ga0395901_1282157 | 3300038443 | Bacteria | 695 |
| 368 | Ga0436365_0402599 | 3300039437 | Bacteria | 4130 |
| 369 | Ga0436365_0446222 | 3300039437 | Bacteria | 690 |
| 370 | Ga0436365_0785088 | 3300039437 | Bacteria | 2288 |
| 371 | Ga0436365_1499059 | 3300039437 | Bacteria | 5892 |
| 372 | Ga0436363_0260166 | 3300039450 | Bacteria | 3255 |
| 373 | Ga0436363_0262026 | 3300039450 | Bacteria | 907 |
| 374 | Ga0436363_0390993 | 3300039450 | Unclassified | 629 |
| 375 | Ga0436363_0808016 | 3300039450 | Unclassified | 715 |
| 376 | Ga0436363_1162396 | 3300039450 | Unclassified | 621 |
| 377 | Ga0436363_1413016 | 3300039450 | Bacteria | 603 |
| 378 | Ga0451802_1039879 | 3300041460 | Bacteria | 537 |
| 379 | Ga0451807_2036011 | 3300041486 | Bacteria | 509 |
| 380 | Ga0451853_0803757 | 3300041512 | Bacteria | 1398 |
| 381 | Ga0451853_3624238 | 3300041512 | Bacteria | 971 |
| 382 | Ga0439463_041862 | 3300042016 | Bacteria | 1165 |
| 383 | Ga0439459_0117061 | 3300042438 | Bacteria | 668 |
| 384 | Ga0466969_0556136 | 3300044656 | Bacteria | 525 |
| 385 | Ga0466969_0586359 | 3300044656 | Unclassified | 511 |
| 386 | Ga0466965_0460710 | 3300044683 | Unclassified | 709 |
| 387 | Ga0466966_0080562 | 3300044684 | Bacteria | 2028 |
| 388 | Ga0466966_0148259 | 3300044684 | Bacteria | 1432 |
| 389 | Ga0466966_0410088 | 3300044684 | Bacteria | 814 |
| 390 | Ga0466961_0115783 | 3300044693 | Bacteria | 1685 |
| 391 | Ga0466961_0207911 | 3300044693 | Bacteria | 1209 |
| 392 | Ga0466961_0615954 | 3300044693 | Bacteria | 652 |
| 393 | Ga0466963_0115480 | 3300044694 | Bacteria | 1845 |
| 394 | Ga0466963_0159345 | 3300044694 | Bacteria | 1570 |
| 395 | Ga0466963_0299681 | 3300044694 | Bacteria | 1130 |
| 396 | Ga0466963_0773579 | 3300044694 | Unclassified | 677 |
| 397 | Ga0466963_0918491 | 3300044694 | Unclassified | 617 |
| 398 | Ga0466963_1157750 | 3300044694 | Bacteria | 544 |
| 399 | Ga0466964_0119112 | 3300044706 | Unclassified | 1188 |
| 400 | Ga0466964_0208024 | 3300044706 | Bacteria | 943 |
| 401 | Ga0466971_0020238 | 3300044719 | Bacteria | 2959 |
| 402 | Ga0466968_0457176 | 3300044735 | Bacteria | 632 |
| 403 | Ga0466970_0228912 | 3300044765 | Bacteria | 1039 |
| 404 | Ga0466957_0031763 | 3300044842 | Bacteria | 3157 |
| 405 | Ga0466957_0159038 | 3300044842 | Bacteria | 1466 |
| 406 | Ga0466957_0160021 | 3300044842 | Bacteria | 1462 |
| 407 | Ga0466957_0678184 | 3300044842 | Bacteria | 726 |
| 408 | Ga0466957_1447750 | 3300044842 | Unclassified | 501 |
| 409 | Ga0466960_0057109 | 3300044901 | Bacteria | 1902 |
| 410 | Ga0466959_0147551 | 3300045049 | Unclassified | 1659 |
| 411 | Ga0466959_0315880 | 3300045049 | Bacteria | 1068 |
| 412 | Ga0466959_0333752 | 3300045049 | Bacteria | 1035 |
| 413 | Ga0466959_0354863 | 3300045049 | Unclassified | 999 |
| 414 | Ga0466959_0404072 | 3300045049 | Bacteria | 928 |
| 415 | Ga0466959_0457545 | 3300045049 | Bacteria | 865 |
| 416 | Ga0466958_0018647 | 3300045836 | Bacteria | 4031 |
| 417 | Ga0466958_0067845 | 3300045836 | Bacteria | 2179 |
| 418 | Ga0466958_0070340 | 3300045836 | Bacteria | 2141 |
| 419 | Ga0466958_0114481 | 3300045836 | Bacteria | 1685 |
| 420 | Ga0466958_0137505 | 3300045836 | Bacteria | 1537 |
| 421 | Ga0466958_0192877 | 3300045836 | Bacteria | 1295 |
| 422 | Ga0466967_0012420 | 3300045976 | Bacteria | 6513 |
| 423 | Ga0466967_0051023 | 3300045976 | Bacteria | 3624 |
| 424 | Ga0466967_0160808 | 3300045976 | Bacteria | 2107 |
| 425 | Ga0466967_0273113 | 3300045976 | Bacteria | 1620 |
| 426 | Ga0466967_0641140 | 3300045976 | Bacteria | 1050 |
| 427 | Ga0466967_0704130 | 3300045976 | Bacteria | 1000 |
| 428 | Ga0466967_1132550 | 3300045976 | Bacteria | 780 |
| 429 | Ga0466967_1835648 | 3300045976 | Bacteria | 603 |
| 430 | Ga0495603_0088330 | 3300046455 | Bacteria | 1814 |
| 431 | Ga0495603_0681074 | 3300046455 | Bacteria | 588 |
| 432 | Ga0495590_0096992 | 3300046457 | Bacteria | 1046 |
| 433 | Ga0495629_0079226 | 3300046459 | Bacteria | 2294 |
| 434 | Ga0495641_0384293 | 3300046461 | Bacteria | 636 |
| 435 | Ga0495651_0007698 | 3300046462 | Bacteria | 8238 |
| 436 | Ga0495653_0056714 | 3300046463 | Bacteria | 2984 |
| 437 | Ga0495653_0309320 | 3300046463 | Bacteria | 1028 |
| 438 | Ga0495580_0587359 | 3300046472 | Unclassified | 737 |
| 439 | Ga0495582_0135062 | 3300046473 | Bacteria | 1395 |
| 440 | Ga0495582_0265373 | 3300046473 | Bacteria | 985 |
| 441 | Ga0495582_0704431 | 3300046473 | Bacteria | 584 |
| 442 | Ga0495605_0140886 | 3300046474 | Bacteria | 1082 |
| 443 | Ga0495639_0133911 | 3300046475 | Bacteria | 1188 |
| 444 | Ga0495639_0354756 | 3300046475 | Bacteria | 737 |
| 445 | Ga0495584_0039572 | 3300046491 | Bacteria | 2382 |
| 446 | Ga0495584_0257300 | 3300046491 | Bacteria | 887 |
| 447 | Ga0495594_0000030 | 3300046499 | Bacteria | 66443 |
| 448 | Ga0495594_0505741 | 3300046499 | Unclassified | 686 |
| 449 | Ga0495596_0112511 | 3300046500 | Bacteria | 1057 |
| 450 | Ga0495608_0003131 | 3300046511 | Bacteria | 11815 |
| 451 | Ga0495608_0120717 | 3300046511 | Bacteria | 1681 |
| 452 | Ga0495616_0186118 | 3300046513 | Bacteria | 920 |
| 453 | Ga0495618_0049808 | 3300046514 | Bacteria | 2645 |
| 454 | Ga0495628_0003835 | 3300046516 | Bacteria | 13403 |
| 455 | Ga0495631_0103057 | 3300046518 | Bacteria | 1228 |
| 456 | Ga0495644_0061859 | 3300046523 | Bacteria | 1407 |
| 457 | Ga0495652_0306018 | 3300046529 | Bacteria | 1153 |
| 458 | Ga0495652_0740217 | 3300046529 | Bacteria | 659 |
| 459 | Ga0495640_0019315 | 3300046533 | Bacteria | 5033 |
| 460 | Ga0495640_0080571 | 3300046533 | Bacteria | 2165 |
| 461 | Ga0495621_0269167 | 3300046539 | Bacteria | 700 |
| 462 | Ga0495645_0228423 | 3300046543 | Bacteria | 1248 |
| 463 | Ga0495633_0114702 | 3300046558 | Bacteria | 1249 |
| 464 | Ga0495667_0025766 | 3300046559 | Bacteria | 3961 |
| 465 | Ga0495634_0028724 | 3300046642 | Bacteria | 3858 |
| 466 | Ga0495611_0194712 | 3300046648 | Bacteria | 946 |
| 467 | Ga0495635_0043941 | 3300046663 | Bacteria | 3082 |
| 468 | Ga0495588_0378923 | 3300046674 | Bacteria | 743 |
| 469 | Ga0495657_0013817 | 3300046675 | Bacteria | 5943 |
| 470 | Ga0495599_0333401 | 3300046678 | Bacteria | 911 |
| 471 | Ga0495623_0063317 | 3300046679 | Bacteria | 2316 |
| 472 | Ga0495646_0129835 | 3300046680 | Bacteria | 1419 |
| 473 | Ga0495646_0387292 | 3300046680 | Unclassified | 728 |
| 474 | Ga0495647_0372610 | 3300046681 | Bacteria | 653 |
| 475 | Ga0495658_0349090 | 3300046683 | Bacteria | 940 |
| 476 | Ga0495658_0740748 | 3300046683 | Unclassified | 630 |
| 477 | Ga0495613_0096707 | 3300046689 | Bacteria | 2135 |
| 478 | Ga0495613_0172053 | 3300046689 | Bacteria | 1537 |
| 479 | Ga0495670_0501196 | 3300046691 | Bacteria | 659 |
| 480 | Ga0495671_0471252 | 3300046692 | Bacteria | 600 |
| 481 | Ga0495589_0115375 | 3300046794 | Bacteria | 1295 |
| 482 | Ga0495589_0429696 | 3300046794 | Bacteria | 605 |
| 483 | Ga0495600_0009805 | 3300046809 | Bacteria | 5924 |
| 484 | Ga0495581_0493293 | 3300047315 | Bacteria | 712 |
| 485 | Ga0495604_0000180 | 3300047317 | Bacteria | 56391 |
| 486 | Ga0495604_0098532 | 3300047317 | Bacteria | 2153 |
| 487 | Ga0495674_0037278 | 3300047319 | Bacteria | 4368 |
| 488 | Ga0495676_0096698 | 3300047321 | Bacteria | 2195 |
| 489 | Ga0495676_0214024 | 3300047321 | Bacteria | 1332 |
| 490 | Ga0495680_0006571 | 3300047322 | Bacteria | 10789 |
| 491 | Ga0495675_0173908 | 3300047444 | Bacteria | 1321 |
| 492 | Ga0495684_0055809 | 3300047471 | Bacteria | 3012 |
| 493 | Ga0495686_0446591 | 3300047472 | Bacteria | 688 |
| 494 | Ga0495686_0537972 | 3300047472 | Bacteria | 611 |
| 495 | Ga0495593_0042794 | 3300047673 | Bacteria | 2430 |
| 496 | Ga0495593_0218255 | 3300047673 | Bacteria | 957 |
| 497 | Ga0495602_0106137 | 3300048088 | Bacteria | 2293 |
| 498 | Ga0495602_0554298 | 3300048088 | Bacteria | 796 |
| 499 | Ga0495614_0285719 | 3300048089 | Bacteria | 760 |
| 500 | Ga0495614_0307314 | 3300048089 | Bacteria | 734 |
| 501 | Ga0496100_0545720 | 3300048903 | Bacteria | 896 |
