F470992

General Info

Members Datasets Scaffolds Average Seq Length
632 318 632 115

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11755453|Ga0105241_117554531
Length 114
Sequence MSADRMRRVNEAVREVLSDAVKLLKDPRVGFVTVTDVRTSPDLRHAKVFVSVLGSEQERAATMDGLASAHGVLQAAVNRELRMKRTPTLDFVYHDTAERADRLERMLADMEQPT

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
86 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 8.23
Rhizosphere 87.34
Stem 0
Stem Tuber 0
Unclassified 4.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10015002 3300003659 Bacteria 1683
2 Ga0070676_10870389 3300005328 Bacteria 669
3 Ga0070683_100316614 3300005329 Bacteria 1485
4 Ga0070683_100878503 3300005329 Unclassified 860
5 Ga0068869_100266591 3300005334 Bacteria 1373
6 Ga0068869_100680320 3300005334 Unclassified 876
7 Ga0068869_101152264 3300005334 Bacteria 680
8 Ga0068869_101958055 3300005334 Bacteria 525
9 Ga0070680_101986540 3300005336 Unclassified 504
10 Ga0068868_100026801 3300005338 Bacteria 4394
11 Ga0068868_100380787 3300005338 Bacteria 1214
12 Ga0068868_100563877 3300005338 Bacteria 1005
13 Ga0068868_100839825 3300005338 Bacteria 831
14 Ga0070660_100112750 3300005339 Bacteria 2165
15 Ga0070660_101343221 3300005339 Bacteria 607
16 Ga0070689_101625001 3300005340 Bacteria 587
17 Ga0070661_100325646 3300005344 Bacteria 1201
18 Ga0070661_100400758 3300005344 Bacteria 1085
19 Ga0070661_100806128 3300005344 Bacteria 771
20 Ga0070692_10143735 3300005345 Bacteria 1353
21 Ga0070668_100293002 3300005347 Bacteria 1363
22 Ga0070668_100803647 3300005347 Bacteria 836
23 Ga0070669_100063759 3300005353 Bacteria 2713
24 Ga0070669_100233670 3300005353 Bacteria 1458
25 Ga0070669_100864457 3300005353 Bacteria 771
26 Ga0070674_100450765 3300005356 Bacteria 1062
27 Ga0070674_101942422 3300005356 Bacteria 535
28 Ga0070673_100669566 3300005364 Bacteria 951
29 Ga0070659_100001291 3300005366 Bacteria 18154
30 Ga0070659_100148371 3300005366 Bacteria 1912
31 Ga0070659_100499116 3300005366 Bacteria 1037
32 Ga0070659_100692533 3300005366 Bacteria 881
33 Ga0070659_100843173 3300005366 Bacteria 799
34 Ga0070659_100984434 3300005366 Bacteria 740
35 Ga0070667_101060114 3300005367 Bacteria 757
36 Ga0070709_11403648 3300005434 Unclassified 565
37 Ga0070714_100030323 3300005435 Bacteria 4500
38 Ga0070714_100172337 3300005435 Bacteria 1964
39 Ga0070714_100175770 3300005435 Bacteria 1945
40 Ga0070714_100856214 3300005435 Bacteria 882
41 Ga0070714_102166056 3300005435 Unclassified 541
42 Ga0070713_100139778 3300005436 Bacteria 2144
43 Ga0070713_100660759 3300005436 Bacteria 996
44 Ga0070713_101352783 3300005436 Unclassified 690
45 Ga0070710_10061767 3300005437 Bacteria 2135
46 Ga0070710_10565250 3300005437 Unclassified 787
47 Ga0070710_10733617 3300005437 Unclassified 700
48 Ga0070701_10300059 3300005438 Bacteria 987
49 Ga0070701_10354983 3300005438 Unclassified 917
50 Ga0070701_10482080 3300005438 Bacteria 802
51 Ga0070711_100028025 3300005439 Bacteria 3702
52 Ga0070711_100801577 3300005439 Bacteria 799
53 Ga0070705_100003636 3300005440 Bacteria 7548
54 Ga0070700_100186125 3300005441 Bacteria 1449
55 Ga0070694_101116812 3300005444 Unclassified 658
56 Ga0070708_101405723 3300005445 Bacteria 651
57 Ga0070663_101085892 3300005455 Bacteria 699
58 Ga0070663_102074929 3300005455 Bacteria 512
59 Ga0070678_101198659 3300005456 Bacteria 704
60 Ga0070662_100049793 3300005457 Bacteria 3022
61 Ga0070662_100213214 3300005457 Bacteria 1537
62 Ga0070662_100482829 3300005457 Bacteria 1032
63 Ga0068867_100180407 3300005459 Bacteria 1678
64 Ga0068867_100322171 3300005459 Bacteria 1281
65 Ga0070684_100166434 3300005535 Bacteria 2001
66 Ga0070684_100811943 3300005535 Bacteria 875
67 Ga0070697_100985412 3300005536 Bacteria 749
68 Ga0070672_100858029 3300005543 Bacteria 801
69 Ga0070686_100274291 3300005544 Bacteria 1241
70 Ga0070686_101591316 3300005544 Bacteria 553
71 Ga0070695_100426192 3300005545 Unclassified 1011
72 Ga0070693_100909828 3300005547 Bacteria 660
73 Ga0070693_101300283 3300005547 Unclassified 562
74 Ga0070665_100149577 3300005548 Bacteria 2338
75 Ga0070704_100293977 3300005549 Bacteria 1351
76 Ga0070704_101684568 3300005549 Unclassified 586
77 Ga0070664_100033731 3300005564 Bacteria 4290
78 Ga0070664_100431824 3300005564 Bacteria 1207
79 Ga0070664_100434965 3300005564 Bacteria 1203
80 Ga0070664_101400759 3300005564 Bacteria 661
81 Ga0068857_100134302 3300005577 Bacteria 2234
82 Ga0068857_100211718 3300005577 Bacteria 1769
83 Ga0068854_100409567 3300005578 Bacteria 1124
84 Ga0068854_100437044 3300005578 Bacteria 1090
85 Ga0068856_100104790 3300005614 Bacteria 2823
86 Ga0068856_101113527 3300005614 Bacteria 807
87 Ga0068856_101534788 3300005614 Bacteria 680
88 Ga0068856_101870159 3300005614 Bacteria 611
89 Ga0068856_102467832 3300005614 Unclassified 527
90 Ga0070702_100005728 3300005615 Bacteria 5817
91 Ga0070702_100785989 3300005615 Bacteria 735
92 Ga0070702_101862884 3300005615 Bacteria 504
93 Ga0068852_100212996 3300005616 Bacteria 1834
94 Ga0068852_100534027 3300005616 Bacteria 1172
95 Ga0068852_101489052 3300005616 Unclassified 699
96 Ga0068852_101587235 3300005616 Bacteria 677
97 Ga0068859_100559774 3300005617 Bacteria 1237
98 Ga0068859_100652156 3300005617 Bacteria 1145
99 Ga0068864_100456665 3300005618 Bacteria 1222
100 Ga0068866_10066783 3300005718 Bacteria 1886
101 Ga0068866_10292550 3300005718 Unclassified 1014
102 Ga0068866_10376082 3300005718 Bacteria 910
103 Ga0068861_100047929 3300005719 Bacteria 3227
104 Ga0068861_100208453 3300005719 Bacteria 1645
105 Ga0068861_102155239 3300005719 Unclassified 558
106 Ga0068870_10601573 3300005840 Bacteria 747
107 Ga0068863_100766542 3300005841 Bacteria 961
108 Ga0068863_100862516 3300005841 Bacteria 905
109 Ga0068863_101021383 3300005841 Bacteria 830
110 Ga0068858_101155261 3300005842 Bacteria 761
111 Ga0068862_100410166 3300005844 Bacteria 1269
112 Ga0081455_10002456 3300005937 Bacteria 22063
113 Ga0081455_10093906 3300005937 Bacteria 2424
114 Ga0081455_10136625 3300005937 Bacteria 1909
115 Ga0081455_10488256 3300005937 Bacteria 831
116 Ga0081538_10007594 3300005981 Bacteria 9353
117 Ga0081538_10082828 3300005981 Bacteria 1699
118 Ga0081540_1002479 3300005983 Bacteria 15034
119 Ga0081540_1059534 3300005983 Bacteria 1833
120 Ga0081539_10008072 3300005985 Bacteria 9317
121 Ga0070717_10000019 3300006028 Bacteria 178051
122 Ga0070717_10645308 3300006028 Bacteria 961
123 Ga0070717_11436225 3300006028 Unclassified 626
124 Ga0075365_10453002 3300006038 Bacteria 906
125 Ga0075432_10197346 3300006058 Bacteria 795
126 Ga0075432_10609814 3300006058 Bacteria 500
127 Ga0070715_10248258 3300006163 Bacteria 929
128 Ga0070716_100048773 3300006173 Bacteria 2396
129 Ga0070712_100017563 3300006175 Bacteria 4633
130 Ga0070712_100190652 3300006175 Bacteria 1604
131 Ga0075428_100143651 3300006844 Bacteria 2594
132 Ga0075430_100023879 3300006846 Bacteria 5206
133 Ga0075431_100035801 3300006847 Bacteria 5111
134 Ga0075431_100484749 3300006847 Bacteria 1229
135 Ga0075434_102019241 3300006871 Bacteria 582
136 Ga0075429_100009960 3300006880 Bacteria 8236
137 Ga0068865_100402804 3300006881 Bacteria 1121
138 Ga0068865_101315613 3300006881 Unclassified 643
139 Ga0068865_101899332 3300006881 Bacteria 539
140 Ga0068865_102128456 3300006881 Unclassified 510
141 Ga0097620_100559802 3300006931 Bacteria 1237
142 Ga0097620_100652153 3300006931 Bacteria 1145
143 Ga0075435_100576793 3300007076 Bacteria 975
144 Ga0075435_100924675 3300007076 Unclassified 761
145 Ga0105240_10122371 3300009093 Bacteria 3131
146 Ga0105240_12536605 3300009093 Unclassified 530
147 Ga0111539_10605093 3300009094 Bacteria 1276
148 Ga0111539_11698353 3300009094 Bacteria 732
149 Ga0111539_12329515 3300009094 Unclassified 621
150 Ga0105245_10019447 3300009098 Bacteria 5950
151 Ga0105245_10116838 3300009098 Bacteria 2488
152 Ga0105245_10166028 3300009098 Bacteria 2099
153 Ga0105245_10985577 3300009098 Bacteria 887
154 Ga0105245_11162312 3300009098 Bacteria 819
155 Ga0105245_13129100 3300009098 Bacteria 513
156 Ga0105247_10153187 3300009101 Bacteria 1520
157 Ga0105247_10490994 3300009101 Bacteria 893
158 Ga0114129_10265746 3300009147 Bacteria 2297
159 Ga0105243_10083402 3300009148 Bacteria 2615
160 Ga0105243_10126617 3300009148 Bacteria 2162
161 Ga0105243_10987886 3300009148 Bacteria 843
162 Ga0105243_12277700 3300009148 Unclassified 579
163 Ga0105241_11066946 3300009174 Unclassified 759
164 Ga0105241_11755453 3300009174 Bacteria 604
165 Ga0105242_10003748 3300009176 Bacteria 11810
166 Ga0105242_10414922 3300009176 Bacteria 1260
167 Ga0105242_10935462 3300009176 Bacteria 870
168 Ga0105248_11488131 3300009177 Bacteria 766
169 Ga0105237_12111398 3300009545 Bacteria 572
170 Ga0105238_10813446 3300009551 Bacteria 950
171 Ga0105249_10152728 3300009553 Bacteria 2224
172 Ga0105249_11320746 3300009553 Bacteria 793
173 Ga0105249_12718523 3300009553 Bacteria 567