| 502 | Ga0496100_0903671 | 3300048903 | Bacteria | 693 |
| 503 | Ga0496100_1359624 | 3300048903 | Bacteria | 561 |
| 504 | Ga0496101_0005130 | 3300048904 | Bacteria | 8328 |
| 505 | Ga0496101_0070696 | 3300048904 | Bacteria | 2557 |
| 506 | Ga0496102_0060839 | 3300048905 | Bacteria | 3455 |
| 507 | Ga0496102_0432701 | 3300048905 | Unclassified | 1235 |
| 508 | Ga0496102_0472299 | 3300048905 | Bacteria | 1175 |
| 509 | Ga0496102_1824332 | 3300048905 | Bacteria | 525 |
| 510 | Ga0496103_0000062 | 3300048906 | Bacteria | 129593 |
| 511 | Ga0496103_0282397 | 3300048906 | Bacteria | 1068 |
| 512 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 513 | Ga0496104_0025689 | 3300048907 | Bacteria | 5432 |
| 514 | Ga0496104_0495696 | 3300048907 | Bacteria | 1133 |
| 515 | Ga0496104_0885476 | 3300048907 | Unclassified | 798 |
| 516 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 517 | Ga0496105_0430073 | 3300048908 | Unclassified | 1044 |
| 518 | Ga0496105_0441782 | 3300048908 | Bacteria | 1028 |
| 519 | Ga0496105_0501211 | 3300048908 | Unclassified | 953 |
| 520 | Ga0496105_0826926 | 3300048908 | Bacteria | 702 |
| 521 | Ga0496105_0927168 | 3300048908 | Bacteria | 655 |
| 522 | Ga0496106_0012759 | 3300048909 | Bacteria | 6204 |
| 523 | Ga0496106_0027544 | 3300048909 | Bacteria | 4233 |
| 524 | Ga0496106_0038469 | 3300048909 | Bacteria | 3580 |
| 525 | Ga0496106_0314242 | 3300048909 | Bacteria | 1257 |
| 526 | Ga0496106_0631183 | 3300048909 | Bacteria | 857 |
| 527 | Ga0496107_0006595 | 3300048910 | Bacteria | 7990 |
| 528 | Ga0496107_0064943 | 3300048910 | Bacteria | 2646 |
| 529 | Ga0496107_0829915 | 3300048910 | Bacteria | 676 |
| 530 | Ga0496108_0041844 | 3300048911 | Bacteria | 3825 |
| 531 | Ga0496108_0079387 | 3300048911 | Bacteria | 2778 |
| 532 | Ga0496108_0250746 | 3300048911 | Bacteria | 1540 |
| 533 | Ga0496109_0058716 | 3300048912 | Bacteria | 3514 |
| 534 | Ga0496109_1289784 | 3300048912 | Unclassified | 666 |
| 535 | Ga0496110_0064366 | 3300048913 | Bacteria | 3240 |
| 536 | Ga0496110_0077196 | 3300048913 | Bacteria | 2963 |
| 537 | Ga0496110_0094975 | 3300048913 | Bacteria | 2670 |
| 538 | Ga0496110_0165186 | 3300048913 | Bacteria | 2007 |
| 539 | Ga0496111_0005221 | 3300048914 | Bacteria | 8282 |
| 540 | Ga0496111_0015546 | 3300048914 | Bacteria | 5227 |
| 541 | Ga0496111_0035276 | 3300048914 | Bacteria | 3574 |
| 542 | Ga0496112_0155314 | 3300048915 | Bacteria | 2255 |
| 543 | Ga0496112_0355863 | 3300048915 | Bacteria | 1406 |
| 544 | Ga0496112_0481800 | 3300048915 | Bacteria | 1177 |
| 545 | Ga0496113_0029166 | 3300048916 | Bacteria | 3980 |
| 546 | Ga0496113_0092656 | 3300048916 | Bacteria | 2331 |
| 547 | Ga0496114_0179393 | 3300048917 | Bacteria | 1849 |
| 548 | Ga0496114_0270470 | 3300048917 | Bacteria | 1497 |
| 549 | Ga0496115_0149188 | 3300048918 | Bacteria | 1930 |
| 550 | Ga0496115_0174917 | 3300048918 | Bacteria | 1775 |
| 551 | Ga0496119_0257125 | 3300048922 | Bacteria | 878 |
| 552 | Ga0496120_0107416 | 3300048923 | Bacteria | 1463 |
| 553 | Ga0496121_0507121 | 3300048924 | Bacteria | 764 |
| 554 | Ga0501291_147179 | 3300049514 | Bacteria | 530 |
| 555 | Ga0501031_0012132 | 3300049568 | Bacteria | 5618 |
| 556 | Ga0501032_0011109 | 3300049569 | Bacteria | 6471 |
| 557 | Ga0501033_0010308 | 3300049570 | Bacteria | 7173 |
| 558 | Ga0501034_0178238 | 3300049571 | Bacteria | 2090 |
| 559 | Ga0501034_1444840 | 3300049571 | Bacteria | 562 |
| 560 | Ga0501036_0163008 | 3300049572 | Bacteria | 1879 |
| 561 | Ga0501036_1399085 | 3300049572 | Bacteria | 567 |
| 562 | Ga0501037_0024274 | 3300049573 | Bacteria | 4484 |
| 563 | Ga0501037_0741991 | 3300049573 | Unclassified | 651 |
| 564 | Ga0501038_0002656 | 3300049574 | Bacteria | 16704 |
| 565 | Ga0501039_0046034 | 3300049575 | Bacteria | 3370 |
| 566 | Ga0501039_0058279 | 3300049575 | Bacteria | 2991 |
| 567 | Ga0501040_0245845 | 3300049576 | Bacteria | 1276 |
| 568 | Ga0501042_0125844 | 3300049578 | Bacteria | 1845 |
| 569 | Ga0501042_1177489 | 3300049578 | Unclassified | 559 |
| 570 | Ga0501043_0010586 | 3300049579 | Bacteria | 7221 |
| 571 | Ga0501046_0101824 | 3300049580 | Bacteria | 2202 |
| 572 | Ga0501047_0130216 | 3300049581 | Bacteria | 2396 |
| 573 | Ga0501048_0032493 | 3300049582 | Bacteria | 3770 |
| 574 | Ga0501048_0964017 | 3300049582 | Unclassified | 613 |
| 575 | Ga0501067_0006428 | 3300049583 | Bacteria | 6510 |
| 576 | Ga0501067_0123726 | 3300049583 | Bacteria | 1440 |
| 577 | Ga0501067_0161971 | 3300049583 | Bacteria | 1246 |
| 578 | Ga0501068_0100487 | 3300049584 | Bacteria | 1792 |
| 579 | Ga0501069_0026324 | 3300049585 | Bacteria | 3184 |
| 580 | Ga0501069_0569768 | 3300049585 | Bacteria | 678 |
| 581 | Ga0501070_0059259 | 3300049586 | Bacteria | 3174 |
| 582 | Ga0501070_0074272 | 3300049586 | Bacteria | 2814 |
| 583 | Ga0501071_0073482 | 3300049587 | Bacteria | 2494 |
| 584 | Ga0501071_0114944 | 3300049587 | Bacteria | 1991 |
| 585 | Ga0501071_0695398 | 3300049587 | Bacteria | 783 |
| 586 | Ga0501072_0081793 | 3300049588 | Bacteria | 2560 |
| 587 | Ga0501072_0188433 | 3300049588 | Bacteria | 1645 |
| 588 | Ga0501073_0010446 | 3300049589 | Bacteria | 6807 |
| 589 | Ga0501074_0018326 | 3300049590 | Bacteria | 5085 |
| 590 | Ga0501074_1183505 | 3300049590 | Unclassified | 536 |
| 591 | Ga0501075_0225759 | 3300049591 | Bacteria | 1428 |
| 592 | Ga0501076_0097731 | 3300049592 | Bacteria | 2365 |
| 593 | Ga0501077_0197782 | 3300049593 | Unclassified | 1277 |
| 594 | Ga0501079_0055286 | 3300049741 | Bacteria | 3063 |
| 595 | Ga0501079_0452964 | 3300049741 | Bacteria | 1008 |
| 596 | Ga0501079_0873176 | 3300049741 | Bacteria | 708 |
| 597 | Ga0501080_0558118 | 3300049742 | Bacteria | 1019 |
| 598 | Ga0501080_0664924 | 3300049742 | Bacteria | 921 |
| 599 | Ga0501081_0651868 | 3300049743 | Unclassified | 789 |
| 600 | Ga0501081_1371886 | 3300049743 | Bacteria | 536 |
| 601 | Ga0501083_0018408 | 3300049744 | Bacteria | 4868 |
| 602 | Ga0501035_0084148 | 3300049822 | Bacteria | 2806 |
| 603 | Ga0501035_0100706 | 3300049822 | Bacteria | 2536 |
| 604 | Ga0501044_0091391 | 3300049823 | Bacteria | 3070 |
| 605 | Ga0501045_0075424 | 3300049824 | Bacteria | 2484 |
| 606 | Ga0501045_0313028 | 3300049824 | Bacteria | 1168 |
| 607 | Ga0501045_0881455 | 3300049824 | Unclassified | 658 |
| 608 | nmdc:mga05p37_268784_c1 | 3300050507 | Bacteria | 2038 |
| 609 | nmdc:mga09592_10828_c1 | 3300050508 | Bacteria | 6402 |
| 610 | nmdc:mga0qj67_1299836_c1 | 3300050509 | Bacteria | 563 |
| 611 | nmdc:mga0qj67_15821_c1 | 3300050509 | Bacteria | 5713 |
| 612 | nmdc:mga06r32_1137728_c1 | 3300050510 | Unclassified | 729 |
| 613 | nmdc:mga08y16_1345027_c1 | 3300050511 | Unclassified | 679 |
| 614 | nmdc:mga0n895_1551628_c1 | 3300050512 | Bacteria | 627 |
| 615 | nmdc:mga0rr50_521573_c1 | 3300050513 | Bacteria | 1011 |
| 616 | Ga0495601_0209836 | 3300053077 | Bacteria | 1272 |
| 617 | Ga0495612_0081882 | 3300053078 | Bacteria | 1357 |
| 618 | Ga0495612_0263107 | 3300053078 | Bacteria | 769 |
| 619 | Ga0495655_0222190 | 3300053083 | Bacteria | 626 |
| 620 | Ga0495595_0058029 | 3300053084 | Bacteria | 1806 |
| 621 | Ga0495619_0021359 | 3300053085 | Bacteria | 4131 |
| 622 | Ga0501084_0203557 | 3300054114 | Bacteria | 1670 |
| 623 | Ga0501084_1332987 | 3300054114 | Unclassified | 601 |
| 624 | Ga0587066_041460 | 3300059490 | Bacteria | 869 |
| 625 | Ga0587070_018036 | 3300059491 | Bacteria | 1152 |
| 626 | Ga0587114_138706 | 3300059655 | Unclassified | 507 |
| 627 | Ga0587071_119514 | 3300060344 | Bacteria | 628 |
| 628 | Ga0501082_0031883 | 3300060353 | Bacteria | 4545 |
| 629 | Ga0501082_0326660 | 3300060353 | Bacteria | 1337 |
| 630 | Ga0466962_0062138 | 3300061719 | Bacteria | 1783 |
| 631 | Ga0466962_0217519 | 3300061719 | Bacteria | 935 |
| 632 | Ga0530510_0606042 | 3300061734 | Unclassified | 833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0316558 | Ga0436364_0316558_249_587 | 105 |
| 2 | 3300039450 | Ga0436363_0390993 | Ga0436363_0390993_103_441 | 105 |
| 3 | 3300046491 | Ga0495584_0039572 | Ga0495584_0039572_12_332 | 106 |
| 4 | 3300009098 | Ga0105245_10985577 | Ga0105245_109855772 | 107 |
| 5 | 3300009553 | Ga0105249_11320746 | Ga0105249_113207462 | 107 |
| 6 | 3300010375 | Ga0105239_11452629 | Ga0105239_114526291 | 107 |
| 7 | 3300012495 | Ga0157323_1041619 | Ga0157323_10416192 | 107 |
| 8 | 3300013308 | Ga0157375_11276997 | Ga0157375_112769972 | 107 |
| 9 | 3300014497 | Ga0182008_10202468 | Ga0182008_102024683 | 107 |
| 10 | 3300035170 | Ga0373943_0445205 | Ga0373943_0445205_345_668 | 107 |
| 11 | 3300035725 | Ga0373947_0032518 | Ga0373947_0032518_1372_1695 | 107 |
| 12 | 3300037068 | Ga0373925_1747136 | Ga0373925_1747136_16_339 | 107 |
| 13 | 3300041512 | Ga0451853_3624238 | Ga0451853_3624238_103_426 | 107 |
| 14 | 3300046457 | Ga0495590_0096992 | Ga0495590_0096992_410_733 | 107 |
| 15 | 3300046473 | Ga0495582_0135062 | Ga0495582_0135062_969_1292 | 107 |
| 16 | 3300046474 | Ga0495605_0140886 | Ga0495605_0140886_45_368 | 107 |
| 17 | 3300046513 | Ga0495616_0186118 | Ga0495616_0186118_244_567 | 107 |
| 18 | 3300046518 | Ga0495631_0103057 | Ga0495631_0103057_771_1094 | 107 |
| 19 | 3300046539 | Ga0495621_0269167 | Ga0495621_0269167_301_624 | 107 |
| 20 | 3300046692 | Ga0495671_0471252 | Ga0495671_0471252_26_349 | 107 |
| 21 | 3300046794 | Ga0495589_0429696 | Ga0495589_0429696_213_536 | 107 |
| 22 | 3300047315 | Ga0495581_0493293 | Ga0495581_0493293_87_410 | 107 |
| 23 | 3300047321 | Ga0495676_0096698 | Ga0495676_0096698_666_989 | 107 |
| 24 | 3300047472 | Ga0495686_0537972 | Ga0495686_0537972_128_451 | 107 |
| 25 | 3300048089 | Ga0495614_0307314 | Ga0495614_0307314_252_575 | 107 |
| 26 | 3300048904 | Ga0496101_0070696 | Ga0496101_0070696_218_541 | 107 |
| 27 | 3300048910 | Ga0496107_0829915 | Ga0496107_0829915_294_617 | 107 |
| 28 | 3300025944 | Ga0207661_10772017 | Ga0207661_107720171 | 108 |
| 29 | 3300044901 | Ga0466960_0057109 | Ga0466960_0057109_685_1023 | 108 |
| 30 | 3300046499 | Ga0495594_0000030 | Ga0495594_0000030_15788_16123 | 108 |
| 31 | 3300005329 | Ga0070683_100316614 | Ga0070683_1003166143 | 109 |
| 32 | 3300005344 | Ga0070661_100400758 | Ga0070661_1004007582 | 109 |
| 33 | 3300005345 | Ga0070692_10143735 | Ga0070692_101437352 | 109 |
| 34 | 3300005347 | Ga0070668_100293002 | Ga0070668_1002930023 | 109 |
| 35 | 3300005366 | Ga0070659_100148371 | Ga0070659_1001483712 | 109 |
| 36 | 3300005366 | Ga0070659_100843173 | Ga0070659_1008431732 | 109 |
| 37 | 3300005367 | Ga0070667_101060114 | Ga0070667_1010601141 | 109 |
| 38 | 3300005457 | Ga0070662_100049793 | Ga0070662_1000497933 | 109 |
| 39 | 3300005459 | Ga0068867_100180407 | Ga0068867_1001804072 | 109 |
| 40 | 3300005543 | Ga0070672_100858029 | Ga0070672_1008580292 | 109 |
| 41 | 3300005564 | Ga0070664_100431824 | Ga0070664_1004318242 | 109 |
| 42 | 3300005577 | Ga0068857_100211718 | Ga0068857_1002117183 | 109 |
| 43 | 3300005616 | Ga0068852_100534027 | Ga0068852_1005340272 | 109 |
| 44 | 3300005981 | Ga0081538_10007594 | Ga0081538_100075949 | 109 |
| 45 | 3300006038 | Ga0075365_10453002 | Ga0075365_104530022 | 109 |
| 46 | 3300006058 | Ga0075432_10197346 | Ga0075432_101973462 | 109 |
| 47 | 3300009094 | Ga0111539_11698353 | Ga0111539_116983532 | 109 |
| 48 | 3300009094 | Ga0111539_12329515 | Ga0111539_123295152 | 109 |
| 49 | 3300009098 | Ga0105245_10166028 | Ga0105245_101660283 | 109 |
| 50 | 3300011119 | Ga0105246_10040064 | Ga0105246_100400643 | 109 |
| 51 | 3300013307 | Ga0157372_10667058 | Ga0157372_106670582 | 109 |
| 52 | 3300025918 | Ga0207662_10896355 | Ga0207662_108963552 | 109 |
| 53 | 3300025920 | Ga0207649_10638901 | Ga0207649_106389012 | 109 |
| 54 | 3300025927 | Ga0207687_10189845 | Ga0207687_101898453 | 109 |
| 55 | 3300025933 | Ga0207706_10041686 | Ga0207706_100416863 | 109 |
| 56 | 3300025938 | Ga0207704_11163090 | Ga0207704_111630902 | 109 |
| 57 | 3300025940 | Ga0207691_10424153 | Ga0207691_104241532 | 109 |
| 58 | 3300025945 | Ga0207679_10861566 | Ga0207679_108615662 | 109 |
| 59 | 3300026035 | Ga0207703_11152725 | Ga0207703_111527252 | 109 |
| 60 | 3300026067 | Ga0207678_10136306 | Ga0207678_101363063 | 109 |
| 61 | 3300026067 | Ga0207678_10561378 | Ga0207678_105613782 | 109 |
| 62 | 3300026089 | Ga0207648_10085987 | Ga0207648_100859874 | 109 |
| 63 | 3300026116 | Ga0207674_10222943 | Ga0207674_102229433 | 109 |
| 64 | 3300026121 | Ga0207683_10130758 | Ga0207683_101307582 | 109 |
| 65 | 3300026142 | Ga0207698_10234543 | Ga0207698_102345432 | 109 |
| 66 | 3300027907 | Ga0207428_10549193 | Ga0207428_105491932 | 109 |
| 67 | 3300028380 | Ga0268265_11120436 | Ga0268265_111204362 | 109 |
| 68 | 3300031548 | Ga0307408_100345906 | Ga0307408_1003459062 | 109 |
| 69 | 3300031731 | Ga0307405_10030476 | Ga0307405_100304763 | 109 |
| 70 | 3300031824 | Ga0307413_10187275 | Ga0307413_101872753 | 109 |
| 71 | 3300031903 | Ga0307407_10157396 | Ga0307407_101573963 | 109 |
| 72 | 3300031995 | Ga0307409_100025284 | Ga0307409_1000252843 | 109 |
| 73 | 3300031995 | Ga0307409_100549990 | Ga0307409_1005499903 | 109 |
| 74 | 3300031995 | Ga0307409_100568157 | Ga0307409_1005681572 | 109 |
| 75 | 3300032002 | Ga0307416_100085961 | Ga0307416_1000859613 | 109 |
| 76 | 3300032002 | Ga0307416_100172523 | Ga0307416_1001725233 | 109 |
| 77 | 3300032004 | Ga0307414_10637093 | Ga0307414_106370933 | 109 |
| 78 | 3300032005 | Ga0307411_10024381 | Ga0307411_100243814 | 109 |
| 79 | 3300032126 | Ga0307415_100010639 | Ga0307415_1000106395 | 109 |
| 80 | 3300044694 | Ga0466963_0115480 | Ga0466963_0115480_867_1208 | 109 |
| 81 | 3300044842 | Ga0466957_0160021 | Ga0466957_0160021_47_388 | 109 |
| 82 | 3300045836 | Ga0466958_0114481 | Ga0466958_0114481_861_1202 | 109 |
| 83 | 3300048903 | Ga0496100_0903671 | Ga0496100_0903671_273_602 | 109 |
| 84 | 3300048909 | Ga0496106_0631183 | Ga0496106_0631183_428_778 | 109 |
| 85 | 3300049571 | Ga0501034_1444840 | Ga0501034_1444840_12_341 | 109 |
| 86 | 3300049578 | Ga0501042_1177489 | Ga0501042_1177489_98_427 | 109 |
| 87 | 3300049583 | Ga0501067_0123726 | Ga0501067_0123726_214_543 | 109 |
| 88 | 3300005329 | Ga0070683_100878503 | Ga0070683_1008785031 | 110 |
| 89 | 3300005338 | Ga0068868_100026801 | Ga0068868_1000268012 | 110 |
| 90 | 3300005340 | Ga0070689_101625001 | Ga0070689_1016250012 | 110 |
| 91 | 3300005438 | Ga0070701_10354983 | Ga0070701_103549831 | 110 |
| 92 | 3300005441 | Ga0070700_100186125 | Ga0070700_1001861253 | 110 |
| 93 | 3300005455 | Ga0070663_101085892 | Ga0070663_1010858921 | 110 |
| 94 | 3300005457 | Ga0070662_100213214 | Ga0070662_1002132142 | 110 |
| 95 | 3300005544 | Ga0070686_100274291 | Ga0070686_1002742912 | 110 |
| 96 | 3300005545 | Ga0070695_100426192 | Ga0070695_1004261921 | 110 |
| 97 | 3300005549 | Ga0070704_100293977 | Ga0070704_1002939772 | 110 |
| 98 | 3300005578 | Ga0068854_100437044 | Ga0068854_1004370442 | 110 |
| 99 | 3300005615 | Ga0070702_100005728 | Ga0070702_1000057284 | 110 |
| 100 | 3300005616 | Ga0068852_100212996 | Ga0068852_1002129963 | 110 |
| 101 | 3300005617 | Ga0068859_100559774 | Ga0068859_1005597742 | 110 |
| 102 | 3300005718 | Ga0068866_10066783 | Ga0068866_100667832 | 110 |
| 103 | 3300005719 | Ga0068861_100047929 | Ga0068861_1000479294 | 110 |
| 104 | 3300005841 | Ga0068863_100766542 | Ga0068863_1007665422 | 110 |
| 105 | 3300005844 | Ga0068862_100410166 | Ga0068862_1004101662 | 110 |
| 106 | 3300005937 | Ga0081455_10136625 | Ga0081455_101366251 | 110 |
| 107 | 3300006844 | Ga0075428_100143651 | Ga0075428_1001436513 | 110 |
| 108 | 3300006846 | Ga0075430_100023879 | Ga0075430_1000238793 | 110 |
| 109 | 3300006847 | Ga0075431_100035801 | Ga0075431_1000358013 | 110 |
| 110 | 3300006880 | Ga0075429_100009960 | Ga0075429_1000099607 | 110 |
| 111 | 3300006881 | Ga0068865_101315613 | Ga0068865_1013156132 | 110 |
| 112 | 3300006931 | Ga0097620_100559802 | Ga0097620_1005598022 | 110 |
| 113 | 3300009101 | Ga0105247_10490994 | Ga0105247_104909942 | 110 |
| 114 | 3300009148 | Ga0105243_10987886 | Ga0105243_109878862 | 110 |