174 Ga0105249_12839180 3300009553 Bacteria 556
175 Ga0105239_11031001 3300010375 Unclassified 946
176 Ga0105239_11452629 3300010375 Unclassified 792
177 Ga0105246_10040064 3300011119 Bacteria 3160
178 Ga0105246_10118851 3300011119 Bacteria 1955
179 Ga0157321_1038485 3300012487 Bacteria 517
180 Ga0157323_1041619 3300012495 Bacteria 529
181 Ga0157373_11259909 3300013100 Unclassified 559
182 Ga0157371_10878615 3300013102 Bacteria 679
183 Ga0157369_11610525 3300013105 Bacteria 660
184 Ga0157378_11993696 3300013297 Unclassified 630
185 Ga0163162_11406603 3300013306 Bacteria 794
186 Ga0157372_10410900 3300013307 Bacteria 1577
187 Ga0157372_10667058 3300013307 Bacteria 1211
188 Ga0157372_13222670 3300013307 Bacteria 520
189 Ga0157375_11276997 3300013308 Bacteria 863
190 Ga0157375_11530306 3300013308 Unclassified 788
191 Ga0157375_13345931 3300013308 Unclassified 534
192 Ga0163163_10992998 3300014325 Bacteria 903
193 Ga0163163_11799166 3300014325 Bacteria 673
194 Ga0157380_10348765 3300014326 Bacteria 1384
195 Ga0157380_10430707 3300014326 Bacteria 1261
196 Ga0157380_12417556 3300014326 Bacteria 591
197 Ga0182008_10137868 3300014497 Bacteria 1219
198 Ga0182008_10202468 3300014497 Bacteria 1010
199 Ga0157377_10631643 3300014745 Bacteria 768
200 Ga0157379_10003495 3300014968 Bacteria 13314
201 Ga0157376_10850266 3300014969 Bacteria 928
202 Ga0163161_10713870 3300017792 Bacteria 836
203 Ga0206353_11254423 3300020082 Bacteria 1241
204 Ga0213874_10018401 3300021377 Bacteria 1887
205 Ga0213874_10038510 3300021377 Bacteria 1419
206 Ga0213874_10278177 3300021377 Unclassified 624
207 Ga0213874_10467612 3300021377 Unclassified 500
208 Ga0213876_10015018 3300021384 Bacteria 4104
209 Ga0213876_10017120 3300021384 Bacteria 3827
210 Ga0213875_10011653 3300021388 Bacteria 4368
211 Ga0213875_10024360 3300021388 Bacteria 2887
212 Ga0207692_10427142 3300025898 Bacteria 830
213 Ga0207692_10428981 3300025898 Unclassified 829
214 Ga0207692_10895745 3300025898 Bacteria 583
215 Ga0207642_10024985 3300025899 Bacteria 2410
216 Ga0207688_10018945 3300025901 Bacteria 3745
217 Ga0207688_10270993 3300025901 Bacteria 1032
218 Ga0207688_10853890 3300025901 Bacteria 577
219 Ga0207699_10199976 3300025906 Bacteria 1353
220 Ga0207699_10992390 3300025906 Unclassified 621
221 Ga0207699_11330602 3300025906 Unclassified 532
222 Ga0207645_10034910 3300025907 Bacteria 3229
223 Ga0207695_10035094 3300025913 Bacteria 5444
224 Ga0207693_10000017 3300025915 Bacteria 139308
225 Ga0207693_10008897 3300025915 Bacteria 8203
226 Ga0207693_10197597 3300025915 Bacteria 1582
227 Ga0207693_10597626 3300025915 Bacteria 859
228 Ga0207663_10196188 3300025916 Bacteria 1453
229 Ga0207663_10295216 3300025916 Bacteria 1209
230 Ga0207662_10896355 3300025918 Bacteria 628
231 Ga0207657_10173108 3300025919 Bacteria 1748
232 Ga0207649_10638901 3300025920 Bacteria 821
233 Ga0207649_11304552 3300025920 Bacteria 574
234 Ga0207681_10004254 3300025923 Bacteria 8837
235 Ga0207681_10837647 3300025923 Bacteria 769
236 Ga0207687_10189845 3300025927 Bacteria 1598
237 Ga0207687_10773495 3300025927 Bacteria 818
238 Ga0207687_10872944 3300025927 Unclassified 769
239 Ga0207700_10713213 3300025928 Bacteria 896
240 Ga0207700_11015812 3300025928 Unclassified 742
241 Ga0207664_10089694 3300025929 Bacteria 2518
242 Ga0207664_10103740 3300025929 Bacteria 2353
243 Ga0207664_10107821 3300025929 Bacteria 2311
244 Ga0207690_10000061 3300025932 Bacteria 98910
245 Ga0207690_10253094 3300025932 Bacteria 1361
246 Ga0207690_10634207 3300025932 Bacteria 874
247 Ga0207706_10041686 3300025933 Bacteria 4069
248 Ga0207706_10755822 3300025933 Bacteria 828
249 Ga0207686_10375023 3300025934 Bacteria 1077
250 Ga0207686_10428683 3300025934 Bacteria 1013
251 Ga0207709_10571420 3300025935 Bacteria 892
252 Ga0207709_11032772 3300025935 Bacteria 673
253 Ga0207709_11077373 3300025935 Bacteria 659
254 Ga0207709_11107119 3300025935 Bacteria 650
255 Ga0207669_10673705 3300025937 Bacteria 848
256 Ga0207704_11163090 3300025938 Bacteria 657
257 Ga0207704_11251900 3300025938 Bacteria 633
258 Ga0207665_10039880 3300025939 Bacteria 3132
259 Ga0207665_11364378 3300025939 Unclassified 565
260 Ga0207691_10424153 3300025940 Bacteria 1133
261 Ga0207689_10383692 3300025942 Bacteria 1170
262 Ga0207689_10459246 3300025942 Bacteria 1065
263 Ga0207689_10593340 3300025942 Unclassified 932
264 Ga0207661_10574834 3300025944 Bacteria 1033
265 Ga0207661_10754000 3300025944 Unclassified 896
266 Ga0207661_10772017 3300025944 Bacteria 885
267 Ga0207679_10079850 3300025945 Bacteria 2496
268 Ga0207679_10861566 3300025945 Bacteria 828
269 Ga0207679_11868187 3300025945 Unclassified 548
270 Ga0207679_11882860 3300025945 Bacteria 546
271 Ga0207712_10584663 3300025961 Bacteria 964
272 Ga0207668_10559343 3300025972 Bacteria 992
273 Ga0207640_10155430 3300025981 Bacteria 1685
274 Ga0207640_10340732 3300025981 Bacteria 1201
275 Ga0207640_10664354 3300025981 Bacteria 889
276 Ga0207640_10781346 3300025981 Bacteria 826
277 Ga0207640_11971220 3300025981 Bacteria 529
278 Ga0207677_10696132 3300026023 Bacteria 901
279 Ga0207677_10823894 3300026023 Bacteria 832
280 Ga0207703_10258439 3300026035 Bacteria 1573
281 Ga0207703_11152725 3300026035 Bacteria 745
282 Ga0207678_10113326 3300026067 Bacteria 2314
283 Ga0207678_10136306 3300026067 Bacteria 2094
284 Ga0207678_10561378 3300026067 Bacteria 999
285 Ga0207678_10571448 3300026067 Bacteria 990
286 Ga0207708_10027228 3300026075 Bacteria 4328
287 Ga0207708_10113581 3300026075 Bacteria 2105
288 Ga0207702_10051574 3300026078 Bacteria 3478
289 Ga0207702_10258612 3300026078 Bacteria 1638
290 Ga0207702_10973485 3300026078 Unclassified 841
291 Ga0207702_11343288 3300026078 Unclassified 709
292 Ga0207641_10369115 3300026088 Bacteria 1372
293 Ga0207648_10085987 3300026089 Bacteria 2743
294 Ga0207648_10582169 3300026089 Bacteria 1030
295 Ga0207676_10318792 3300026095 Bacteria 1426
296 Ga0207676_10397276 3300026095 Bacteria 1287
297 Ga0207676_11546448 3300026095 Bacteria 661
298 Ga0207674_10153416 3300026116 Bacteria 2259
299 Ga0207674_10222943 3300026116 Bacteria 1834
300 Ga0207674_10864087 3300026116 Bacteria 872
301 Ga0207675_100022184 3300026118 Bacteria 5912
302 Ga0207675_100653356 3300026118 Bacteria 1058
303 Ga0207675_101414560 3300026118 Bacteria 716
304 Ga0207683_10130758 3300026121 Bacteria 2258
305 Ga0207698_10234543 3300026142 Bacteria 1668
306 Ga0207698_10589550 3300026142 Bacteria 1095
307 Ga0207698_10636098 3300026142 Bacteria 1055
308 Ga0207698_10859223 3300026142 Bacteria 913
309 Ga0207698_11066725 3300026142 Unclassified 820
310 Ga0207428_10549193 3300027907 Bacteria 836
311 Ga0207428_10818547 3300027907 Bacteria 661
312 Ga0268265_11120436 3300028380 Bacteria 782
313 Ga0265338_10074044 3300028800 Bacteria 2899
314 Ga0307408_100345906 3300031548 Bacteria 1260
315 Ga0307408_100856804 3300031548 Bacteria 829
316 Ga0307408_100994476 3300031548 Bacteria 773
317 Ga0307405_10030476 3300031731 Bacteria 3164
318 Ga0307405_10881403 3300031731 Bacteria 756
319 Ga0307413_10187275 3300031824 Bacteria 1482
320 Ga0307410_10474826 3300031852 Bacteria 1025
321 Ga0307410_10490022 3300031852 Bacteria 1010
322 Ga0307410_11384391 3300031852 Bacteria 617
323 Ga0326468_10004933 3300031889 Bacteria 1182
324 Ga0307406_10201277 3300031901 Bacteria 1466
325 Ga0307406_11507981 3300031901 Bacteria 592
326 Ga0307407_10157396 3300031903 Bacteria 1483
327 Ga0307412_10320413 3300031911 Bacteria 1233
328 Ga0307412_10689299 3300031911 Bacteria 876
329 Ga0307409_100025284 3300031995 Bacteria 4161
330 Ga0307409_100273742 3300031995 Bacteria 1556
331 Ga0307409_100549990 3300031995 Bacteria 1133
332 Ga0307409_100568157 3300031995 Bacteria 1116
333 Ga0307409_100758223 3300031995 Bacteria 975
334 Ga0307409_101292936 3300031995 Bacteria 754
335 Ga0307409_101509063 3300031995 Bacteria 699
336 Ga0307416_100085961 3300032002 Bacteria 2679
337 Ga0307416_100172523 3300032002 Bacteria 2015
338 Ga0307416_100642553 3300032002 Bacteria 1145
339 Ga0307416_100731750 3300032002 Bacteria 1081
340 Ga0307416_103725721 3300032002 Bacteria 510
341 Ga0307414_10637093 3300032004 Bacteria 960
342 Ga0307414_10788800 3300032004 Bacteria 866
343 Ga0307411_10024381 3300032005 Bacteria 3605
344 Ga0307411_10518041 3300032005 Bacteria 1012
345 Ga0307411_12048751 3300032005 Bacteria 535
346 Ga0307415_100010639 3300032126 Bacteria 5219
347 Ga0307415_100027856 3300032126 Bacteria 3586
348 Ga0307415_100530126 3300032126 Bacteria 1035
349 Ga0307415_102062046 3300032126 Bacteria 556
350 Ga0373941_0502722 3300035115 Bacteria 516
351 Ga0373953_0072191 3300035117 Bacteria 1425
352 Ga0373943_0445205 3300035170 Unclassified 752
353 Ga0373955_0027472 3300035172 Bacteria 2943
354 Ga0373924_0017046 3300035410 Bacteria 2782
355 Ga0373933_0026577 3300035724 Bacteria 3325
356 Ga0373947_0032518 3300035725 Bacteria 3075
357 Ga0373937_0138829 3300036401 Bacteria 2273