| 115 | 3300009176 | Ga0105242_10003748 | Ga0105242_100037485 | 110 |
| 116 | 3300009553 | Ga0105249_10152728 | Ga0105249_101527282 | 110 |
| 117 | 3300009553 | Ga0105249_12718523 | Ga0105249_127185231 | 110 |
| 118 | 3300009553 | Ga0105249_12839180 | Ga0105249_128391802 | 110 |
| 119 | 3300013308 | Ga0157375_13345931 | Ga0157375_133459312 | 110 |
| 120 | 3300014325 | Ga0163163_10992998 | Ga0163163_109929981 | 110 |
| 121 | 3300014326 | Ga0157380_10430707 | Ga0157380_104307072 | 110 |
| 122 | 3300014968 | Ga0157379_10003495 | Ga0157379_100034957 | 110 |
| 123 | 3300021377 | Ga0213874_10278177 | Ga0213874_102781772 | 110 |
| 124 | 3300025898 | Ga0207692_10428981 | Ga0207692_104289812 | 110 |
| 125 | 3300025899 | Ga0207642_10024985 | Ga0207642_100249852 | 110 |
| 126 | 3300025901 | Ga0207688_10018945 | Ga0207688_100189453 | 110 |
| 127 | 3300025915 | Ga0207693_10000017 | Ga0207693_10000017117 | 110 |
| 128 | 3300025932 | Ga0207690_10253094 | Ga0207690_102530943 | 110 |
| 129 | 3300025933 | Ga0207706_10755822 | Ga0207706_107558221 | 110 |
| 130 | 3300025942 | Ga0207689_10459246 | Ga0207689_104592462 | 110 |
| 131 | 3300025944 | Ga0207661_10754000 | Ga0207661_107540003 | 110 |
| 132 | 3300025961 | Ga0207712_10584663 | Ga0207712_105846633 | 110 |
| 133 | 3300025981 | Ga0207640_10340732 | Ga0207640_103407322 | 110 |
| 134 | 3300026023 | Ga0207677_10696132 | Ga0207677_106961322 | 110 |
| 135 | 3300026035 | Ga0207703_10258439 | Ga0207703_102584392 | 110 |
| 136 | 3300026067 | Ga0207678_10113326 | Ga0207678_101133261 | 110 |
| 137 | 3300026075 | Ga0207708_10027228 | Ga0207708_100272284 | 110 |
| 138 | 3300026095 | Ga0207676_10318792 | Ga0207676_103187922 | 110 |
| 139 | 3300026116 | Ga0207674_10864087 | Ga0207674_108640872 | 110 |
| 140 | 3300026118 | Ga0207675_100022184 | Ga0207675_1000221849 | 110 |
| 141 | 3300026142 | Ga0207698_10589550 | Ga0207698_105895503 | 110 |
| 142 | 3300035115 | Ga0373941_0502722 | Ga0373941_0502722_32_367 | 110 |
| 143 | 3300037418 | Ga0395900_0254235 | Ga0395900_0254235_46_381 | 110 |
| 144 | 3300037418 | Ga0395900_0263531 | Ga0395900_0263531_1116_1454 | 110 |
| 145 | 3300037466 | Ga0395898_0237749 | Ga0395898_0237749_169_507 | 110 |
| 146 | 3300038443 | Ga0395901_0338210 | Ga0395901_0338210_657_995 | 110 |
| 147 | 3300038443 | Ga0395901_1282157 | Ga0395901_1282157_131_466 | 110 |
| 148 | 3300044684 | Ga0466966_0410088 | Ga0466966_0410088_387_728 | 110 |
| 149 | 3300044693 | Ga0466961_0207911 | Ga0466961_0207911_745_1086 | 110 |
| 150 | 3300044694 | Ga0466963_0773579 | Ga0466963_0773579_54_395 | 110 |
| 151 | 3300044706 | Ga0466964_0208024 | Ga0466964_0208024_97_435 | 110 |
| 152 | 3300044735 | Ga0466968_0457176 | Ga0466968_0457176_97_435 | 110 |
| 153 | 3300044842 | Ga0466957_0031763 | Ga0466957_0031763_599_940 | 110 |
| 154 | 3300044842 | Ga0466957_0678184 | Ga0466957_0678184_42_383 | 110 |
| 155 | 3300045049 | Ga0466959_0333752 | Ga0466959_0333752_182_523 | 110 |
| 156 | 3300045836 | Ga0466958_0067845 | Ga0466958_0067845_824_1165 | 110 |
| 157 | 3300045836 | Ga0466958_0070340 | Ga0466958_0070340_726_1067 | 110 |
| 158 | 3300045836 | Ga0466958_0137505 | Ga0466958_0137505_900_1238 | 110 |
| 159 | 3300045836 | Ga0466958_0192877 | Ga0466958_0192877_93_434 | 110 |
| 160 | 3300045976 | Ga0466967_0012420 | Ga0466967_0012420_3646_3984 | 110 |
| 161 | 3300045976 | Ga0466967_1132550 | Ga0466967_1132550_98_436 | 110 |
| 162 | 3300045976 | Ga0466967_1835648 | Ga0466967_1835648_48_395 | 110 |
| 163 | 3300048903 | Ga0496100_1359624 | Ga0496100_1359624_13_348 | 110 |
| 164 | 3300048905 | Ga0496102_1824332 | Ga0496102_1824332_154_489 | 110 |
| 165 | 3300048906 | Ga0496103_0000062 | Ga0496103_0000062_104754_105152 | 110 |
| 166 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_281564_281908 | 110 |
| 167 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_193891_194235 | 110 |
| 168 | 3300048908 | Ga0496105_0441782 | Ga0496105_0441782_636_971 | 110 |
| 169 | 3300048909 | Ga0496106_0038469 | Ga0496106_0038469_99_434 | 110 |
| 170 | 3300048912 | Ga0496109_1289784 | Ga0496109_1289784_125_466 | 110 |
| 171 | 3300048913 | Ga0496110_0077196 | Ga0496110_0077196_1770_2105 | 110 |
| 172 | 3300048922 | Ga0496119_0257125 | Ga0496119_0257125_490_825 | 110 |
| 173 | 3300048923 | Ga0496120_0107416 | Ga0496120_0107416_642_986 | 110 |
| 174 | 3300048924 | Ga0496121_0507121 | Ga0496121_0507121_114_449 | 110 |
| 175 | 3300049514 | Ga0501291_147179 | Ga0501291_147179_13_345 | 110 |
| 176 | 3300049585 | Ga0501069_0569768 | Ga0501069_0569768_265_603 | 110 |
| 177 | 3300049586 | Ga0501070_0059259 | Ga0501070_0059259_227_565 | 110 |
| 178 | 3300059490 | Ga0587066_041460 | Ga0587066_041460_387_788 | 110 |
| 179 | 3300061719 | Ga0466962_0217519 | Ga0466962_0217519_365_706 | 110 |
| 180 | 3300009174 | Ga0105241_11066946 | Ga0105241_110669462 | 111 |
| 181 | 3300014326 | Ga0157380_12417556 | Ga0157380_124175562 | 111 |
| 182 | 3300005334 | Ga0068869_100266591 | Ga0068869_1002665912 | 112 |
| 183 | 3300005338 | Ga0068868_100380787 | Ga0068868_1003807872 | 112 |
| 184 | 3300005338 | Ga0068868_100839825 | Ga0068868_1008398251 | 112 |
| 185 | 3300005344 | Ga0070661_100806128 | Ga0070661_1008061282 | 112 |
| 186 | 3300005347 | Ga0070668_100803647 | Ga0070668_1008036472 | 112 |
| 187 | 3300005366 | Ga0070659_100499116 | Ga0070659_1004991162 | 112 |
| 188 | 3300005455 | Ga0070663_102074929 | Ga0070663_1020749291 | 112 |
| 189 | 3300005544 | Ga0070686_101591316 | Ga0070686_1015913161 | 112 |
| 190 | 3300005547 | Ga0070693_101300283 | Ga0070693_1013002832 | 112 |
| 191 | 3300005578 | Ga0068854_100409567 | Ga0068854_1004095672 | 112 |
| 192 | 3300005614 | Ga0068856_100104790 | Ga0068856_1001047902 | 112 |
| 193 | 3300005614 | Ga0068856_101870159 | Ga0068856_1018701591 | 112 |
| 194 | 3300005615 | Ga0070702_101862884 | Ga0070702_1018628841 | 112 |
| 195 | 3300005617 | Ga0068859_100652156 | Ga0068859_1006521562 | 112 |
| 196 | 3300005841 | Ga0068863_100862516 | Ga0068863_1008625162 | 112 |
| 197 | 3300005841 | Ga0068863_101021383 | Ga0068863_1010213832 | 112 |
| 198 | 3300005937 | Ga0081455_10002456 | Ga0081455_1000245621 | 112 |
| 199 | 3300005983 | Ga0081540_1059534 | Ga0081540_10595342 | 112 |
| 200 | 3300006871 | Ga0075434_102019241 | Ga0075434_1020192412 | 112 |
| 201 | 3300006931 | Ga0097620_100652153 | Ga0097620_1006521532 | 112 |
| 202 | 3300009098 | Ga0105245_11162312 | Ga0105245_111623122 | 112 |
| 203 | 3300009177 | Ga0105248_11488131 | Ga0105248_114881312 | 112 |
| 204 | 3300009545 | Ga0105237_12111398 | Ga0105237_121113982 | 112 |
| 205 | 3300009551 | Ga0105238_10813446 | Ga0105238_108134462 | 112 |
| 206 | 3300012487 | Ga0157321_1038485 | Ga0157321_10384852 | 112 |
| 207 | 3300013102 | Ga0157371_10878615 | Ga0157371_108786152 | 112 |
| 208 | 3300013105 | Ga0157369_11610525 | Ga0157369_116105252 | 112 |
| 209 | 3300013307 | Ga0157372_10410900 | Ga0157372_104109003 | 112 |
| 210 | 3300014745 | Ga0157377_10631643 | Ga0157377_106316432 | 112 |
| 211 | 3300014969 | Ga0157376_10850266 | Ga0157376_108502661 | 112 |
| 212 | 3300025898 | Ga0207692_10895745 | Ga0207692_108957452 | 112 |
| 213 | 3300025915 | Ga0207693_10597626 | Ga0207693_105976262 | 112 |
| 214 | 3300025920 | Ga0207649_11304552 | Ga0207649_113045522 | 112 |
| 215 | 3300025927 | Ga0207687_10872944 | Ga0207687_108729442 | 112 |
| 216 | 3300025932 | Ga0207690_10634207 | Ga0207690_106342072 | 112 |
| 217 | 3300025935 | Ga0207709_11077373 | Ga0207709_110773731 | 112 |
| 218 | 3300025945 | Ga0207679_11882860 | Ga0207679_118828602 | 112 |
| 219 | 3300025981 | Ga0207640_10781346 | Ga0207640_107813462 | 112 |
| 220 | 3300026023 | Ga0207677_10823894 | Ga0207677_108238942 | 112 |
| 221 | 3300026078 | Ga0207702_10051574 | Ga0207702_100515743 | 112 |
| 222 | 3300026078 | Ga0207702_10258612 | Ga0207702_102586122 | 112 |
| 223 | 3300026088 | Ga0207641_10369115 | Ga0207641_103691152 | 112 |
| 224 | 3300026142 | Ga0207698_10636098 | Ga0207698_106360983 | 112 |