358 Ga0373925_1747136 3300037068 Bacteria 508
359 Ga0395900_0254235 3300037418 Bacteria 1757
360 Ga0395900_0263531 3300037418 Bacteria 1720
361 Ga0395898_0237749 3300037466 Bacteria 1737
362 Ga0436364_0316558 3300037853 Bacteria 683
363 Ga0436364_0419300 3300037853 Unclassified 533
364 Ga0436364_0953233 3300037853 Bacteria 2786
365 Ga0436364_1211610 3300037853 Bacteria 6876
366 Ga0395901_0338210 3300038443 Bacteria 1555
367 Ga0395901_1282157 3300038443 Bacteria 695
368 Ga0436365_0402599 3300039437 Bacteria 4130
369 Ga0436365_0446222 3300039437 Bacteria 690
370 Ga0436365_0785088 3300039437 Bacteria 2288
371 Ga0436365_1499059 3300039437 Bacteria 5892
372 Ga0436363_0260166 3300039450 Bacteria 3255
373 Ga0436363_0262026 3300039450 Bacteria 907
374 Ga0436363_0390993 3300039450 Unclassified 629
375 Ga0436363_0808016 3300039450 Unclassified 715
376 Ga0436363_1162396 3300039450 Unclassified 621
377 Ga0436363_1413016 3300039450 Bacteria 603
378 Ga0451802_1039879 3300041460 Bacteria 537
379 Ga0451807_2036011 3300041486 Bacteria 509
380 Ga0451853_0803757 3300041512 Bacteria 1398
381 Ga0451853_3624238 3300041512 Bacteria 971
382 Ga0439463_041862 3300042016 Bacteria 1165
383 Ga0439459_0117061 3300042438 Bacteria 668
384 Ga0466969_0556136 3300044656 Bacteria 525
385 Ga0466969_0586359 3300044656 Unclassified 511
386 Ga0466965_0460710 3300044683 Unclassified 709
387 Ga0466966_0080562 3300044684 Bacteria 2028
388 Ga0466966_0148259 3300044684 Bacteria 1432
389 Ga0466966_0410088 3300044684 Bacteria 814
390 Ga0466961_0115783 3300044693 Bacteria 1685
391 Ga0466961_0207911 3300044693 Bacteria 1209
392 Ga0466961_0615954 3300044693 Bacteria 652
393 Ga0466963_0115480 3300044694 Bacteria 1845
394 Ga0466963_0159345 3300044694 Bacteria 1570
395 Ga0466963_0299681 3300044694 Bacteria 1130
396 Ga0466963_0773579 3300044694 Unclassified 677
397 Ga0466963_0918491 3300044694 Unclassified 617
398 Ga0466963_1157750 3300044694 Bacteria 544
399 Ga0466964_0119112 3300044706 Unclassified 1188
400 Ga0466964_0208024 3300044706 Bacteria 943
401 Ga0466971_0020238 3300044719 Bacteria 2959
402 Ga0466968_0457176 3300044735 Bacteria 632
403 Ga0466970_0228912 3300044765 Bacteria 1039
404 Ga0466957_0031763 3300044842 Bacteria 3157
405 Ga0466957_0159038 3300044842 Bacteria 1466
406 Ga0466957_0160021 3300044842 Bacteria 1462
407 Ga0466957_0678184 3300044842 Bacteria 726
408 Ga0466957_1447750 3300044842 Unclassified 501
409 Ga0466960_0057109 3300044901 Bacteria 1902
410 Ga0466959_0147551 3300045049 Unclassified 1659
411 Ga0466959_0315880 3300045049 Bacteria 1068
412 Ga0466959_0333752 3300045049 Bacteria 1035
413 Ga0466959_0354863 3300045049 Unclassified 999
414 Ga0466959_0404072 3300045049 Bacteria 928
415 Ga0466959_0457545 3300045049 Bacteria 865
416 Ga0466958_0018647 3300045836 Bacteria 4031
417 Ga0466958_0067845 3300045836 Bacteria 2179
418 Ga0466958_0070340 3300045836 Bacteria 2141
419 Ga0466958_0114481 3300045836 Bacteria 1685
420 Ga0466958_0137505 3300045836 Bacteria 1537
421 Ga0466958_0192877 3300045836 Bacteria 1295
422 Ga0466967_0012420 3300045976 Bacteria 6513
423 Ga0466967_0051023 3300045976 Bacteria 3624
424 Ga0466967_0160808 3300045976 Bacteria 2107
425 Ga0466967_0273113 3300045976 Bacteria 1620
426 Ga0466967_0641140 3300045976 Bacteria 1050
427 Ga0466967_0704130 3300045976 Bacteria 1000
428 Ga0466967_1132550 3300045976 Bacteria 780
429 Ga0466967_1835648 3300045976 Bacteria 603
430 Ga0495603_0088330 3300046455 Bacteria 1814
431 Ga0495603_0681074 3300046455 Bacteria 588
432 Ga0495590_0096992 3300046457 Bacteria 1046
433 Ga0495629_0079226 3300046459 Bacteria 2294
434 Ga0495641_0384293 3300046461 Bacteria 636
435 Ga0495651_0007698 3300046462 Bacteria 8238
436 Ga0495653_0056714 3300046463 Bacteria 2984
437 Ga0495653_0309320 3300046463 Bacteria 1028
438 Ga0495580_0587359 3300046472 Unclassified 737
439 Ga0495582_0135062 3300046473 Bacteria 1395
440 Ga0495582_0265373 3300046473 Bacteria 985
441 Ga0495582_0704431 3300046473 Bacteria 584
442 Ga0495605_0140886 3300046474 Bacteria 1082
443 Ga0495639_0133911 3300046475 Bacteria 1188
444 Ga0495639_0354756 3300046475 Bacteria 737
445 Ga0495584_0039572 3300046491 Bacteria 2382
446 Ga0495584_0257300 3300046491 Bacteria 887
447 Ga0495594_0000030 3300046499 Bacteria 66443
448 Ga0495594_0505741 3300046499 Unclassified 686
449 Ga0495596_0112511 3300046500 Bacteria 1057
450 Ga0495608_0003131 3300046511 Bacteria 11815
451 Ga0495608_0120717 3300046511 Bacteria 1681
452 Ga0495616_0186118 3300046513 Bacteria 920
453 Ga0495618_0049808 3300046514 Bacteria 2645
454 Ga0495628_0003835 3300046516 Bacteria 13403
455 Ga0495631_0103057 3300046518 Bacteria 1228
456 Ga0495644_0061859 3300046523 Bacteria 1407
457 Ga0495652_0306018 3300046529 Bacteria 1153
458 Ga0495652_0740217 3300046529 Bacteria 659
459 Ga0495640_0019315 3300046533 Bacteria 5033
460 Ga0495640_0080571 3300046533 Bacteria 2165
461 Ga0495621_0269167 3300046539 Bacteria 700
462 Ga0495645_0228423 3300046543 Bacteria 1248
463 Ga0495633_0114702 3300046558 Bacteria 1249
464 Ga0495667_0025766 3300046559 Bacteria 3961
465 Ga0495634_0028724 3300046642 Bacteria 3858
466 Ga0495611_0194712 3300046648 Bacteria 946
467 Ga0495635_0043941 3300046663 Bacteria 3082
468 Ga0495588_0378923 3300046674 Bacteria 743
469 Ga0495657_0013817 3300046675 Bacteria 5943
470 Ga0495599_0333401 3300046678 Bacteria 911
471 Ga0495623_0063317 3300046679 Bacteria 2316
472 Ga0495646_0129835 3300046680 Bacteria 1419
473 Ga0495646_0387292 3300046680 Unclassified 728
474 Ga0495647_0372610 3300046681 Bacteria 653
475 Ga0495658_0349090 3300046683 Bacteria 940
476 Ga0495658_0740748 3300046683 Unclassified 630
477 Ga0495613_0096707 3300046689 Bacteria 2135
478 Ga0495613_0172053 3300046689 Bacteria 1537
479 Ga0495670_0501196 3300046691 Bacteria 659
480 Ga0495671_0471252 3300046692 Bacteria 600
481 Ga0495589_0115375 3300046794 Bacteria 1295
482 Ga0495589_0429696 3300046794 Bacteria 605
483 Ga0495600_0009805 3300046809 Bacteria 5924
484 Ga0495581_0493293 3300047315 Bacteria 712
485 Ga0495604_0000180 3300047317 Bacteria 56391
486 Ga0495604_0098532 3300047317 Bacteria 2153
487 Ga0495674_0037278 3300047319 Bacteria 4368
488 Ga0495676_0096698 3300047321 Bacteria 2195
489 Ga0495676_0214024 3300047321 Bacteria 1332
490 Ga0495680_0006571 3300047322 Bacteria 10789
491 Ga0495675_0173908 3300047444 Bacteria 1321
492 Ga0495684_0055809 3300047471 Bacteria 3012
493 Ga0495686_0446591 3300047472 Bacteria 688
494 Ga0495686_0537972 3300047472 Bacteria 611
495 Ga0495593_0042794 3300047673 Bacteria 2430
496 Ga0495593_0218255 3300047673 Bacteria 957
497 Ga0495602_0106137 3300048088 Bacteria 2293
498 Ga0495602_0554298 3300048088 Bacteria 796
499 Ga0495614_0285719 3300048089 Bacteria 760
500 Ga0495614_0307314 3300048089 Bacteria 734
501 Ga0496100_0545720 3300048903 Bacteria 896
502 Ga0496100_0903671 3300048903 Bacteria 693
503 Ga0496100_1359624 3300048903 Bacteria 561
504 Ga0496101_0005130 3300048904 Bacteria 8328
505 Ga0496101_0070696 3300048904 Bacteria 2557
506 Ga0496102_0060839 3300048905 Bacteria 3455
507 Ga0496102_0432701 3300048905 Unclassified 1235
508 Ga0496102_0472299 3300048905 Bacteria 1175
509 Ga0496102_1824332 3300048905 Bacteria 525
510 Ga0496103_0000062 3300048906 Bacteria 129593
511 Ga0496103_0282397 3300048906 Bacteria 1068
512 Ga0496104_0000015 3300048907 Bacteria 374530
513 Ga0496104_0025689 3300048907 Bacteria 5432
514 Ga0496104_0495696 3300048907 Bacteria 1133
515 Ga0496104_0885476 3300048907 Unclassified 798
516 Ga0496105_0000004 3300048908 Bacteria 475798
517 Ga0496105_0430073 3300048908 Unclassified 1044
518 Ga0496105_0441782 3300048908 Bacteria 1028
519 Ga0496105_0501211 3300048908 Unclassified 953
520 Ga0496105_0826926 3300048908 Bacteria 702
521 Ga0496105_0927168 3300048908 Bacteria 655
522 Ga0496106_0012759 3300048909 Bacteria 6204
523 Ga0496106_0027544 3300048909 Bacteria 4233
524 Ga0496106_0038469 3300048909 Bacteria 3580
525 Ga0496106_0314242 3300048909 Bacteria 1257
526 Ga0496106_0631183 3300048909 Bacteria 857
527 Ga0496107_0006595 3300048910 Bacteria 7990
528 Ga0496107_0064943 3300048910 Bacteria 2646
529 Ga0496107_0829915 3300048910 Bacteria 676
530 Ga0496108_0041844 3300048911 Bacteria 3825
531 Ga0496108_0079387 3300048911 Bacteria 2778
532 Ga0496108_0250746 3300048911 Bacteria 1540
533 Ga0496109_0058716 3300048912 Bacteria 3514
534 Ga0496109_1289784 3300048912 Unclassified 666
535 Ga0496110_0064366 3300048913 Bacteria 3240
536 Ga0496110_0077196 3300048913 Bacteria 2963
537 Ga0496110_0094975 3300048913 Bacteria 2670
538 Ga0496110_0165186 3300048913 Bacteria 2007
539 Ga0496111_0005221 3300048914 Bacteria 8282
540 Ga0496111_0015546 3300048914 Bacteria 5227
541 Ga0496111_0035276 3300048914 Bacteria 3574
542 Ga0496112_0155314 3300048915 Bacteria 2255
543 Ga0496112_0355863 3300048915 Bacteria 1406
544 Ga0496112_0481800 3300048915 Bacteria 1177
545 Ga0496113_0029166 3300048916 Bacteria 3980