| 225 | 3300026142 | Ga0207698_10859223 | Ga0207698_108592232 | 112 |
| 226 | 3300028800 | Ga0265338_10074044 | Ga0265338_100740442 | 112 |
| 227 | 3300041460 | Ga0451802_1039879 | Ga0451802_1039879_87_428 | 112 |
| 228 | 3300041486 | Ga0451807_2036011 | Ga0451807_2036011_25_363 | 112 |
| 229 | 3300042016 | Ga0439463_041862 | Ga0439463_041862_449_787 | 112 |
| 230 | 3300042438 | Ga0439459_0117061 | Ga0439459_0117061_313_651 | 112 |
| 231 | 3300045976 | Ga0466967_0641140 | Ga0466967_0641140_532_870 | 112 |
| 232 | 3300046475 | Ga0495639_0354756 | Ga0495639_0354756_162_500 | 112 |
| 233 | 3300046491 | Ga0495584_0257300 | Ga0495584_0257300_418_756 | 112 |
| 234 | 3300046500 | Ga0495596_0112511 | Ga0495596_0112511_414_752 | 112 |
| 235 | 3300046523 | Ga0495644_0061859 | Ga0495644_0061859_441_779 | 112 |
| 236 | 3300046558 | Ga0495633_0114702 | Ga0495633_0114702_506_844 | 112 |
| 237 | 3300046648 | Ga0495611_0194712 | Ga0495611_0194712_364_702 | 112 |
| 238 | 3300046681 | Ga0495647_0372610 | Ga0495647_0372610_183_521 | 112 |
| 239 | 3300046691 | Ga0495670_0501196 | Ga0495670_0501196_14_352 | 112 |
| 240 | 3300046794 | Ga0495589_0115375 | Ga0495589_0115375_544_882 | 112 |
| 241 | 3300047472 | Ga0495686_0446591 | Ga0495686_0446591_222_560 | 112 |
| 242 | 3300048903 | Ga0496100_0545720 | Ga0496100_0545720_238_576 | 112 |
| 243 | 3300048905 | Ga0496102_0060839 | Ga0496102_0060839_2688_3026 | 112 |
| 244 | 3300048905 | Ga0496102_0472299 | Ga0496102_0472299_615_953 | 112 |
| 245 | 3300048906 | Ga0496103_0282397 | Ga0496103_0282397_428_766 | 112 |
| 246 | 3300048907 | Ga0496104_0025689 | Ga0496104_0025689_1547_1885 | 112 |
| 247 | 3300048907 | Ga0496104_0495696 | Ga0496104_0495696_781_1119 | 112 |
| 248 | 3300048908 | Ga0496105_0826926 | Ga0496105_0826926_130_468 | 112 |
| 249 | 3300048909 | Ga0496106_0027544 | Ga0496106_0027544_2588_2926 | 112 |
| 250 | 3300048909 | Ga0496106_0314242 | Ga0496106_0314242_524_862 | 112 |
| 251 | 3300048910 | Ga0496107_0064943 | Ga0496107_0064943_1842_2180 | 112 |
| 252 | 3300048911 | Ga0496108_0041844 | Ga0496108_0041844_1386_1724 | 112 |
| 253 | 3300048911 | Ga0496108_0079387 | Ga0496108_0079387_1505_1843 | 112 |
| 254 | 3300048912 | Ga0496109_0058716 | Ga0496109_0058716_2744_3082 | 112 |
| 255 | 3300048913 | Ga0496110_0064366 | Ga0496110_0064366_433_771 | 112 |
| 256 | 3300048913 | Ga0496110_0165186 | Ga0496110_0165186_1069_1407 | 112 |
| 257 | 3300048914 | Ga0496111_0005221 | Ga0496111_0005221_7381_7719 | 112 |
| 258 | 3300048914 | Ga0496111_0015546 | Ga0496111_0015546_3789_4127 | 112 |
| 259 | 3300048914 | Ga0496111_0035276 | Ga0496111_0035276_409_747 | 112 |
| 260 | 3300048915 | Ga0496112_0155314 | Ga0496112_0155314_672_1010 | 112 |
| 261 | 3300048915 | Ga0496112_0355863 | Ga0496112_0355863_615_953 | 112 |
| 262 | 3300048916 | Ga0496113_0029166 | Ga0496113_0029166_902_1240 | 112 |
| 263 | 3300048916 | Ga0496113_0092656 | Ga0496113_0092656_875_1213 | 112 |
| 264 | 3300048917 | Ga0496114_0179393 | Ga0496114_0179393_1065_1403 | 112 |
| 265 | 3300048918 | Ga0496115_0174917 | Ga0496115_0174917_1278_1616 | 112 |
| 266 | 3300050512 | nmdc:mga0n895_1551628_c1 | nmdc:mga0n895_1551628_c1_75_413 | 112 |
| 267 | 3300053083 | Ga0495655_0222190 | Ga0495655_0222190_40_378 | 112 |
| 268 | 3300005435 | Ga0070714_100172337 | Ga0070714_1001723372 | 113 |
| 269 | 3300005435 | Ga0070714_100856214 | Ga0070714_1008562142 | 113 |
| 270 | 3300005436 | Ga0070713_100139778 | Ga0070713_1001397783 | 113 |
| 271 | 3300005437 | Ga0070710_10061767 | Ga0070710_100617671 | 113 |
| 272 | 3300005439 | Ga0070711_100028025 | Ga0070711_1000280252 | 113 |
| 273 | 3300005440 | Ga0070705_100003636 | Ga0070705_1000036365 | 113 |
| 274 | 3300006163 | Ga0070715_10248258 | Ga0070715_102482582 | 113 |
| 275 | 3300006173 | Ga0070716_100048773 | Ga0070716_1000487732 | 113 |
| 276 | 3300006175 | Ga0070712_100017563 | Ga0070712_1000175634 | 113 |
| 277 | 3300007076 | Ga0075435_100576793 | Ga0075435_1005767932 | 113 |
| 278 | 3300009093 | Ga0105240_10122371 | Ga0105240_101223713 | 113 |
| 279 | 3300009094 | Ga0111539_10605093 | Ga0111539_106050933 | 113 |
| 280 | 3300009147 | Ga0114129_10265746 | Ga0114129_102657462 | 113 |
| 281 | 3300025906 | Ga0207699_10199976 | Ga0207699_101999762 | 113 |
| 282 | 3300025913 | Ga0207695_10035094 | Ga0207695_100350941 | 113 |
| 283 | 3300025915 | Ga0207693_10008897 | Ga0207693_100088979 | 113 |
| 284 | 3300025916 | Ga0207663_10196188 | Ga0207663_101961882 | 113 |
| 285 | 3300025929 | Ga0207664_10089694 | Ga0207664_100896942 | 113 |
| 286 | 3300025929 | Ga0207664_10103740 | Ga0207664_101037402 | 113 |
| 287 | 3300025939 | Ga0207665_10039880 | Ga0207665_100398802 | 113 |
| 288 | 3300031889 | Ga0326468_10004933 | Ga0326468_100049333 | 113 |
| 289 | 3300031901 | Ga0307406_11507981 | Ga0307406_115079812 | 113 |
| 290 | 3300031995 | Ga0307409_101292936 | Ga0307409_1012929362 | 113 |
| 291 | 3300032005 | Ga0307411_12048751 | Ga0307411_120487512 | 113 |
| 292 | 3300032126 | Ga0307415_102062046 | Ga0307415_1020620461 | 113 |
| 293 | 3300035117 | Ga0373953_0072191 | Ga0373953_0072191_501_863 | 113 |
| 294 | 3300035172 | Ga0373955_0027472 | Ga0373955_0027472_1002_1364 | 113 |
| 295 | 3300035410 | Ga0373924_0017046 | Ga0373924_0017046_160_522 | 113 |
| 296 | 3300035724 | Ga0373933_0026577 | Ga0373933_0026577_1300_1662 | 113 |
| 297 | 3300036401 | Ga0373937_0138829 | Ga0373937_0138829_369_731 | 113 |
| 298 | 3300037853 | Ga0436364_0953233 | Ga0436364_0953233_655_1005 | 113 |
| 299 | 3300041512 | Ga0451853_0803757 | Ga0451853_0803757_670_1032 | 113 |
| 300 | 3300045976 | Ga0466967_0273113 | Ga0466967_0273113_629_976 | 113 |
| 301 | 3300046455 | Ga0495603_0088330 | Ga0495603_0088330_1264_1626 | 113 |
| 302 | 3300046459 | Ga0495629_0079226 | Ga0495629_0079226_1565_1927 | 113 |
| 303 | 3300046462 | Ga0495651_0007698 | Ga0495651_0007698_4134_4496 | 113 |
| 304 | 3300046463 | Ga0495653_0056714 | Ga0495653_0056714_1244_1606 | 113 |
| 305 | 3300046463 | Ga0495653_0309320 | Ga0495653_0309320_296_658 | 113 |
| 306 | 3300046472 | Ga0495580_0587359 | Ga0495580_0587359_46_408 | 113 |
| 307 | 3300046473 | Ga0495582_0265373 | Ga0495582_0265373_29_391 | 113 |
| 308 | 3300046475 | Ga0495639_0133911 | Ga0495639_0133911_38_400 | 113 |
| 309 | 3300046499 | Ga0495594_0505741 | Ga0495594_0505741_271_633 | 113 |
| 310 | 3300046511 | Ga0495608_0003131 | Ga0495608_0003131_6541_6903 | 113 |
| 311 | 3300046511 | Ga0495608_0120717 | Ga0495608_0120717_495_857 | 113 |
| 312 | 3300046514 | Ga0495618_0049808 | Ga0495618_0049808_924_1286 | 113 |
| 313 | 3300046516 | Ga0495628_0003835 | Ga0495628_0003835_3593_3955 | 113 |
| 314 | 3300046529 | Ga0495652_0306018 | Ga0495652_0306018_396_758 | 113 |
| 315 | 3300046533 | Ga0495640_0019315 | Ga0495640_0019315_4171_4533 | 113 |
| 316 | 3300046533 | Ga0495640_0080571 | Ga0495640_0080571_493_855 | 113 |
| 317 | 3300046543 | Ga0495645_0228423 | Ga0495645_0228423_786_1148 | 113 |
| 318 | 3300046559 | Ga0495667_0025766 | Ga0495667_0025766_1537_1899 | 113 |
| 319 | 3300046642 | Ga0495634_0028724 | Ga0495634_0028724_1171_1533 | 113 |
| 320 | 3300046663 | Ga0495635_0043941 | Ga0495635_0043941_1484_1846 | 113 |
| 321 | 3300046675 | Ga0495657_0013817 | Ga0495657_0013817_3745_4107 | 113 |
| 322 | 3300046678 | Ga0495599_0333401 | Ga0495599_0333401_308_670 | 113 |
| 323 | 3300046679 | Ga0495623_0063317 | Ga0495623_0063317_1454_1816 | 113 |
| 324 | 3300046680 | Ga0495646_0129835 | Ga0495646_0129835_911_1273 | 113 |
| 325 | 3300046680 | Ga0495646_0387292 | Ga0495646_0387292_38_400 | 113 |
| 326 | 3300046683 | Ga0495658_0349090 | Ga0495658_0349090_367_729 | 113 |
| 327 | 3300046683 | Ga0495658_0740748 | Ga0495658_0740748_64_426 | 113 |
| 328 | 3300046689 | Ga0495613_0096707 | Ga0495613_0096707_1512_1874 | 113 |
| 329 | 3300046689 | Ga0495613_0172053 | Ga0495613_0172053_441_803 | 113 |
| 330 | 3300046809 | Ga0495600_0009805 | Ga0495600_0009805_334_696 | 113 |
| 331 | 3300047317 | Ga0495604_0098532 | Ga0495604_0098532_435_797 | 113 |