546 Ga0496113_0092656 3300048916 Bacteria 2331
547 Ga0496114_0179393 3300048917 Bacteria 1849
548 Ga0496114_0270470 3300048917 Bacteria 1497
549 Ga0496115_0149188 3300048918 Bacteria 1930
550 Ga0496115_0174917 3300048918 Bacteria 1775
551 Ga0496119_0257125 3300048922 Bacteria 878
552 Ga0496120_0107416 3300048923 Bacteria 1463
553 Ga0496121_0507121 3300048924 Bacteria 764
554 Ga0501291_147179 3300049514 Bacteria 530
555 Ga0501031_0012132 3300049568 Bacteria 5618
556 Ga0501032_0011109 3300049569 Bacteria 6471
557 Ga0501033_0010308 3300049570 Bacteria 7173
558 Ga0501034_0178238 3300049571 Bacteria 2090
559 Ga0501034_1444840 3300049571 Bacteria 562
560 Ga0501036_0163008 3300049572 Bacteria 1879
561 Ga0501036_1399085 3300049572 Bacteria 567
562 Ga0501037_0024274 3300049573 Bacteria 4484
563 Ga0501037_0741991 3300049573 Unclassified 651
564 Ga0501038_0002656 3300049574 Bacteria 16704
565 Ga0501039_0046034 3300049575 Bacteria 3370
566 Ga0501039_0058279 3300049575 Bacteria 2991
567 Ga0501040_0245845 3300049576 Bacteria 1276
568 Ga0501042_0125844 3300049578 Bacteria 1845
569 Ga0501042_1177489 3300049578 Unclassified 559
570 Ga0501043_0010586 3300049579 Bacteria 7221
571 Ga0501046_0101824 3300049580 Bacteria 2202
572 Ga0501047_0130216 3300049581 Bacteria 2396
573 Ga0501048_0032493 3300049582 Bacteria 3770
574 Ga0501048_0964017 3300049582 Unclassified 613
575 Ga0501067_0006428 3300049583 Bacteria 6510
576 Ga0501067_0123726 3300049583 Bacteria 1440
577 Ga0501067_0161971 3300049583 Bacteria 1246
578 Ga0501068_0100487 3300049584 Bacteria 1792
579 Ga0501069_0026324 3300049585 Bacteria 3184
580 Ga0501069_0569768 3300049585 Bacteria 678
581 Ga0501070_0059259 3300049586 Bacteria 3174
582 Ga0501070_0074272 3300049586 Bacteria 2814
583 Ga0501071_0073482 3300049587 Bacteria 2494
584 Ga0501071_0114944 3300049587 Bacteria 1991
585 Ga0501071_0695398 3300049587 Bacteria 783
586 Ga0501072_0081793 3300049588 Bacteria 2560
587 Ga0501072_0188433 3300049588 Bacteria 1645
588 Ga0501073_0010446 3300049589 Bacteria 6807
589 Ga0501074_0018326 3300049590 Bacteria 5085
590 Ga0501074_1183505 3300049590 Unclassified 536
591 Ga0501075_0225759 3300049591 Bacteria 1428
592 Ga0501076_0097731 3300049592 Bacteria 2365
593 Ga0501077_0197782 3300049593 Unclassified 1277
594 Ga0501079_0055286 3300049741 Bacteria 3063
595 Ga0501079_0452964 3300049741 Bacteria 1008
596 Ga0501079_0873176 3300049741 Bacteria 708
597 Ga0501080_0558118 3300049742 Bacteria 1019
598 Ga0501080_0664924 3300049742 Bacteria 921
599 Ga0501081_0651868 3300049743 Unclassified 789
600 Ga0501081_1371886 3300049743 Bacteria 536
601 Ga0501083_0018408 3300049744 Bacteria 4868
602 Ga0501035_0084148 3300049822 Bacteria 2806
603 Ga0501035_0100706 3300049822 Bacteria 2536
604 Ga0501044_0091391 3300049823 Bacteria 3070
605 Ga0501045_0075424 3300049824 Bacteria 2484
606 Ga0501045_0313028 3300049824 Bacteria 1168
607 Ga0501045_0881455 3300049824 Unclassified 658
608 nmdc:mga05p37_268784_c1 3300050507 Bacteria 2038
609 nmdc:mga09592_10828_c1 3300050508 Bacteria 6402
610 nmdc:mga0qj67_1299836_c1 3300050509 Bacteria 563
611 nmdc:mga0qj67_15821_c1 3300050509 Bacteria 5713
612 nmdc:mga06r32_1137728_c1 3300050510 Unclassified 729
613 nmdc:mga08y16_1345027_c1 3300050511 Unclassified 679
614 nmdc:mga0n895_1551628_c1 3300050512 Bacteria 627
615 nmdc:mga0rr50_521573_c1 3300050513 Bacteria 1011
616 Ga0495601_0209836 3300053077 Bacteria 1272
617 Ga0495612_0081882 3300053078 Bacteria 1357
618 Ga0495612_0263107 3300053078 Bacteria 769
619 Ga0495655_0222190 3300053083 Bacteria 626
620 Ga0495595_0058029 3300053084 Bacteria 1806
621 Ga0495619_0021359 3300053085 Bacteria 4131
622 Ga0501084_0203557 3300054114 Bacteria 1670
623 Ga0501084_1332987 3300054114 Unclassified 601
624 Ga0587066_041460 3300059490 Bacteria 869
625 Ga0587070_018036 3300059491 Bacteria 1152
626 Ga0587114_138706 3300059655 Unclassified 507
627 Ga0587071_119514 3300060344 Bacteria 628
628 Ga0501082_0031883 3300060353 Bacteria 4545
629 Ga0501082_0326660 3300060353 Bacteria 1337
630 Ga0466962_0062138 3300061719 Bacteria 1783
631 Ga0466962_0217519 3300061719 Bacteria 935
632 Ga0530510_0606042 3300061734 Unclassified 833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0316558 Ga0436364_0316558_249_587 105
2 3300039450 Ga0436363_0390993 Ga0436363_0390993_103_441 105
3 3300046491 Ga0495584_0039572 Ga0495584_0039572_12_332 106
4 3300009098 Ga0105245_10985577 Ga0105245_109855772 107
5 3300009553 Ga0105249_11320746 Ga0105249_113207462 107
6 3300010375 Ga0105239_11452629 Ga0105239_114526291 107
7 3300012495 Ga0157323_1041619 Ga0157323_10416192 107
8 3300013308 Ga0157375_11276997 Ga0157375_112769972 107
9 3300014497 Ga0182008_10202468 Ga0182008_102024683 107
10 3300035170 Ga0373943_0445205 Ga0373943_0445205_345_668 107
11 3300035725 Ga0373947_0032518 Ga0373947_0032518_1372_1695 107
12 3300037068 Ga0373925_1747136 Ga0373925_1747136_16_339 107
13 3300041512 Ga0451853_3624238 Ga0451853_3624238_103_426 107
14 3300046457 Ga0495590_0096992 Ga0495590_0096992_410_733 107
15 3300046473 Ga0495582_0135062 Ga0495582_0135062_969_1292 107
16 3300046474 Ga0495605_0140886 Ga0495605_0140886_45_368 107
17 3300046513 Ga0495616_0186118 Ga0495616_0186118_244_567 107
18 3300046518 Ga0495631_0103057 Ga0495631_0103057_771_1094 107
19 3300046539 Ga0495621_0269167 Ga0495621_0269167_301_624 107
20 3300046692 Ga0495671_0471252 Ga0495671_0471252_26_349 107
21 3300046794 Ga0495589_0429696 Ga0495589_0429696_213_536 107
22 3300047315 Ga0495581_0493293 Ga0495581_0493293_87_410 107
23 3300047321 Ga0495676_0096698 Ga0495676_0096698_666_989 107
24 3300047472 Ga0495686_0537972 Ga0495686_0537972_128_451 107
25 3300048089 Ga0495614_0307314 Ga0495614_0307314_252_575 107
26 3300048904 Ga0496101_0070696 Ga0496101_0070696_218_541 107
27 3300048910 Ga0496107_0829915 Ga0496107_0829915_294_617 107
28 3300025944 Ga0207661_10772017 Ga0207661_107720171 108
29 3300044901 Ga0466960_0057109 Ga0466960_0057109_685_1023 108
30 3300046499 Ga0495594_0000030 Ga0495594_0000030_15788_16123 108
31 3300005329 Ga0070683_100316614 Ga0070683_1003166143 109
32 3300005344 Ga0070661_100400758 Ga0070661_1004007582 109
33 3300005345 Ga0070692_10143735 Ga0070692_101437352 109
34 3300005347 Ga0070668_100293002 Ga0070668_1002930023 109
35 3300005366 Ga0070659_100148371 Ga0070659_1001483712 109
36 3300005366 Ga0070659_100843173 Ga0070659_1008431732 109
37 3300005367 Ga0070667_101060114 Ga0070667_1010601141 109
38 3300005457 Ga0070662_100049793 Ga0070662_1000497933 109
39 3300005459 Ga0068867_100180407 Ga0068867_1001804072 109
40 3300005543 Ga0070672_100858029 Ga0070672_1008580292 109
41 3300005564 Ga0070664_100431824 Ga0070664_1004318242 109
42 3300005577 Ga0068857_100211718 Ga0068857_1002117183 109
43 3300005616 Ga0068852_100534027 Ga0068852_1005340272 109
44 3300005981 Ga0081538_10007594 Ga0081538_100075949 109
45 3300006038 Ga0075365_10453002 Ga0075365_104530022 109
46 3300006058 Ga0075432_10197346 Ga0075432_101973462 109
47 3300009094 Ga0111539_11698353 Ga0111539_116983532 109
48 3300009094 Ga0111539_12329515 Ga0111539_123295152 109
49 3300009098 Ga0105245_10166028 Ga0105245_101660283 109
50 3300011119 Ga0105246_10040064 Ga0105246_100400643 109
51 3300013307 Ga0157372_10667058 Ga0157372_106670582 109
52 3300025918 Ga0207662_10896355 Ga0207662_108963552 109
53 3300025920 Ga0207649_10638901 Ga0207649_106389012 109
54 3300025927 Ga0207687_10189845 Ga0207687_101898453 109
55 3300025933 Ga0207706_10041686 Ga0207706_100416863 109
56 3300025938 Ga0207704_11163090 Ga0207704_111630902 109
57 3300025940 Ga0207691_10424153 Ga0207691_104241532 109
58 3300025945 Ga0207679_10861566 Ga0207679_108615662 109
59 3300026035 Ga0207703_11152725 Ga0207703_111527252 109
60 3300026067 Ga0207678_10136306 Ga0207678_101363063 109
61 3300026067 Ga0207678_10561378 Ga0207678_105613782 109
62 3300026089 Ga0207648_10085987 Ga0207648_100859874 109
63 3300026116 Ga0207674_10222943 Ga0207674_102229433 109
64 3300026121 Ga0207683_10130758 Ga0207683_101307582 109
65 3300026142 Ga0207698_10234543 Ga0207698_102345432 109
66 3300027907 Ga0207428_10549193 Ga0207428_105491932 109
67 3300028380 Ga0268265_11120436 Ga0268265_111204362 109
68 3300031548 Ga0307408_100345906 Ga0307408_1003459062 109
69 3300031731 Ga0307405_10030476 Ga0307405_100304763 109
70 3300031824 Ga0307413_10187275 Ga0307413_101872753 109
71 3300031903 Ga0307407_10157396 Ga0307407_101573963 109
72 3300031995 Ga0307409_100025284 Ga0307409_1000252843 109
73 3300031995 Ga0307409_100549990 Ga0307409_1005499903 109
74 3300031995 Ga0307409_100568157 Ga0307409_1005681572 109
75 3300032002 Ga0307416_100085961 Ga0307416_1000859613 109
76 3300032002 Ga0307416_100172523 Ga0307416_1001725233 109
77 3300032004 Ga0307414_10637093 Ga0307414_106370933 109
78 3300032005 Ga0307411_10024381 Ga0307411_100243814 109
79 3300032126 Ga0307415_100010639 Ga0307415_1000106395 109