| 332 | 3300047319 | Ga0495674_0037278 | Ga0495674_0037278_2456_2818 | 113 |
| 333 | 3300047321 | Ga0495676_0214024 | Ga0495676_0214024_502_864 | 113 |
| 334 | 3300047322 | Ga0495680_0006571 | Ga0495680_0006571_2027_2389 | 113 |
| 335 | 3300047444 | Ga0495675_0173908 | Ga0495675_0173908_135_497 | 113 |
| 336 | 3300047471 | Ga0495684_0055809 | Ga0495684_0055809_1166_1528 | 113 |
| 337 | 3300047673 | Ga0495593_0042794 | Ga0495593_0042794_1281_1643 | 113 |
| 338 | 3300047673 | Ga0495593_0218255 | Ga0495593_0218255_258_620 | 113 |
| 339 | 3300048088 | Ga0495602_0106137 | Ga0495602_0106137_681_1043 | 113 |
| 340 | 3300048088 | Ga0495602_0554298 | Ga0495602_0554298_335_697 | 113 |
| 341 | 3300048089 | Ga0495614_0285719 | Ga0495614_0285719_236_598 | 113 |
| 342 | 3300048908 | Ga0496105_0430073 | Ga0496105_0430073_609_971 | 113 |
| 343 | 3300048911 | Ga0496108_0250746 | Ga0496108_0250746_467_829 | 113 |
| 344 | 3300048913 | Ga0496110_0094975 | Ga0496110_0094975_1104_1466 | 113 |
| 345 | 3300048915 | Ga0496112_0481800 | Ga0496112_0481800_526_888 | 113 |
| 346 | 3300049573 | Ga0501037_0741991 | Ga0501037_0741991_68_409 | 113 |
| 347 | 3300049575 | Ga0501039_0058279 | Ga0501039_0058279_62_403 | 113 |
| 348 | 3300049582 | Ga0501048_0964017 | Ga0501048_0964017_36_377 | 113 |
| 349 | 3300049583 | Ga0501067_0161971 | Ga0501067_0161971_396_737 | 113 |
| 350 | 3300049587 | Ga0501071_0114944 | Ga0501071_0114944_639_980 | 113 |
| 351 | 3300049588 | Ga0501072_0188433 | Ga0501072_0188433_857_1198 | 113 |
| 352 | 3300049590 | Ga0501074_1183505 | Ga0501074_1183505_11_352 | 113 |
| 353 | 3300049591 | Ga0501075_0225759 | Ga0501075_0225759_1033_1374 | 113 |
| 354 | 3300049592 | Ga0501076_0097731 | Ga0501076_0097731_541_882 | 113 |
| 355 | 3300049593 | Ga0501077_0197782 | Ga0501077_0197782_671_1012 | 113 |
| 356 | 3300049741 | Ga0501079_0452964 | Ga0501079_0452964_15_356 | 113 |
| 357 | 3300049742 | Ga0501080_0664924 | Ga0501080_0664924_30_371 | 113 |
| 358 | 3300049743 | Ga0501081_0651868 | Ga0501081_0651868_259_600 | 113 |
| 359 | 3300049822 | Ga0501035_0084148 | Ga0501035_0084148_2438_2779 | 113 |
| 360 | 3300050509 | nmdc:mga0qj67_1299836_c1 | nmdc:mga0qj67_1299836_c1_155_502 | 113 |
| 361 | 3300050513 | nmdc:mga0rr50_521573_c1 | nmdc:mga0rr50_521573_c1_503_865 | 113 |
| 362 | 3300053077 | Ga0495601_0209836 | Ga0495601_0209836_212_574 | 113 |
| 363 | 3300053078 | Ga0495612_0081882 | Ga0495612_0081882_501_863 | 113 |
| 364 | 3300053078 | Ga0495612_0263107 | Ga0495612_0263107_80_442 | 113 |
| 365 | 3300053084 | Ga0495595_0058029 | Ga0495595_0058029_1386_1748 | 113 |
| 366 | 3300053085 | Ga0495619_0021359 | Ga0495619_0021359_2482_2844 | 113 |
| 367 | 3300054114 | Ga0501084_1332987 | Ga0501084_1332987_249_590 | 113 |
| 368 | 3300061734 | Ga0530510_0606042 | Ga0530510_0606042_100_441 | 113 |
| 369 | 3300005328 | Ga0070676_10870389 | Ga0070676_108703892 | 114 |
| 370 | 3300005334 | Ga0068869_101152264 | Ga0068869_1011522641 | 114 |
| 371 | 3300005336 | Ga0070680_101986540 | Ga0070680_1019865401 | 114 |
| 372 | 3300005338 | Ga0068868_100563877 | Ga0068868_1005638773 | 114 |
| 373 | 3300005339 | Ga0070660_100112750 | Ga0070660_1001127502 | 114 |
| 374 | 3300005353 | Ga0070669_100063759 | Ga0070669_1000637593 | 114 |
| 375 | 3300005356 | Ga0070674_100450765 | Ga0070674_1004507652 | 114 |
| 376 | 3300005364 | Ga0070673_100669566 | Ga0070673_1006695662 | 114 |
| 377 | 3300005366 | Ga0070659_100001291 | Ga0070659_10000129116 | 114 |
| 378 | 3300005366 | Ga0070659_100984434 | Ga0070659_1009844341 | 114 |
| 379 | 3300005434 | Ga0070709_11403648 | Ga0070709_114036481 | 114 |
| 380 | 3300005435 | Ga0070714_100030323 | Ga0070714_1000303234 | 114 |
| 381 | 3300005435 | Ga0070714_100175770 | Ga0070714_1001757703 | 114 |
| 382 | 3300005435 | Ga0070714_102166056 | Ga0070714_1021660561 | 114 |
| 383 | 3300005436 | Ga0070713_100660759 | Ga0070713_1006607592 | 114 |
| 384 | 3300005436 | Ga0070713_101352783 | Ga0070713_1013527832 | 114 |
| 385 | 3300005437 | Ga0070710_10733617 | Ga0070710_107336172 | 114 |
| 386 | 3300005445 | Ga0070708_101405723 | Ga0070708_1014057232 | 114 |
| 387 | 3300005459 | Ga0068867_100322171 | Ga0068867_1003221712 | 114 |
| 388 | 3300005535 | Ga0070684_100811943 | Ga0070684_1008119432 | 114 |
| 389 | 3300005536 | Ga0070697_100985412 | Ga0070697_1009854122 | 114 |
| 390 | 3300005547 | Ga0070693_100909828 | Ga0070693_1009098282 | 114 |
| 391 | 3300005549 | Ga0070704_101684568 | Ga0070704_1016845682 | 114 |
| 392 | 3300005614 | Ga0068856_102467832 | Ga0068856_1024678322 | 114 |
| 393 | 3300005616 | Ga0068852_101587235 | Ga0068852_1015872352 | 114 |
| 394 | 3300005718 | Ga0068866_10376082 | Ga0068866_103760822 | 114 |
| 395 | 3300005719 | Ga0068861_102155239 | Ga0068861_1021552392 | 114 |
| 396 | 3300005840 | Ga0068870_10601573 | Ga0068870_106015732 | 114 |
| 397 | 3300005842 | Ga0068858_101155261 | Ga0068858_1011552612 | 114 |
| 398 | 3300005937 | Ga0081455_10488256 | Ga0081455_104882561 | 114 |
| 399 | 3300005981 | Ga0081538_10082828 | Ga0081538_100828283 | 114 |
| 400 | 3300005985 | Ga0081539_10008072 | Ga0081539_100080723 | 114 |
| 401 | 3300006028 | Ga0070717_10000019 | Ga0070717_1000001957 | 114 |
| 402 | 3300006028 | Ga0070717_10645308 | Ga0070717_106453082 | 114 |
| 403 | 3300006028 | Ga0070717_11436225 | Ga0070717_114362251 | 114 |
| 404 | 3300006175 | Ga0070712_100190652 | Ga0070712_1001906522 | 114 |
| 405 | 3300006847 | Ga0075431_100484749 | Ga0075431_1004847492 | 114 |
| 406 | 3300006881 | Ga0068865_100402804 | Ga0068865_1004028042 | 114 |
| 407 | 3300009093 | Ga0105240_12536605 | Ga0105240_125366051 | 114 |
| 408 | 3300009098 | Ga0105245_10116838 | Ga0105245_101168383 | 114 |
| 409 | 3300009098 | Ga0105245_13129100 | Ga0105245_131291001 | 114 |
| 410 | 3300009148 | Ga0105243_10083402 | Ga0105243_100834022 | 114 |
| 411 | 3300009174 | Ga0105241_11755453 | Ga0105241_117554531 | 114 |
| 412 | 3300009176 | Ga0105242_10935462 | Ga0105242_109354621 | 114 |
| 413 | 3300013307 | Ga0157372_13222670 | Ga0157372_132226702 | 114 |
| 414 | 3300013308 | Ga0157375_11530306 | Ga0157375_115303063 | 114 |
| 415 | 3300014326 | Ga0157380_10348765 | Ga0157380_103487653 | 114 |
| 416 | 3300017792 | Ga0163161_10713870 | Ga0163161_107138703 | 114 |
| 417 | 3300020082 | Ga0206353_11254423 | Ga0206353_112544232 | 114 |
| 418 | 3300021377 | Ga0213874_10018401 | Ga0213874_100184013 | 114 |
| 419 | 3300021377 | Ga0213874_10038510 | Ga0213874_100385102 | 114 |
| 420 | 3300021377 | Ga0213874_10467612 | Ga0213874_104676121 | 114 |
| 421 | 3300021384 | Ga0213876_10015018 | Ga0213876_100150183 | 114 |
| 422 | 3300021384 | Ga0213876_10017120 | Ga0213876_100171202 | 114 |
| 423 | 3300021388 | Ga0213875_10011653 | Ga0213875_100116532 | 114 |
| 424 | 3300021388 | Ga0213875_10024360 | Ga0213875_100243603 | 114 |
| 425 | 3300025898 | Ga0207692_10427142 | Ga0207692_104271422 | 114 |
| 426 | 3300025901 | Ga0207688_10853890 | Ga0207688_108538902 | 114 |
| 427 | 3300025906 | Ga0207699_10992390 | Ga0207699_109923902 | 114 |
| 428 | 3300025907 | Ga0207645_10034910 | Ga0207645_100349102 | 114 |
| 429 | 3300025915 | Ga0207693_10197597 | Ga0207693_101975972 | 114 |
| 430 | 3300025919 | Ga0207657_10173108 | Ga0207657_101731083 | 114 |
| 431 | 3300025923 | Ga0207681_10004254 | Ga0207681_100042542 | 114 |
| 432 | 3300025927 | Ga0207687_10773495 | Ga0207687_107734952 | 114 |
| 433 | 3300025928 | Ga0207700_10713213 | Ga0207700_107132132 | 114 |
| 434 | 3300025928 | Ga0207700_11015812 | Ga0207700_110158122 | 114 |
| 435 | 3300025929 | Ga0207664_10107821 | Ga0207664_101078213 | 114 |
| 436 | 3300025932 | Ga0207690_10000061 | Ga0207690_1000006198 | 114 |
| 437 | 3300025934 | Ga0207686_10428683 | Ga0207686_104286832 | 114 |
| 438 | 3300025981 | Ga0207640_10155430 | Ga0207640_101554302 | 114 |
| 439 | 3300025981 | Ga0207640_11971220 | Ga0207640_119712201 | 114 |
| 440 | 3300026089 | Ga0207648_10582169 | Ga0207648_105821692 | 114 |
| 441 | 3300026118 | Ga0207675_100653356 | Ga0207675_1006533562 | 114 |
| 442 | 3300031548 | Ga0307408_100856804 | Ga0307408_1008568042 | 114 |
| 443 | 3300031731 | Ga0307405_10881403 | Ga0307405_108814032 | 114 |
| 444 | 3300031852 | Ga0307410_10474826 | Ga0307410_104748262 | 114 |
| 445 | 3300031852 | Ga0307410_11384391 | Ga0307410_113843912 | 114 |
| 446 | 3300031911 | Ga0307412_10320413 | Ga0307412_103204132 | 114 |
| 447 | 3300031995 | Ga0307409_100758223 | Ga0307409_1007582232 | 114 |
| 448 | 3300031995 | Ga0307409_101509063 | Ga0307409_1015090632 | 114 |
| 449 | 3300032002 | Ga0307416_100642553 | Ga0307416_1006425532 | 114 |
| 450 | 3300032002 | Ga0307416_103725721 | Ga0307416_1037257211 | 114 |
| 451 | 3300032004 | Ga0307414_10788800 | Ga0307414_107888002 | 114 |
| 452 | 3300032005 | Ga0307411_10518041 | Ga0307411_105180412 | 114 |
| 453 | 3300037853 | Ga0436364_1211610 | Ga0436364_1211610_2994_3359 | 114 |
| 454 | 3300039437 | Ga0436365_0402599 | Ga0436365_0402599_2757_3122 | 114 |
| 455 | 3300039437 | Ga0436365_0446222 | Ga0436365_0446222_113_463 | 114 |
| 456 | 3300039437 | Ga0436365_0785088 | Ga0436365_0785088_1333_1698 | 114 |
| 457 | 3300039437 | Ga0436365_1499059 | Ga0436365_1499059_1950_2300 | 114 |
| 458 | 3300039450 | Ga0436363_0260166 | Ga0436363_0260166_1096_1446 | 114 |
| 459 | 3300039450 | Ga0436363_0262026 | Ga0436363_0262026_119_469 | 114 |
| 460 | 3300039450 | Ga0436363_0808016 | Ga0436363_0808016_66_410 | 114 |
| 461 | 3300039450 | Ga0436363_1162396 | Ga0436363_1162396_173_523 | 114 |
| 462 | 3300039450 | Ga0436363_1413016 | Ga0436363_1413016_142_492 | 114 |
| 463 | 3300044656 | Ga0466969_0556136 | Ga0466969_0556136_140_484 | 114 |
| 464 | 3300044656 | Ga0466969_0586359 | Ga0466969_0586359_63_410 | 114 |
| 465 | 3300044683 | Ga0466965_0460710 | Ga0466965_0460710_305_652 | 114 |
| 466 | 3300044684 | Ga0466966_0080562 | Ga0466966_0080562_1022_1369 | 114 |
| 467 | 3300044684 | Ga0466966_0148259 | Ga0466966_0148259_472_840 | 114 |
| 468 | 3300044693 | Ga0466961_0115783 | Ga0466961_0115783_700_1044 | 114 |
| 469 | 3300044693 | Ga0466961_0615954 | Ga0466961_0615954_47_394 | 114 |
| 470 | 3300044694 | Ga0466963_0159345 | Ga0466963_0159345_559_903 | 114 |
| 471 | 3300044694 | Ga0466963_0299681 | Ga0466963_0299681_266_616 | 114 |
| 472 | 3300044694 | Ga0466963_0918491 | Ga0466963_0918491_61_408 | 114 |
| 473 | 3300044706 | Ga0466964_0119112 | Ga0466964_0119112_652_1002 | 114 |
| 474 | 3300044719 | Ga0466971_0020238 | Ga0466971_0020238_2563_2931 | 114 |
| 475 | 3300044765 | Ga0466970_0228912 | Ga0466970_0228912_424_792 | 114 |
| 476 | 3300044842 | Ga0466957_0159038 | Ga0466957_0159038_150_500 | 114 |
| 477 | 3300044842 | Ga0466957_1447750 | Ga0466957_1447750_70_417 | 114 |
| 478 | 3300045049 | Ga0466959_0147551 | Ga0466959_0147551_585_935 | 114 |
| 479 | 3300045049 | Ga0466959_0315880 | Ga0466959_0315880_614_958 | 114 |
| 480 | 3300045049 | Ga0466959_0354863 | Ga0466959_0354863_536_901 | 114 |
| 481 | 3300045049 | Ga0466959_0404072 | Ga0466959_0404072_446_793 | 114 |
| 482 | 3300045049 | Ga0466959_0457545 | Ga0466959_0457545_353_703 | 114 |
| 483 | 3300045836 | Ga0466958_0018647 | Ga0466958_0018647_407_754 | 114 |
| 484 | 3300045976 | Ga0466967_0051023 | Ga0466967_0051023_740_1090 | 114 |
| 485 | 3300045976 | Ga0466967_0160808 | Ga0466967_0160808_1291_1635 | 114 |
| 486 | 3300045976 | Ga0466967_0704130 | Ga0466967_0704130_192_536 | 114 |
| 487 | 3300046455 | Ga0495603_0681074 | Ga0495603_0681074_145_489 | 114 |
| 488 | 3300046529 | Ga0495652_0740217 | Ga0495652_0740217_137_502 | 114 |
| 489 | 3300047317 | Ga0495604_0000180 | Ga0495604_0000180_52408_52752 | 114 |
| 490 | 3300048907 | Ga0496104_0885476 | Ga0496104_0885476_276_641 | 114 |
| 491 | 3300048908 | Ga0496105_0501211 | Ga0496105_0501211_184_549 | 114 |
| 492 | 3300049572 | Ga0501036_1399085 | Ga0501036_1399085_130_474 | 114 |
| 493 | 3300049741 | Ga0501079_0873176 | Ga0501079_0873176_45_389 | 114 |
| 494 | 3300049824 | Ga0501045_0313028 | Ga0501045_0313028_420_764 | 114 |
| 495 | 3300049824 | Ga0501045_0881455 | Ga0501045_0881455_59_403 | 114 |
| 496 | 3300061719 | Ga0466962_0062138 | Ga0466962_0062138_658_1026 | 114 |
| 497 | 3300003659 | JGI25404J52841_10015002 | JGI25404J52841_100150022 | 115 |
| 498 | 3300005334 | Ga0068869_100680320 | Ga0068869_1006803202 | 115 |
| 499 | 3300005334 | Ga0068869_101958055 | Ga0068869_1019580552 | 115 |
| 500 | 3300005339 | Ga0070660_101343221 | Ga0070660_1013432212 | 115 |
| 501 | 3300005344 | Ga0070661_100325646 | Ga0070661_1003256463 | 115 |
| 502 | 3300005353 | Ga0070669_100233670 | Ga0070669_1002336701 | 115 |
| 503 | 3300005353 | Ga0070669_100864457 | Ga0070669_1008644572 | 115 |
| 504 | 3300005356 | Ga0070674_101942422 | Ga0070674_1019424221 | 115 |
| 505 | 3300005366 | Ga0070659_100692533 | Ga0070659_1006925332 | 115 |
| 506 | 3300005437 | Ga0070710_10565250 | Ga0070710_105652502 | 115 |
| 507 | 3300005438 | Ga0070701_10300059 | Ga0070701_103000592 | 115 |
| 508 | 3300005438 | Ga0070701_10482080 | Ga0070701_104820801 | 115 |
| 509 | 3300005439 | Ga0070711_100801577 | Ga0070711_1008015772 | 115 |
| 510 | 3300005444 | Ga0070694_101116812 | Ga0070694_1011168122 | 115 |
| 511 | 3300005456 | Ga0070678_101198659 | Ga0070678_1011986591 | 115 |
| 512 | 3300005457 | Ga0070662_100482829 | Ga0070662_1004828292 | 115 |
| 513 | 3300005535 | Ga0070684_100166434 | Ga0070684_1001664342 | 115 |
| 514 | 3300005548 | Ga0070665_100149577 | Ga0070665_1001495772 | 115 |
| 515 | 3300005564 | Ga0070664_100033731 | Ga0070664_1000337312 | 115 |
| 516 | 3300005564 | Ga0070664_100434965 | Ga0070664_1004349652 | 115 |
| 517 | 3300005564 | Ga0070664_101400759 | Ga0070664_1014007592 | 115 |
| 518 | 3300005577 | Ga0068857_100134302 | Ga0068857_1001343022 | 115 |
| 519 | 3300005614 | Ga0068856_101113527 | Ga0068856_1011135272 | 115 |
| 520 | 3300005614 | Ga0068856_101534788 | Ga0068856_1015347882 | 115 |
| 521 | 3300005615 | Ga0070702_100785989 | Ga0070702_1007859892 | 115 |
| 522 | 3300005616 | Ga0068852_101489052 | Ga0068852_1014890522 | 115 |
| 523 | 3300005618 | Ga0068864_100456665 | Ga0068864_1004566652 | 115 |
| 524 | 3300005718 | Ga0068866_10292550 | Ga0068866_102925502 | 115 |
| 525 | 3300005719 | Ga0068861_100208453 | Ga0068861_1002084533 | 115 |
| 526 | 3300005937 | Ga0081455_10093906 | Ga0081455_100939062 | 115 |
| 527 | 3300005983 | Ga0081540_1002479 | Ga0081540_100247914 | 115 |
| 528 | 3300006058 | Ga0075432_10609814 | Ga0075432_106098142 | 115 |
| 529 | 3300006881 | Ga0068865_101899332 | Ga0068865_1018993321 | 115 |
| 530 | 3300006881 | Ga0068865_102128456 | Ga0068865_1021284561 | 115 |
| 531 | 3300007076 | Ga0075435_100924675 | Ga0075435_1009246751 | 115 |
| 532 | 3300009098 | Ga0105245_10019447 | Ga0105245_100194474 | 115 |
| 533 | 3300009101 | Ga0105247_10153187 | Ga0105247_101531871 | 115 |
| 534 | 3300009148 | Ga0105243_10126617 | Ga0105243_101266173 | 115 |
| 535 | 3300009148 | Ga0105243_12277700 | Ga0105243_122777001 | 115 |
| 536 | 3300009176 | Ga0105242_10414922 | Ga0105242_104149222 | 115 |
| 537 | 3300010375 | Ga0105239_11031001 | Ga0105239_110310011 | 115 |
| 538 | 3300011119 | Ga0105246_10118851 | Ga0105246_101188513 | 115 |
| 539 | 3300013100 | Ga0157373_11259909 | Ga0157373_112599092 | 115 |
| 540 | 3300013297 | Ga0157378_11993696 | Ga0157378_119936962 | 115 |
| 541 | 3300013306 | Ga0163162_11406603 | Ga0163162_114066032 | 115 |
| 542 | 3300014325 | Ga0163163_11799166 | Ga0163163_117991661 | 115 |
| 543 | 3300014497 | Ga0182008_10137868 | Ga0182008_101378682 | 115 |
| 544 | 3300025901 | Ga0207688_10270993 | Ga0207688_102709932 | 115 |
| 545 | 3300025906 | Ga0207699_11330602 | Ga0207699_113306022 | 115 |
| 546 | 3300025916 | Ga0207663_10295216 | Ga0207663_102952162 | 115 |
| 547 | 3300025923 | Ga0207681_10837647 | Ga0207681_108376472 | 115 |
| 548 | 3300025934 | Ga0207686_10375023 | Ga0207686_103750232 | 115 |
| 549 | 3300025935 | Ga0207709_10571420 | Ga0207709_105714202 | 115 |