80 3300044694 Ga0466963_0115480 Ga0466963_0115480_867_1208 109
81 3300044842 Ga0466957_0160021 Ga0466957_0160021_47_388 109
82 3300045836 Ga0466958_0114481 Ga0466958_0114481_861_1202 109
83 3300048903 Ga0496100_0903671 Ga0496100_0903671_273_602 109
84 3300048909 Ga0496106_0631183 Ga0496106_0631183_428_778 109
85 3300049571 Ga0501034_1444840 Ga0501034_1444840_12_341 109
86 3300049578 Ga0501042_1177489 Ga0501042_1177489_98_427 109
87 3300049583 Ga0501067_0123726 Ga0501067_0123726_214_543 109
88 3300005329 Ga0070683_100878503 Ga0070683_1008785031 110
89 3300005338 Ga0068868_100026801 Ga0068868_1000268012 110
90 3300005340 Ga0070689_101625001 Ga0070689_1016250012 110
91 3300005438 Ga0070701_10354983 Ga0070701_103549831 110
92 3300005441 Ga0070700_100186125 Ga0070700_1001861253 110
93 3300005455 Ga0070663_101085892 Ga0070663_1010858921 110
94 3300005457 Ga0070662_100213214 Ga0070662_1002132142 110
95 3300005544 Ga0070686_100274291 Ga0070686_1002742912 110
96 3300005545 Ga0070695_100426192 Ga0070695_1004261921 110
97 3300005549 Ga0070704_100293977 Ga0070704_1002939772 110
98 3300005578 Ga0068854_100437044 Ga0068854_1004370442 110
99 3300005615 Ga0070702_100005728 Ga0070702_1000057284 110
100 3300005616 Ga0068852_100212996 Ga0068852_1002129963 110
101 3300005617 Ga0068859_100559774 Ga0068859_1005597742 110
102 3300005718 Ga0068866_10066783 Ga0068866_100667832 110
103 3300005719 Ga0068861_100047929 Ga0068861_1000479294 110
104 3300005841 Ga0068863_100766542 Ga0068863_1007665422 110
105 3300005844 Ga0068862_100410166 Ga0068862_1004101662 110
106 3300005937 Ga0081455_10136625 Ga0081455_101366251 110
107 3300006844 Ga0075428_100143651 Ga0075428_1001436513 110
108 3300006846 Ga0075430_100023879 Ga0075430_1000238793 110
109 3300006847 Ga0075431_100035801 Ga0075431_1000358013 110
110 3300006880 Ga0075429_100009960 Ga0075429_1000099607 110
111 3300006881 Ga0068865_101315613 Ga0068865_1013156132 110
112 3300006931 Ga0097620_100559802 Ga0097620_1005598022 110
113 3300009101 Ga0105247_10490994 Ga0105247_104909942 110
114 3300009148 Ga0105243_10987886 Ga0105243_109878862 110
115 3300009176 Ga0105242_10003748 Ga0105242_100037485 110
116 3300009553 Ga0105249_10152728 Ga0105249_101527282 110
117 3300009553 Ga0105249_12718523 Ga0105249_127185231 110
118 3300009553 Ga0105249_12839180 Ga0105249_128391802 110
119 3300013308 Ga0157375_13345931 Ga0157375_133459312 110
120 3300014325 Ga0163163_10992998 Ga0163163_109929981 110
121 3300014326 Ga0157380_10430707 Ga0157380_104307072 110
122 3300014968 Ga0157379_10003495 Ga0157379_100034957 110
123 3300021377 Ga0213874_10278177 Ga0213874_102781772 110
124 3300025898 Ga0207692_10428981 Ga0207692_104289812 110
125 3300025899 Ga0207642_10024985 Ga0207642_100249852 110
126 3300025901 Ga0207688_10018945 Ga0207688_100189453 110
127 3300025915 Ga0207693_10000017 Ga0207693_10000017117 110
128 3300025932 Ga0207690_10253094 Ga0207690_102530943 110
129 3300025933 Ga0207706_10755822 Ga0207706_107558221 110
130 3300025942 Ga0207689_10459246 Ga0207689_104592462 110
131 3300025944 Ga0207661_10754000 Ga0207661_107540003 110
132 3300025961 Ga0207712_10584663 Ga0207712_105846633 110
133 3300025981 Ga0207640_10340732 Ga0207640_103407322 110
134 3300026023 Ga0207677_10696132 Ga0207677_106961322 110
135 3300026035 Ga0207703_10258439 Ga0207703_102584392 110
136 3300026067 Ga0207678_10113326 Ga0207678_101133261 110
137 3300026075 Ga0207708_10027228 Ga0207708_100272284 110
138 3300026095 Ga0207676_10318792 Ga0207676_103187922 110
139 3300026116 Ga0207674_10864087 Ga0207674_108640872 110
140 3300026118 Ga0207675_100022184 Ga0207675_1000221849 110
141 3300026142 Ga0207698_10589550 Ga0207698_105895503 110
142 3300035115 Ga0373941_0502722 Ga0373941_0502722_32_367 110
143 3300037418 Ga0395900_0254235 Ga0395900_0254235_46_381 110
144 3300037418 Ga0395900_0263531 Ga0395900_0263531_1116_1454 110
145 3300037466 Ga0395898_0237749 Ga0395898_0237749_169_507 110
146 3300038443 Ga0395901_0338210 Ga0395901_0338210_657_995 110
147 3300038443 Ga0395901_1282157 Ga0395901_1282157_131_466 110
148 3300044684 Ga0466966_0410088 Ga0466966_0410088_387_728 110
149 3300044693 Ga0466961_0207911 Ga0466961_0207911_745_1086 110
150 3300044694 Ga0466963_0773579 Ga0466963_0773579_54_395 110
151 3300044706 Ga0466964_0208024 Ga0466964_0208024_97_435 110
152 3300044735 Ga0466968_0457176 Ga0466968_0457176_97_435 110
153 3300044842 Ga0466957_0031763 Ga0466957_0031763_599_940 110
154 3300044842 Ga0466957_0678184 Ga0466957_0678184_42_383 110
155 3300045049 Ga0466959_0333752 Ga0466959_0333752_182_523 110
156 3300045836 Ga0466958_0067845 Ga0466958_0067845_824_1165 110
157 3300045836 Ga0466958_0070340 Ga0466958_0070340_726_1067 110
158 3300045836 Ga0466958_0137505 Ga0466958_0137505_900_1238 110
159 3300045836 Ga0466958_0192877 Ga0466958_0192877_93_434 110
160 3300045976 Ga0466967_0012420 Ga0466967_0012420_3646_3984 110
161 3300045976 Ga0466967_1132550 Ga0466967_1132550_98_436 110
162 3300045976 Ga0466967_1835648 Ga0466967_1835648_48_395 110
163 3300048903 Ga0496100_1359624 Ga0496100_1359624_13_348 110
164 3300048905 Ga0496102_1824332 Ga0496102_1824332_154_489 110
165 3300048906 Ga0496103_0000062 Ga0496103_0000062_104754_105152 110
166 3300048907 Ga0496104_0000015 Ga0496104_0000015_281564_281908 110
167 3300048908 Ga0496105_0000004 Ga0496105_0000004_193891_194235 110
168 3300048908 Ga0496105_0441782 Ga0496105_0441782_636_971 110
169 3300048909 Ga0496106_0038469 Ga0496106_0038469_99_434 110
170 3300048912 Ga0496109_1289784 Ga0496109_1289784_125_466 110
171 3300048913 Ga0496110_0077196 Ga0496110_0077196_1770_2105 110
172 3300048922 Ga0496119_0257125 Ga0496119_0257125_490_825 110
173 3300048923 Ga0496120_0107416 Ga0496120_0107416_642_986 110
174 3300048924 Ga0496121_0507121 Ga0496121_0507121_114_449 110
175 3300049514 Ga0501291_147179 Ga0501291_147179_13_345 110
176 3300049585 Ga0501069_0569768 Ga0501069_0569768_265_603 110
177 3300049586 Ga0501070_0059259 Ga0501070_0059259_227_565 110
178 3300059490 Ga0587066_041460 Ga0587066_041460_387_788 110
179 3300061719 Ga0466962_0217519 Ga0466962_0217519_365_706 110
180 3300009174 Ga0105241_11066946 Ga0105241_110669462 111
181 3300014326 Ga0157380_12417556 Ga0157380_124175562 111
182 3300005334 Ga0068869_100266591 Ga0068869_1002665912 112
183 3300005338 Ga0068868_100380787 Ga0068868_1003807872 112
184 3300005338 Ga0068868_100839825 Ga0068868_1008398251 112
185 3300005344 Ga0070661_100806128 Ga0070661_1008061282 112
186 3300005347 Ga0070668_100803647 Ga0070668_1008036472 112
187 3300005366 Ga0070659_100499116 Ga0070659_1004991162 112
188 3300005455 Ga0070663_102074929 Ga0070663_1020749291 112
189 3300005544 Ga0070686_101591316 Ga0070686_1015913161 112
190 3300005547 Ga0070693_101300283 Ga0070693_1013002832 112
191 3300005578 Ga0068854_100409567 Ga0068854_1004095672 112
192 3300005614 Ga0068856_100104790 Ga0068856_1001047902 112
193 3300005614 Ga0068856_101870159 Ga0068856_1018701591 112
194 3300005615 Ga0070702_101862884 Ga0070702_1018628841 112
195 3300005617 Ga0068859_100652156 Ga0068859_1006521562 112
196 3300005841 Ga0068863_100862516 Ga0068863_1008625162 112
197 3300005841 Ga0068863_101021383 Ga0068863_1010213832 112
198 3300005937 Ga0081455_10002456 Ga0081455_1000245621 112
199 3300005983 Ga0081540_1059534 Ga0081540_10595342 112
200 3300006871 Ga0075434_102019241 Ga0075434_1020192412 112
201 3300006931 Ga0097620_100652153 Ga0097620_1006521532 112
202 3300009098 Ga0105245_11162312 Ga0105245_111623122 112
203 3300009177 Ga0105248_11488131 Ga0105248_114881312 112
204 3300009545 Ga0105237_12111398 Ga0105237_121113982 112
205 3300009551 Ga0105238_10813446 Ga0105238_108134462 112
206 3300012487 Ga0157321_1038485 Ga0157321_10384852 112
207 3300013102 Ga0157371_10878615 Ga0157371_108786152 112
208 3300013105 Ga0157369_11610525 Ga0157369_116105252 112
209 3300013307 Ga0157372_10410900 Ga0157372_104109003 112
210 3300014745 Ga0157377_10631643 Ga0157377_106316432 112
211 3300014969 Ga0157376_10850266 Ga0157376_108502661 112
212 3300025898 Ga0207692_10895745 Ga0207692_108957452 112
213 3300025915 Ga0207693_10597626 Ga0207693_105976262 112
214 3300025920 Ga0207649_11304552 Ga0207649_113045522 112
215 3300025927 Ga0207687_10872944 Ga0207687_108729442 112
216 3300025932 Ga0207690_10634207 Ga0207690_106342072 112
217 3300025935 Ga0207709_11077373 Ga0207709_110773731 112
218 3300025945 Ga0207679_11882860 Ga0207679_118828602 112
219 3300025981 Ga0207640_10781346 Ga0207640_107813462 112
220 3300026023 Ga0207677_10823894 Ga0207677_108238942 112
221 3300026078 Ga0207702_10051574 Ga0207702_100515743 112
222 3300026078 Ga0207702_10258612 Ga0207702_102586122 112
223 3300026088 Ga0207641_10369115 Ga0207641_103691152 112
224 3300026142 Ga0207698_10636098 Ga0207698_106360983 112
225 3300026142 Ga0207698_10859223 Ga0207698_108592232 112
226 3300028800 Ga0265338_10074044 Ga0265338_100740442 112
227 3300041460 Ga0451802_1039879 Ga0451802_1039879_87_428 112
228 3300041486 Ga0451807_2036011 Ga0451807_2036011_25_363 112
229 3300042016 Ga0439463_041862 Ga0439463_041862_449_787 112
230 3300042438 Ga0439459_0117061 Ga0439459_0117061_313_651 112
231 3300045976 Ga0466967_0641140 Ga0466967_0641140_532_870 112
232 3300046475 Ga0495639_0354756 Ga0495639_0354756_162_500 112
233 3300046491 Ga0495584_0257300 Ga0495584_0257300_418_756 112
234 3300046500 Ga0495596_0112511 Ga0495596_0112511_414_752 112
235 3300046523 Ga0495644_0061859 Ga0495644_0061859_441_779 112
236 3300046558 Ga0495633_0114702 Ga0495633_0114702_506_844 112
237 3300046648 Ga0495611_0194712 Ga0495611_0194712_364_702 112
238 3300046681 Ga0495647_0372610 Ga0495647_0372610_183_521 112
239 3300046691 Ga0495670_0501196 Ga0495670_0501196_14_352 112
240 3300046794 Ga0495589_0115375 Ga0495589_0115375_544_882 112
241 3300047472 Ga0495686_0446591 Ga0495686_0446591_222_560 112
242 3300048903 Ga0496100_0545720 Ga0496100_0545720_238_576 112
243 3300048905 Ga0496102_0060839 Ga0496102_0060839_2688_3026 112
244 3300048905 Ga0496102_0472299 Ga0496102_0472299_615_953 112
245 3300048906 Ga0496103_0282397 Ga0496103_0282397_428_766 112
246 3300048907 Ga0496104_0025689 Ga0496104_0025689_1547_1885 112
247 3300048907 Ga0496104_0495696 Ga0496104_0495696_781_1119 112
248 3300048908 Ga0496105_0826926 Ga0496105_0826926_130_468 112
249 3300048909 Ga0496106_0027544 Ga0496106_0027544_2588_2926 112
250 3300048909 Ga0496106_0314242 Ga0496106_0314242_524_862 112
251 3300048910 Ga0496107_0064943 Ga0496107_0064943_1842_2180 112
252 3300048911 Ga0496108_0041844 Ga0496108_0041844_1386_1724 112
253 3300048911 Ga0496108_0079387 Ga0496108_0079387_1505_1843 112
254 3300048912 Ga0496109_0058716 Ga0496109_0058716_2744_3082 112
255 3300048913 Ga0496110_0064366 Ga0496110_0064366_433_771 112
256 3300048913 Ga0496110_0165186 Ga0496110_0165186_1069_1407 112
257 3300048914 Ga0496111_0005221 Ga0496111_0005221_7381_7719 112
258 3300048914 Ga0496111_0015546 Ga0496111_0015546_3789_4127 112
259 3300048914 Ga0496111_0035276 Ga0496111_0035276_409_747 112
260 3300048915 Ga0496112_0155314 Ga0496112_0155314_672_1010 112
261 3300048915 Ga0496112_0355863 Ga0496112_0355863_615_953 112
262 3300048916 Ga0496113_0029166 Ga0496113_0029166_902_1240 112
263 3300048916 Ga0496113_0092656 Ga0496113_0092656_875_1213 112
264 3300048917 Ga0496114_0179393 Ga0496114_0179393_1065_1403 112
265 3300048918 Ga0496115_0174917 Ga0496115_0174917_1278_1616 112
266 3300050512 nmdc:mga0n895_1551628_c1 nmdc:mga0n895_1551628_c1_75_413 112
267 3300053083 Ga0495655_0222190 Ga0495655_0222190_40_378 112
268 3300005435 Ga0070714_100172337 Ga0070714_1001723372 113
269 3300005435 Ga0070714_100856214 Ga0070714_1008562142 113
270 3300005436 Ga0070713_100139778 Ga0070713_1001397783 113
271 3300005437 Ga0070710_10061767 Ga0070710_100617671 113
272 3300005439 Ga0070711_100028025 Ga0070711_1000280252 113
273 3300005440 Ga0070705_100003636 Ga0070705_1000036365 113
274 3300006163 Ga0070715_10248258 Ga0070715_102482582 113
275 3300006173 Ga0070716_100048773 Ga0070716_1000487732 113
276 3300006175 Ga0070712_100017563 Ga0070712_1000175634 113
277 3300007076 Ga0075435_100576793 Ga0075435_1005767932 113
278 3300009093 Ga0105240_10122371 Ga0105240_101223713 113
279 3300009094 Ga0111539_10605093 Ga0111539_106050933 113
280 3300009147 Ga0114129_10265746 Ga0114129_102657462 113
281 3300025906 Ga0207699_10199976 Ga0207699_101999762 113
282 3300025913 Ga0207695_10035094 Ga0207695_100350941 113
283 3300025915 Ga0207693_10008897 Ga0207693_100088979 113
284 3300025916 Ga0207663_10196188 Ga0207663_101961882 113
285 3300025929 Ga0207664_10089694 Ga0207664_100896942 113
286 3300025929 Ga0207664_10103740 Ga0207664_101037402 113
287 3300025939 Ga0207665_10039880 Ga0207665_100398802 113
288 3300031889 Ga0326468_10004933 Ga0326468_100049333 113
289 3300031901 Ga0307406_11507981 Ga0307406_115079812 113
290 3300031995 Ga0307409_101292936 Ga0307409_1012929362 113
291 3300032005 Ga0307411_12048751 Ga0307411_120487512 113
292 3300032126 Ga0307415_102062046 Ga0307415_1020620461 113
293 3300035117 Ga0373953_0072191 Ga0373953_0072191_501_863 113
294 3300035172 Ga0373955_0027472 Ga0373955_0027472_1002_1364 113
295 3300035410 Ga0373924_0017046 Ga0373924_0017046_160_522 113
296 3300035724 Ga0373933_0026577 Ga0373933_0026577_1300_1662 113
297 3300036401 Ga0373937_0138829 Ga0373937_0138829_369_731 113
298 3300037853 Ga0436364_0953233 Ga0436364_0953233_655_1005 113
299 3300041512 Ga0451853_0803757 Ga0451853_0803757_670_1032 113
300 3300045976 Ga0466967_0273113 Ga0466967_0273113_629_976 113
301 3300046455 Ga0495603_0088330 Ga0495603_0088330_1264_1626 113
302 3300046459 Ga0495629_0079226 Ga0495629_0079226_1565_1927 113
303 3300046462 Ga0495651_0007698 Ga0495651_0007698_4134_4496 113
304 3300046463 Ga0495653_0056714 Ga0495653_0056714_1244_1606 113
305 3300046463 Ga0495653_0309320 Ga0495653_0309320_296_658 113
306 3300046472 Ga0495580_0587359 Ga0495580_0587359_46_408 113
307 3300046473 Ga0495582_0265373 Ga0495582_0265373_29_391 113
308 3300046475 Ga0495639_0133911 Ga0495639_0133911_38_400 113
309 3300046499 Ga0495594_0505741 Ga0495594_0505741_271_633 113
310 3300046511 Ga0495608_0003131 Ga0495608_0003131_6541_6903 113
311 3300046511 Ga0495608_0120717 Ga0495608_0120717_495_857 113
312 3300046514 Ga0495618_0049808 Ga0495618_0049808_924_1286 113
313 3300046516 Ga0495628_0003835 Ga0495628_0003835_3593_3955 113
314 3300046529 Ga0495652_0306018 Ga0495652_0306018_396_758 113
315 3300046533 Ga0495640_0019315 Ga0495640_0019315_4171_4533 113
316 3300046533 Ga0495640_0080571 Ga0495640_0080571_493_855 113
317 3300046543 Ga0495645_0228423 Ga0495645_0228423_786_1148 113
318 3300046559 Ga0495667_0025766 Ga0495667_0025766_1537_1899 113
319 3300046642 Ga0495634_0028724 Ga0495634_0028724_1171_1533 113
320 3300046663 Ga0495635_0043941 Ga0495635_0043941_1484_1846 113
321 3300046675 Ga0495657_0013817 Ga0495657_0013817_3745_4107 113
322 3300046678 Ga0495599_0333401 Ga0495599_0333401_308_670 113
323 3300046679 Ga0495623_0063317 Ga0495623_0063317_1454_1816 113
324 3300046680 Ga0495646_0129835 Ga0495646_0129835_911_1273 113
325 3300046680 Ga0495646_0387292 Ga0495646_0387292_38_400 113
326 3300046683 Ga0495658_0349090 Ga0495658_0349090_367_729 113
327 3300046683 Ga0495658_0740748 Ga0495658_0740748_64_426 113
328 3300046689 Ga0495613_0096707 Ga0495613_0096707_1512_1874 113
329 3300046689 Ga0495613_0172053 Ga0495613_0172053_441_803 113
330 3300046809 Ga0495600_0009805 Ga0495600_0009805_334_696 113
331 3300047317 Ga0495604_0098532 Ga0495604_0098532_435_797 113
332 3300047319 Ga0495674_0037278 Ga0495674_0037278_2456_2818 113
333 3300047321 Ga0495676_0214024 Ga0495676_0214024_502_864 113
334 3300047322 Ga0495680_0006571 Ga0495680_0006571_2027_2389 113
335 3300047444 Ga0495675_0173908 Ga0495675_0173908_135_497 113
336 3300047471 Ga0495684_0055809 Ga0495684_0055809_1166_1528 113
337 3300047673 Ga0495593_0042794 Ga0495593_0042794_1281_1643 113
338 3300047673 Ga0495593_0218255 Ga0495593_0218255_258_620 113
339 3300048088 Ga0495602_0106137 Ga0495602_0106137_681_1043 113
340 3300048088 Ga0495602_0554298 Ga0495602_0554298_335_697 113
341 3300048089 Ga0495614_0285719 Ga0495614_0285719_236_598 113
342 3300048908 Ga0496105_0430073 Ga0496105_0430073_609_971 113
343 3300048911 Ga0496108_0250746 Ga0496108_0250746_467_829 113
344 3300048913 Ga0496110_0094975 Ga0496110_0094975_1104_1466 113
345 3300048915 Ga0496112_0481800 Ga0496112_0481800_526_888 113
346 3300049573 Ga0501037_0741991 Ga0501037_0741991_68_409 113
347 3300049575 Ga0501039_0058279 Ga0501039_0058279_62_403 113
348 3300049582 Ga0501048_0964017 Ga0501048_0964017_36_377 113
349 3300049583 Ga0501067_0161971 Ga0501067_0161971_396_737 113
350 3300049587 Ga0501071_0114944 Ga0501071_0114944_639_980 113
351 3300049588 Ga0501072_0188433 Ga0501072_0188433_857_1198 113
352 3300049590 Ga0501074_1183505 Ga0501074_1183505_11_352 113
353 3300049591 Ga0501075_0225759 Ga0501075_0225759_1033_1374 113
354 3300049592 Ga0501076_0097731 Ga0501076_0097731_541_882 113
355 3300049593 Ga0501077_0197782 Ga0501077_0197782_671_1012 113
356 3300049741 Ga0501079_0452964 Ga0501079_0452964_15_356 113
357 3300049742 Ga0501080_0664924 Ga0501080_0664924_30_371 113
358 3300049743 Ga0501081_0651868 Ga0501081_0651868_259_600 113
359 3300049822 Ga0501035_0084148 Ga0501035_0084148_2438_2779 113
360 3300050509 nmdc:mga0qj67_1299836_c1 nmdc:mga0qj67_1299836_c1_155_502 113
361 3300050513 nmdc:mga0rr50_521573_c1 nmdc:mga0rr50_521573_c1_503_865 113
362 3300053077 Ga0495601_0209836 Ga0495601_0209836_212_574 113
363 3300053078 Ga0495612_0081882 Ga0495612_0081882_501_863 113
364 3300053078 Ga0495612_0263107 Ga0495612_0263107_80_442 113
365 3300053084 Ga0495595_0058029 Ga0495595_0058029_1386_1748 113
366 3300053085 Ga0495619_0021359 Ga0495619_0021359_2482_2844 113
367 3300054114 Ga0501084_1332987 Ga0501084_1332987_249_590 113
368 3300061734 Ga0530510_0606042 Ga0530510_0606042_100_441 113
369 3300005328 Ga0070676_10870389 Ga0070676_108703892 114
370 3300005334 Ga0068869_101152264 Ga0068869_1011522641 114
371 3300005336 Ga0070680_101986540 Ga0070680_1019865401 114
372 3300005338 Ga0068868_100563877 Ga0068868_1005638773 114
373 3300005339 Ga0070660_100112750 Ga0070660_1001127502 114
374 3300005353 Ga0070669_100063759 Ga0070669_1000637593 114
375 3300005356 Ga0070674_100450765 Ga0070674_1004507652 114
376 3300005364 Ga0070673_100669566 Ga0070673_1006695662 114
377 3300005366 Ga0070659_100001291 Ga0070659_10000129116 114
378 3300005366 Ga0070659_100984434 Ga0070659_1009844341 114
379 3300005434 Ga0070709_11403648 Ga0070709_114036481 114
380 3300005435 Ga0070714_100030323 Ga0070714_1000303234 114
381 3300005435 Ga0070714_100175770 Ga0070714_1001757703 114
382 3300005435 Ga0070714_102166056 Ga0070714_1021660561 114
383 3300005436 Ga0070713_100660759 Ga0070713_1006607592 114
384 3300005436 Ga0070713_101352783 Ga0070713_1013527832 114
385 3300005437 Ga0070710_10733617 Ga0070710_107336172 114
386 3300005445 Ga0070708_101405723 Ga0070708_1014057232 114
387 3300005459 Ga0068867_100322171 Ga0068867_1003221712 114
388 3300005535 Ga0070684_100811943 Ga0070684_1008119432 114
389 3300005536 Ga0070697_100985412 Ga0070697_1009854122 114
390 3300005547 Ga0070693_100909828 Ga0070693_1009098282 114
391 3300005549 Ga0070704_101684568 Ga0070704_1016845682 114
392 3300005614 Ga0068856_102467832 Ga0068856_1024678322 114
393 3300005616 Ga0068852_101587235 Ga0068852_1015872352 114
394 3300005718 Ga0068866_10376082 Ga0068866_103760822 114
395 3300005719 Ga0068861_102155239 Ga0068861_1021552392 114
396 3300005840 Ga0068870_10601573 Ga0068870_106015732 114
397 3300005842 Ga0068858_101155261 Ga0068858_1011552612 114
398 3300005937 Ga0081455_10488256 Ga0081455_104882561 114
399 3300005981 Ga0081538_10082828 Ga0081538_100828283 114
400 3300005985 Ga0081539_10008072 Ga0081539_100080723 114
401 3300006028 Ga0070717_10000019 Ga0070717_1000001957 114
402 3300006028 Ga0070717_10645308 Ga0070717_106453082 114
403 3300006028 Ga0070717_11436225 Ga0070717_114362251 114
404 3300006175 Ga0070712_100190652 Ga0070712_1001906522 114
405 3300006847 Ga0075431_100484749 Ga0075431_1004847492 114
406 3300006881 Ga0068865_100402804 Ga0068865_1004028042 114
407 3300009093 Ga0105240_12536605 Ga0105240_125366051 114
408 3300009098 Ga0105245_10116838 Ga0105245_101168383 114
409 3300009098 Ga0105245_13129100 Ga0105245_131291001 114
410 3300009148 Ga0105243_10083402 Ga0105243_100834022 114
411 3300009174 Ga0105241_11755453 Ga0105241_117554531 114
412 3300009176 Ga0105242_10935462 Ga0105242_109354621 114
413 3300013307 Ga0157372_13222670 Ga0157372_132226702 114
414 3300013308 Ga0157375_11530306 Ga0157375_115303063 114
415 3300014326 Ga0157380_10348765 Ga0157380_103487653 114
416 3300017792 Ga0163161_10713870 Ga0163161_107138703 114
417 3300020082 Ga0206353_11254423 Ga0206353_112544232 114
418 3300021377 Ga0213874_10018401 Ga0213874_100184013 114
419 3300021377 Ga0213874_10038510 Ga0213874_100385102 114
420 3300021377 Ga0213874_10467612 Ga0213874_104676121 114
421 3300021384 Ga0213876_10015018 Ga0213876_100150183 114
422 3300021384 Ga0213876_10017120 Ga0213876_100171202 114
423 3300021388 Ga0213875_10011653 Ga0213875_100116532 114
424 3300021388 Ga0213875_10024360 Ga0213875_100243603 114
425 3300025898 Ga0207692_10427142 Ga0207692_104271422 114
426 3300025901 Ga0207688_10853890 Ga0207688_108538902 114
427 3300025906 Ga0207699_10992390 Ga0207699_109923902 114
428 3300025907 Ga0207645_10034910 Ga0207645_100349102 114
429 3300025915 Ga0207693_10197597 Ga0207693_101975972 114
430 3300025919 Ga0207657_10173108 Ga0207657_101731083 114
431 3300025923 Ga0207681_10004254 Ga0207681_100042542 114
432 3300025927 Ga0207687_10773495 Ga0207687_107734952 114
433 3300025928 Ga0207700_10713213 Ga0207700_107132132 114
434 3300025928 Ga0207700_11015812 Ga0207700_110158122 114
435 3300025929 Ga0207664_10107821 Ga0207664_101078213 114
436 3300025932 Ga0207690_10000061 Ga0207690_1000006198 114
437 3300025934 Ga0207686_10428683 Ga0207686_104286832 114
438 3300025981 Ga0207640_10155430 Ga0207640_101554302 114
439 3300025981 Ga0207640_11971220 Ga0207640_119712201 114
440 3300026089 Ga0207648_10582169 Ga0207648_105821692 114
441 3300026118 Ga0207675_100653356 Ga0207675_1006533562 114
442 3300031548 Ga0307408_100856804 Ga0307408_1008568042 114
443 3300031731 Ga0307405_10881403 Ga0307405_108814032 114
444 3300031852 Ga0307410_10474826 Ga0307410_104748262 114
445 3300031852 Ga0307410_11384391 Ga0307410_113843912 114
446 3300031911 Ga0307412_10320413 Ga0307412_103204132 114
447 3300031995 Ga0307409_100758223 Ga0307409_1007582232 114
448 3300031995 Ga0307409_101509063 Ga0307409_1015090632 114
449 3300032002 Ga0307416_100642553 Ga0307416_1006425532 114
450 3300032002 Ga0307416_103725721 Ga0307416_1037257211 114
451 3300032004 Ga0307414_10788800 Ga0307414_107888002 114
452 3300032005 Ga0307411_10518041 Ga0307411_105180412 114
453 3300037853 Ga0436364_1211610 Ga0436364_1211610_2994_3359 114
454 3300039437 Ga0436365_0402599 Ga0436365_0402599_2757_3122 114
455 3300039437 Ga0436365_0446222 Ga0436365_0446222_113_463 114
456 3300039437 Ga0436365_0785088 Ga0436365_0785088_1333_1698 114
457 3300039437 Ga0436365_1499059 Ga0436365_1499059_1950_2300 114
458 3300039450 Ga0436363_0260166 Ga0436363_0260166_1096_1446 114
459 3300039450 Ga0436363_0262026 Ga0436363_0262026_119_469 114
460 3300039450 Ga0436363_0808016 Ga0436363_0808016_66_410 114
461 3300039450 Ga0436363_1162396 Ga0436363_1162396_173_523 114
462 3300039450 Ga0436363_1413016 Ga0436363_1413016_142_492 114
463 3300044656 Ga0466969_0556136 Ga0466969_0556136_140_484 114
464 3300044656 Ga0466969_0586359 Ga0466969_0586359_63_410 114
465 3300044683 Ga0466965_0460710 Ga0466965_0460710_305_652 114
466 3300044684 Ga0466966_0080562 Ga0466966_0080562_1022_1369 114
467 3300044684 Ga0466966_0148259 Ga0466966_0148259_472_840 114
468 3300044693 Ga0466961_0115783 Ga0466961_0115783_700_1044 114
469 3300044693 Ga0466961_0615954 Ga0466961_0615954_47_394 114
470 3300044694 Ga0466963_0159345 Ga0466963_0159345_559_903 114
471 3300044694 Ga0466963_0299681 Ga0466963_0299681_266_616 114
472 3300044694 Ga0466963_0918491 Ga0466963_0918491_61_408 114
473 3300044706 Ga0466964_0119112 Ga0466964_0119112_652_1002 114
474 3300044719 Ga0466971_0020238 Ga0466971_0020238_2563_2931 114
475 3300044765 Ga0466970_0228912 Ga0466970_0228912_424_792 114
476 3300044842 Ga0466957_0159038 Ga0466957_0159038_150_500 114
477 3300044842 Ga0466957_1447750 Ga0466957_1447750_70_417 114
478 3300045049 Ga0466959_0147551 Ga0466959_0147551_585_935 114
479 3300045049 Ga0466959_0315880 Ga0466959_0315880_614_958 114
480 3300045049 Ga0466959_0354863 Ga0466959_0354863_536_901 114
481 3300045049 Ga0466959_0404072 Ga0466959_0404072_446_793 114
482 3300045049 Ga0466959_0457545 Ga0466959_0457545_353_703 114
483 3300045836 Ga0466958_0018647 Ga0466958_0018647_407_754 114
484 3300045976 Ga0466967_0051023 Ga0466967_0051023_740_1090 114
485 3300045976 Ga0466967_0160808 Ga0466967_0160808_1291_1635 114
486 3300045976 Ga0466967_0704130 Ga0466967_0704130_192_536 114
487 3300046455 Ga0495603_0681074 Ga0495603_0681074_145_489 114
488 3300046529 Ga0495652_0740217 Ga0495652_0740217_137_502 114
489 3300047317 Ga0495604_0000180 Ga0495604_0000180_52408_52752 114
490 3300048907 Ga0496104_0885476 Ga0496104_0885476_276_641 114
491 3300048908 Ga0496105_0501211 Ga0496105_0501211_184_549 114
492 3300049572 Ga0501036_1399085 Ga0501036_1399085_130_474 114
493 3300049741 Ga0501079_0873176 Ga0501079_0873176_45_389 114
494 3300049824 Ga0501045_0313028 Ga0501045_0313028_420_764 114
495 3300049824 Ga0501045_0881455 Ga0501045_0881455_59_403 114
496 3300061719 Ga0466962_0062138 Ga0466962_0062138_658_1026 114
497 3300003659 JGI25404J52841_10015002 JGI25404J52841_100150022 115
498 3300005334 Ga0068869_100680320 Ga0068869_1006803202 115
499 3300005334 Ga0068869_101958055 Ga0068869_1019580552 115
500 3300005339 Ga0070660_101343221 Ga0070660_1013432212 115
501 3300005344 Ga0070661_100325646 Ga0070661_1003256463 115
502 3300005353 Ga0070669_100233670 Ga0070669_1002336701 115
503 3300005353 Ga0070669_100864457 Ga0070669_1008644572 115
504 3300005356 Ga0070674_101942422 Ga0070674_1019424221 115
505 3300005366 Ga0070659_100692533 Ga0070659_1006925332 115
506 3300005437 Ga0070710_10565250 Ga0070710_105652502 115
507 3300005438 Ga0070701_10300059 Ga0070701_103000592 115
508 3300005438 Ga0070701_10482080 Ga0070701_104820801 115
509 3300005439 Ga0070711_100801577 Ga0070711_1008015772 115
510 3300005444 Ga0070694_101116812 Ga0070694_1011168122 115
511 3300005456 Ga0070678_101198659 Ga0070678_1011986591 115
512 3300005457 Ga0070662_100482829 Ga0070662_1004828292 115
513 3300005535 Ga0070684_100166434 Ga0070684_1001664342 115
514 3300005548 Ga0070665_100149577 Ga0070665_1001495772 115
515 3300005564 Ga0070664_100033731 Ga0070664_1000337312 115
516 3300005564 Ga0070664_100434965 Ga0070664_1004349652 115
517 3300005564 Ga0070664_101400759 Ga0070664_1014007592 115
518 3300005577 Ga0068857_100134302 Ga0068857_1001343022 115
519 3300005614 Ga0068856_101113527 Ga0068856_1011135272 115
520 3300005614 Ga0068856_101534788 Ga0068856_1015347882 115
521 3300005615 Ga0070702_100785989 Ga0070702_1007859892 115
522 3300005616 Ga0068852_101489052 Ga0068852_1014890522 115
523 3300005618 Ga0068864_100456665 Ga0068864_1004566652 115
524 3300005718 Ga0068866_10292550 Ga0068866_102925502 115
525 3300005719 Ga0068861_100208453 Ga0068861_1002084533 115
526 3300005937 Ga0081455_10093906 Ga0081455_100939062 115
527 3300005983 Ga0081540_1002479 Ga0081540_100247914 115
528 3300006058 Ga0075432_10609814 Ga0075432_106098142 115
529 3300006881 Ga0068865_101899332 Ga0068865_1018993321 115
530 3300006881 Ga0068865_102128456 Ga0068865_1021284561 115
531 3300007076 Ga0075435_100924675 Ga0075435_1009246751 115
532 3300009098 Ga0105245_10019447 Ga0105245_100194474 115
533 3300009101 Ga0105247_10153187 Ga0105247_101531871 115
534 3300009148 Ga0105243_10126617 Ga0105243_101266173 115
535 3300009148 Ga0105243_12277700 Ga0105243_122777001 115
536 3300009176 Ga0105242_10414922 Ga0105242_104149222 115
537 3300010375 Ga0105239_11031001 Ga0105239_110310011 115
538 3300011119 Ga0105246_10118851 Ga0105246_101188513 115
539 3300013100 Ga0157373_11259909 Ga0157373_112599092 115
540 3300013297 Ga0157378_11993696 Ga0157378_119936962 115
541 3300013306 Ga0163162_11406603 Ga0163162_114066032 115
542 3300014325 Ga0163163_11799166 Ga0163163_117991661 115
543 3300014497 Ga0182008_10137868 Ga0182008_101378682 115
544 3300025901 Ga0207688_10270993 Ga0207688_102709932 115
545 3300025906 Ga0207699_11330602 Ga0207699_113306022 115
546 3300025916 Ga0207663_10295216 Ga0207663_102952162 115
547 3300025923 Ga0207681_10837647 Ga0207681_108376472 115
548 3300025934 Ga0207686_10375023 Ga0207686_103750232 115
549 3300025935 Ga0207709_10571420 Ga0207709_105714202 115
550 3300025935 Ga0207709_11032772 Ga0207709_110327722 115
551 3300025935 Ga0207709_11107119 Ga0207709_111071192 115
552 3300025937 Ga0207669_10673705 Ga0207669_106737052 115
553 3300025938 Ga0207704_11251900 Ga0207704_112519001 115
554 3300025939 Ga0207665_11364378 Ga0207665_113643782 115
555 3300025942 Ga0207689_10383692 Ga0207689_103836923 115
556 3300025942 Ga0207689_10593340 Ga0207689_105933403 115
557 3300025944 Ga0207661_10574834 Ga0207661_105748342 115
558 3300025945 Ga0207679_10079850 Ga0207679_100798502 115
559 3300025945 Ga0207679_11868187 Ga0207679_118681872 115
560 3300025972 Ga0207668_10559343 Ga0207668_105593432 115
561 3300025981 Ga0207640_10664354 Ga0207640_106643542 115
562 3300026067 Ga0207678_10571448 Ga0207678_105714482 115
563 3300026075 Ga0207708_10113581 Ga0207708_101135813 115
564 3300026078 Ga0207702_10973485 Ga0207702_109734851 115
565 3300026078 Ga0207702_11343288 Ga0207702_113432882 115
566 3300026095 Ga0207676_10397276 Ga0207676_103972763 115
567 3300026095 Ga0207676_11546448 Ga0207676_115464482 115
568 3300026116 Ga0207674_10153416 Ga0207674_101534162 115
569 3300026118 Ga0207675_101414560 Ga0207675_1014145602 115
570 3300026142 Ga0207698_11066725 Ga0207698_110667251 115
571 3300027907 Ga0207428_10818547 Ga0207428_108185472 115
572 3300031548 Ga0307408_100994476 Ga0307408_1009944762 115
573 3300031852 Ga0307410_10490022 Ga0307410_104900223 115
574 3300031901 Ga0307406_10201277 Ga0307406_102012772 115
575 3300031911 Ga0307412_10689299 Ga0307412_106892992 115
576 3300031995 Ga0307409_100273742 Ga0307409_1002737422 115
577 3300032002 Ga0307416_100731750 Ga0307416_1007317502 115
578 3300032126 Ga0307415_100027856 Ga0307415_1000278564 115
579 3300032126 Ga0307415_100530126 Ga0307415_1005301262 115
580 3300037853 Ga0436364_0419300 Ga0436364_0419300_76_426 115
581 3300044694 Ga0466963_1157750 Ga0466963_1157750_163_513 115
582 3300046461 Ga0495641_0384293 Ga0495641_0384293_148_495 115
583 3300046473 Ga0495582_0704431 Ga0495582_0704431_176_523 115
584 3300046674 Ga0495588_0378923 Ga0495588_0378923_114_473 115
585 3300048904 Ga0496101_0005130 Ga0496101_0005130_4964_5335 115
586 3300048905 Ga0496102_0432701 Ga0496102_0432701_43_414 115
587 3300048908 Ga0496105_0927168 Ga0496105_0927168_253_624 115
588 3300048909 Ga0496106_0012759 Ga0496106_0012759_2219_2590 115
589 3300048910 Ga0496107_0006595 Ga0496107_0006595_1344_1715 115
590 3300048917 Ga0496114_0270470 Ga0496114_0270470_25_396 115
591 3300048918 Ga0496115_0149188 Ga0496115_0149188_1094_1465 115
592 3300049568 Ga0501031_0012132 Ga0501031_0012132_1373_1720 115
593 3300049569 Ga0501032_0011109 Ga0501032_0011109_1849_2196 115
594 3300049570 Ga0501033_0010308 Ga0501033_0010308_2909_3256 115
595 3300049571 Ga0501034_0178238 Ga0501034_0178238_1482_1829 115
596 3300049572 Ga0501036_0163008 Ga0501036_0163008_1345_1692 115
597 3300049573 Ga0501037_0024274 Ga0501037_0024274_311_658 115
598 3300049574 Ga0501038_0002656 Ga0501038_0002656_2514_2861 115
599 3300049575 Ga0501039_0046034 Ga0501039_0046034_197_544 115
600 3300049576 Ga0501040_0245845 Ga0501040_0245845_52_399 115
601 3300049578 Ga0501042_0125844 Ga0501042_0125844_804_1151 115
602 3300049579 Ga0501043_0010586 Ga0501043_0010586_1499_1846 115
603 3300049580 Ga0501046_0101824 Ga0501046_0101824_880_1227 115
604 3300049581 Ga0501047_0130216 Ga0501047_0130216_833_1180 115
605 3300049582 Ga0501048_0032493 Ga0501048_0032493_991_1338 115
606 3300049583 Ga0501067_0006428 Ga0501067_0006428_3576_3923 115
607 3300049584 Ga0501068_0100487 Ga0501068_0100487_1211_1558 115
608 3300049585 Ga0501069_0026324 Ga0501069_0026324_1848_2195 115
609 3300049586 Ga0501070_0074272 Ga0501070_0074272_986_1333 115
610 3300049587 Ga0501071_0073482 Ga0501071_0073482_838_1185 115
611 3300049587 Ga0501071_0695398 Ga0501071_0695398_17_367 115
612 3300049588 Ga0501072_0081793 Ga0501072_0081793_418_765 115
613 3300049589 Ga0501073_0010446 Ga0501073_0010446_1037_1384 115
614 3300049590 Ga0501074_0018326 Ga0501074_0018326_3747_4094 115
615 3300049741 Ga0501079_0055286 Ga0501079_0055286_2397_2744 115
616 3300049742 Ga0501080_0558118 Ga0501080_0558118_608_955 115
617 3300049743 Ga0501081_1371886 Ga0501081_1371886_147_497 115
618 3300049744 Ga0501083_0018408 Ga0501083_0018408_1543_1890 115
619 3300049822 Ga0501035_0100706 Ga0501035_0100706_1344_1691 115
620 3300049823 Ga0501044_0091391 Ga0501044_0091391_1380_1727 115
621 3300049824 Ga0501045_0075424 Ga0501045_0075424_720_1067 115
622 3300050507 nmdc:mga05p37_268784_c1 nmdc:mga05p37_268784_c1_1487_1837 115
623 3300050508 nmdc:mga09592_10828_c1 nmdc:mga09592_10828_c1_2048_2398 115
624 3300050509 nmdc:mga0qj67_15821_c1 nmdc:mga0qj67_15821_c1_5213_5563 115
625 3300050510 nmdc:mga06r32_1137728_c1 nmdc:mga06r32_1137728_c1_173_523 115
626 3300050511 nmdc:mga08y16_1345027_c1 nmdc:mga08y16_1345027_c1_137_484 115
627 3300054114 Ga0501084_0203557 Ga0501084_0203557_1301_1648 115
628 3300059491 Ga0587070_018036 Ga0587070_018036_304_654 115
629 3300059655 Ga0587114_138706 Ga0587114_138706_93_440 115
630 3300060344 Ga0587071_119514 Ga0587071_119514_128_478 115
631 3300060353 Ga0501082_0031883 Ga0501082_0031883_3209_3556 115
632 3300060353 Ga0501082_0326660 Ga0501082_0326660_601_951 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

5

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9506 6 94
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.9346 6 94
7nav-assembly1.cif.gz_V bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) 0.9249 5 97
8byv-assembly1.cif.gz_A cryo-em structure of a staphylococus aureus 30s-rbfa complex 0.9131 1 110
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.9078 1 97
ID Description Score Start End Superfamily
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9346 6 94 3.30.300.20
af_P0A7G2_1_108_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9167 1 102 3.30.300.20
af_Q5VPH3_41_157_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9073 2 101 3.30.300.20
af_Q2G2Q4_1_115_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8998 1 110 3.30.300.20
2kzfA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8886 1 93 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2W4HV54-F1-model_v4 Ribosome-binding factor A 0.9861 5 109 GO:0005829
GO:0030490
GO:0043024
AF-A0A2V8TQE8-F1-model_v4 Ribosome-binding factor A 0.9811 1 95 GO:0005829
GO:0030490
GO:0043024
AF-A0A496UT03-F1-model_v4 Ribosome-binding factor A 0.9797 1 110 GO:0003676
GO:0005737
GO:0030490
AF-A0A3D0N7V1-F1-model_v4 Ribosome-binding factor A 0.9792 4 111 GO:0005829
GO:0030490
GO:0043024
AF-A0A535F431-F1-model_v4 Ribosome-binding factor A 0.9786 2 110 GO:0005829
GO:0030490
GO:0043024

Feature Viewer

pLDDT pTM Quality
84.23 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map