| 550 | 3300025935 | Ga0207709_11032772 | Ga0207709_110327722 | 115 |
| 551 | 3300025935 | Ga0207709_11107119 | Ga0207709_111071192 | 115 |
| 552 | 3300025937 | Ga0207669_10673705 | Ga0207669_106737052 | 115 |
| 553 | 3300025938 | Ga0207704_11251900 | Ga0207704_112519001 | 115 |
| 554 | 3300025939 | Ga0207665_11364378 | Ga0207665_113643782 | 115 |
| 555 | 3300025942 | Ga0207689_10383692 | Ga0207689_103836923 | 115 |
| 556 | 3300025942 | Ga0207689_10593340 | Ga0207689_105933403 | 115 |
| 557 | 3300025944 | Ga0207661_10574834 | Ga0207661_105748342 | 115 |
| 558 | 3300025945 | Ga0207679_10079850 | Ga0207679_100798502 | 115 |
| 559 | 3300025945 | Ga0207679_11868187 | Ga0207679_118681872 | 115 |
| 560 | 3300025972 | Ga0207668_10559343 | Ga0207668_105593432 | 115 |
| 561 | 3300025981 | Ga0207640_10664354 | Ga0207640_106643542 | 115 |
| 562 | 3300026067 | Ga0207678_10571448 | Ga0207678_105714482 | 115 |
| 563 | 3300026075 | Ga0207708_10113581 | Ga0207708_101135813 | 115 |
| 564 | 3300026078 | Ga0207702_10973485 | Ga0207702_109734851 | 115 |
| 565 | 3300026078 | Ga0207702_11343288 | Ga0207702_113432882 | 115 |
| 566 | 3300026095 | Ga0207676_10397276 | Ga0207676_103972763 | 115 |
| 567 | 3300026095 | Ga0207676_11546448 | Ga0207676_115464482 | 115 |
| 568 | 3300026116 | Ga0207674_10153416 | Ga0207674_101534162 | 115 |
| 569 | 3300026118 | Ga0207675_101414560 | Ga0207675_1014145602 | 115 |
| 570 | 3300026142 | Ga0207698_11066725 | Ga0207698_110667251 | 115 |
| 571 | 3300027907 | Ga0207428_10818547 | Ga0207428_108185472 | 115 |
| 572 | 3300031548 | Ga0307408_100994476 | Ga0307408_1009944762 | 115 |
| 573 | 3300031852 | Ga0307410_10490022 | Ga0307410_104900223 | 115 |
| 574 | 3300031901 | Ga0307406_10201277 | Ga0307406_102012772 | 115 |
| 575 | 3300031911 | Ga0307412_10689299 | Ga0307412_106892992 | 115 |
| 576 | 3300031995 | Ga0307409_100273742 | Ga0307409_1002737422 | 115 |
| 577 | 3300032002 | Ga0307416_100731750 | Ga0307416_1007317502 | 115 |
| 578 | 3300032126 | Ga0307415_100027856 | Ga0307415_1000278564 | 115 |
| 579 | 3300032126 | Ga0307415_100530126 | Ga0307415_1005301262 | 115 |
| 580 | 3300037853 | Ga0436364_0419300 | Ga0436364_0419300_76_426 | 115 |
| 581 | 3300044694 | Ga0466963_1157750 | Ga0466963_1157750_163_513 | 115 |
| 582 | 3300046461 | Ga0495641_0384293 | Ga0495641_0384293_148_495 | 115 |
| 583 | 3300046473 | Ga0495582_0704431 | Ga0495582_0704431_176_523 | 115 |
| 584 | 3300046674 | Ga0495588_0378923 | Ga0495588_0378923_114_473 | 115 |
| 585 | 3300048904 | Ga0496101_0005130 | Ga0496101_0005130_4964_5335 | 115 |
| 586 | 3300048905 | Ga0496102_0432701 | Ga0496102_0432701_43_414 | 115 |
| 587 | 3300048908 | Ga0496105_0927168 | Ga0496105_0927168_253_624 | 115 |
| 588 | 3300048909 | Ga0496106_0012759 | Ga0496106_0012759_2219_2590 | 115 |
| 589 | 3300048910 | Ga0496107_0006595 | Ga0496107_0006595_1344_1715 | 115 |
| 590 | 3300048917 | Ga0496114_0270470 | Ga0496114_0270470_25_396 | 115 |
| 591 | 3300048918 | Ga0496115_0149188 | Ga0496115_0149188_1094_1465 | 115 |
| 592 | 3300049568 | Ga0501031_0012132 | Ga0501031_0012132_1373_1720 | 115 |
| 593 | 3300049569 | Ga0501032_0011109 | Ga0501032_0011109_1849_2196 | 115 |
| 594 | 3300049570 | Ga0501033_0010308 | Ga0501033_0010308_2909_3256 | 115 |
| 595 | 3300049571 | Ga0501034_0178238 | Ga0501034_0178238_1482_1829 | 115 |
| 596 | 3300049572 | Ga0501036_0163008 | Ga0501036_0163008_1345_1692 | 115 |
| 597 | 3300049573 | Ga0501037_0024274 | Ga0501037_0024274_311_658 | 115 |
| 598 | 3300049574 | Ga0501038_0002656 | Ga0501038_0002656_2514_2861 | 115 |
| 599 | 3300049575 | Ga0501039_0046034 | Ga0501039_0046034_197_544 | 115 |
| 600 | 3300049576 | Ga0501040_0245845 | Ga0501040_0245845_52_399 | 115 |
| 601 | 3300049578 | Ga0501042_0125844 | Ga0501042_0125844_804_1151 | 115 |
| 602 | 3300049579 | Ga0501043_0010586 | Ga0501043_0010586_1499_1846 | 115 |
| 603 | 3300049580 | Ga0501046_0101824 | Ga0501046_0101824_880_1227 | 115 |
| 604 | 3300049581 | Ga0501047_0130216 | Ga0501047_0130216_833_1180 | 115 |
| 605 | 3300049582 | Ga0501048_0032493 | Ga0501048_0032493_991_1338 | 115 |
| 606 | 3300049583 | Ga0501067_0006428 | Ga0501067_0006428_3576_3923 | 115 |
| 607 | 3300049584 | Ga0501068_0100487 | Ga0501068_0100487_1211_1558 | 115 |
| 608 | 3300049585 | Ga0501069_0026324 | Ga0501069_0026324_1848_2195 | 115 |
| 609 | 3300049586 | Ga0501070_0074272 | Ga0501070_0074272_986_1333 | 115 |
| 610 | 3300049587 | Ga0501071_0073482 | Ga0501071_0073482_838_1185 | 115 |
| 611 | 3300049587 | Ga0501071_0695398 | Ga0501071_0695398_17_367 | 115 |
| 612 | 3300049588 | Ga0501072_0081793 | Ga0501072_0081793_418_765 | 115 |
| 613 | 3300049589 | Ga0501073_0010446 | Ga0501073_0010446_1037_1384 | 115 |
| 614 | 3300049590 | Ga0501074_0018326 | Ga0501074_0018326_3747_4094 | 115 |
| 615 | 3300049741 | Ga0501079_0055286 | Ga0501079_0055286_2397_2744 | 115 |
| 616 | 3300049742 | Ga0501080_0558118 | Ga0501080_0558118_608_955 | 115 |
| 617 | 3300049743 | Ga0501081_1371886 | Ga0501081_1371886_147_497 | 115 |
| 618 | 3300049744 | Ga0501083_0018408 | Ga0501083_0018408_1543_1890 | 115 |
| 619 | 3300049822 | Ga0501035_0100706 | Ga0501035_0100706_1344_1691 | 115 |
| 620 | 3300049823 | Ga0501044_0091391 | Ga0501044_0091391_1380_1727 | 115 |
| 621 | 3300049824 | Ga0501045_0075424 | Ga0501045_0075424_720_1067 | 115 |
| 622 | 3300050507 | nmdc:mga05p37_268784_c1 | nmdc:mga05p37_268784_c1_1487_1837 | 115 |
| 623 | 3300050508 | nmdc:mga09592_10828_c1 | nmdc:mga09592_10828_c1_2048_2398 | 115 |
| 624 | 3300050509 | nmdc:mga0qj67_15821_c1 | nmdc:mga0qj67_15821_c1_5213_5563 | 115 |
| 625 | 3300050510 | nmdc:mga06r32_1137728_c1 | nmdc:mga06r32_1137728_c1_173_523 | 115 |
| 626 | 3300050511 | nmdc:mga08y16_1345027_c1 | nmdc:mga08y16_1345027_c1_137_484 | 115 |
| 627 | 3300054114 | Ga0501084_0203557 | Ga0501084_0203557_1301_1648 | 115 |
| 628 | 3300059491 | Ga0587070_018036 | Ga0587070_018036_304_654 | 115 |
| 629 | 3300059655 | Ga0587114_138706 | Ga0587114_138706_93_440 | 115 |
| 630 | 3300060344 | Ga0587071_119514 | Ga0587071_119514_128_478 | 115 |
| 631 | 3300060353 | Ga0501082_0031883 | Ga0501082_0031883_3209_3556 | 115 |
| 632 | 3300060353 | Ga0501082_0326660 | Ga0501082_0326660_601_951 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dyj-assembly1.cif.gz_A | crystal structure of ribosome-binding factor a from thermus thermophilus hb8 | 0.9506 | 6 | 94 |
| 2dyj-assembly2.cif.gz_B | crystal structure of ribosome-binding factor a from thermus thermophilus hb8 | 0.9346 | 6 | 94 |
| 7nav-assembly1.cif.gz_V | bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) | 0.9249 | 5 | 97 |
| 8byv-assembly1.cif.gz_A | cryo-em structure of a staphylococus aureus 30s-rbfa complex | 0.9131 | 1 | 110 |
| 8bxa-assembly1.cif.gz_A | crystal structure of ribosome binding factor a (rbfa) from s. aureus | 0.9078 | 1 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dyjB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9346 | 6 | 94 | 3.30.300.20 |
| af_P0A7G2_1_108_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9167 | 1 | 102 | 3.30.300.20 |
| af_Q5VPH3_41_157_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9073 | 2 | 101 | 3.30.300.20 |
| af_Q2G2Q4_1_115_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8998 | 1 | 110 | 3.30.300.20 |
| 2kzfA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8886 | 1 | 93 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4HV54-F1-model_v4 | Ribosome-binding factor A | 0.9861 | 5 | 109 |
GO:0005829
GO:0030490 GO:0043024 |
| AF-A0A2V8TQE8-F1-model_v4 | Ribosome-binding factor A | 0.9811 | 1 | 95 |
GO:0005829
GO:0030490 GO:0043024 |
| AF-A0A496UT03-F1-model_v4 | Ribosome-binding factor A | 0.9797 | 1 | 110 |
GO:0003676
GO:0005737 GO:0030490 |
| AF-A0A3D0N7V1-F1-model_v4 | Ribosome-binding factor A | 0.9792 | 4 | 111 |
GO:0005829
GO:0030490 GO:0043024 |
| AF-A0A535F431-F1-model_v4 | Ribosome-binding factor A | 0.9786 | 2 | 110 |
GO:0005829
GO:0030490 GO:0043024 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar