F470952

General Info

Members Datasets Scaffolds Average Seq Length
631 395 1262 331

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0011296|Ga0466968_0011296_1177_2334
Length 385
Sequence MARCFADIGPGERLRRRAARAIRIVIPGRALCPPAQRFAKGIALDYVNLGRTGLKVSRLCLGCMSFGESAKGSHEWTLDEGTSRPFFRQALEAGINFFDTANAYSAGTSEEITGRALRDFARRDEIVVATKAYMPWREAPNAGGLSRKALFQAIDDSLRRLGMDYVDLYQIHRFDHETPVEETMEALHDIVKSGRVRYIGASSMEAWRFAKMQHVAQANGWTRFISMQPQVNLVYREEEREMIPLCLDQGVGVIPWSPLARGMLTRDWDEKTSRSQTDQYSKVIYTRTAEQDRKVVEAVAALAAERGLPRARIALAWLFAKPGITAPIVGATKPKHLEDAVAALDVTLTPEEMERLEEPYVPHPVVGLSAASRFTGTVSPPPAER

Samples

Sample ID Description Type Environment
1 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
97 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
98 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
99 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
182 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 2509276019 Ensifer aridi TW10 Isolate Nodule
335 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
336 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
337 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
338 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
339 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
340 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
341 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
342 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
343 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
344 2643221615 Nocardioides sp. Root224 Isolate Unclassified
345 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
346 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
347 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
348 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
349 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
350 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
351 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
352 2765235841 Pseudomonas putida AA7 Isolate Unclassified
353 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
354 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
355 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
356 2831426010 Nostoc sp. 106C Isolate Unclassified
357 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
358 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
359 2842694124 Methylopila sp. R-72369 Isolate Unclassified
360 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
361 2849660919 Nostoc sp. T09 Isolate Unclassified
362 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
363 2855730933 Achromobacter sp. HZ28 Isolate Nodule
364 2855767633 Achromobacter sp. HZ34 Isolate Nodule
365 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
366 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
367 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
368 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
369 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
370 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
371 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
372 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
373 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
374 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
375 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
376 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
377 2919150387 Rahnella aceris 1817 Isolate Unclassified
378 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
379 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
380 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
381 2927143783 Rahnella sp. 2050 Isolate Unclassified
382 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
383 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
384 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
385 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
386 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
387 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
388 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
389 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
390 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
391 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
392 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
393 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
394 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
395 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.86
Metatranscriptomes 0
Isolates 10.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 7.92
Nodule 2.06
Rhizoplane 5.07
Rhizosphere 69.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466968_0011296 3300044735 Bacteria 3477
2 SwRhRL2b_contig_15820 2162886007 Bacteria 1584
3 LJNas_1000436 3300000546 Bacteria 7366
4 JGI25162J39368_1000035 3300002737 Bacteria 180993
5 JGI25163J39215_1000058 3300002771 Bacteria 49660
6 JGI25164J39214_1000019 3300002772 Bacteria 180993
7 JGI25406J46586_10001580 3300003203 Bacteria 10749
8 rootH2_10101188 3300003320 Bacteria 8007
9 Ga0055538_1000039 3300003751 Bacteria 180993
10 Ga0055539_1000050 3300003752 Bacteria 180993
11 Ga0055533_1000062 3300003756 Bacteria 180993
12 Ga0055525_1000072 3300003759 Bacteria 180993
13 Ga0055526_1007305 3300003771 Bacteria 5778
14 Ga0055528_1002649 3300003790 Bacteria 9454
15 Ga0055528_1005808 3300003790 Eukaryota 5673
16 Ga0055541_1000038 3300003841 Bacteria 180993
17 Ga0065165_1001819 3300005262 Bacteria 20888
18 Ga0065714_10064555 3300005288 Bacteria 36587
19 Ga0065704_10000473 3300005289 Bacteria 19308
20 Ga0065704_10006453 3300005289 Bacteria 4293
21 Ga0065707_10082494 3300005295 Bacteria 14559
22 Ga0070683_100497560 3300005329 Bacteria 1164
23 Ga0070690_100080327 3300005330 Bacteria 2133
24 Ga0070670_100000044 3300005331 Bacteria 140263
25 Ga0068869_100218122 3300005334 Bacteria 1511
26 Ga0070666_10056294 3300005335 Bacteria 2655
27 Ga0070666_10074676 3300005335 Bacteria 2311
28 Ga0070680_100009949 3300005336 Bacteria 7323
29 Ga0070680_100172600 3300005336 Bacteria 1820
30 Ga0070680_100189076 3300005336 Bacteria 1735
31 Ga0070682_100066831 3300005337 Bacteria 2288
32 Ga0070682_100173210 3300005337 Bacteria 1501
33 Ga0070689_100232830 3300005340 Bacteria 1515
34 Ga0070661_100111218 3300005344 Bacteria 2045
35 Ga0070668_100010477 3300005347 Bacteria 6891
36 Ga0070668_100027124 3300005347 Bacteria 4347
37 Ga0070668_100089477 3300005347 Bacteria 2425
38 Ga0070668_100163085 3300005347 Bacteria 1810
39 Ga0070671_100006298 3300005355 Bacteria 9462
40 Ga0070671_100054791 3300005355 Bacteria 3316
41 Ga0070671_100093766 3300005355 Bacteria 2516
42 Ga0070673_100049163 3300005364 Bacteria 3292
43 Ga0070659_100066939 3300005366 Bacteria 2848
44 Ga0070667_100000442 3300005367 Bacteria 43103
45 Ga0070667_100112222 3300005367 Bacteria 2365
46 Ga0070709_10020356 3300005434 Bacteria 3848
47 Ga0070713_100006764 3300005436 Bacteria 7988
48 Ga0070713_100114561 3300005436 Bacteria 2356
49 Ga0070713_100178567 3300005436 Bacteria 1906
50 Ga0070713_100212390 3300005436 Bacteria 1752
51 Ga0070711_100124424 3300005439 Bacteria 1912
52 Ga0070705_100169377 3300005440 Bacteria 1468
53 Ga0070663_100239829 3300005455 Bacteria 1430
54 Ga0070678_100182052 3300005456 Bacteria 1721
55 Ga0070662_100114076 3300005457 Bacteria 2063
56 Ga0070681_10000086 3300005458 Bacteria 70488
57 Ga0070681_10004874 3300005458 Bacteria 12873
58 Ga0070698_100342230 3300005471 Bacteria 1427
59 Ga0070679_100001324 3300005530 Bacteria 21816
60 Ga0070679_100041191 3300005530 Bacteria 4597
61 Ga0070679_100046356 3300005530 Bacteria 4333
62 Ga0068853_100102030 3300005539 Bacteria 2538
63 Ga0070672_100065304 3300005543 Bacteria 2878
64 Ga0070672_100333520 3300005543 Bacteria 1291
65 Ga0070665_100009789 3300005548 Bacteria 9693
66 Ga0070665_100035864 3300005548 Bacteria 4989
67 Ga0070665_100192429 3300005548 Bacteria 2040
68 Ga0068855_100002756 3300005563 Bacteria 21628
69 Ga0068855_100234926 3300005563 Bacteria 2050
70 Ga0070664_100199933 3300005564 Bacteria 1783
71 Ga0068852_100028683 3300005616 Bacteria 4560
72 Ga0068852_100464041 3300005616 Bacteria 1256
73 Ga0068852_100522593 3300005616 Bacteria 1184
74 Ga0068859_100006822 3300005617 Bacteria 11602
75 Ga0068859_100021352 3300005617 Bacteria 6497
76 Ga0068859_100026905 3300005617 Bacteria 5770
77 Ga0068859_100081744 3300005617 Bacteria 3273
78 Ga0068864_100000061 3300005618 Bacteria 123373
79 Ga0068864_100227803 3300005618 Bacteria 1722
80 Ga0068863_100000012 3300005841 Bacteria 229774
81 Ga0068863_100000029 3300005841 Bacteria 177191
82 Ga0068863_100000943 3300005841 Bacteria 29196
83 Ga0068863_100005461 3300005841 Bacteria 12518
84 Ga0068863_100038790 3300005841 Bacteria 4532
85 Ga0068858_100000904 3300005842 Bacteria 30776
86 Ga0068858_100008350 3300005842 Bacteria 9963
87 Ga0068858_100014640 3300005842 Bacteria 7387
88 Ga0068858_100250693 3300005842 Bacteria 1681
89 Ga0068860_100000122 3300005843 Bacteria 125178
90 Ga0068860_100030648 3300005843 Bacteria 5173
91 Ga0068860_100283935 3300005843 Bacteria 1618
92 Ga0068862_100000175 3300005844 Bacteria 71556
93 Ga0068862_100087506 3300005844 Bacteria 2710
94 Ga0068862_100107694 3300005844 Bacteria 2443
95 Ga0081455_10113102 3300005937 Bacteria 2153
96 Ga0081539_10000299 3300005985 Bacteria 111908
97 Ga0070717_10133960 3300006028 Bacteria 2132
98 Ga0075365_10109823 3300006038 Bacteria 1895
99 Ga0075363_100024348 3300006048 Bacteria 3077
100 Ga0075364_10022181 3300006051 Bacteria 4007
101 Ga0075432_10070033 3300006058 Bacteria 1259
102 Ga0070716_100029213 3300006173 Bacteria 2978
103 Ga0070712_100032446 3300006175 Bacteria 3527
104 Ga0070712_100168775 3300006175 Bacteria 1696
105 Ga0075367_10055498 3300006178 Bacteria 2351
106 Ga0075367_10068556 3300006178 Bacteria 2128
107 Ga0075366_10081578 3300006195 Bacteria 1932
108 Ga0075370_10014645 3300006353 Bacteria 4187
109 Ga0075370_10100708 3300006353 Bacteria 1672
110 Ga0097620_100006822 3300006931 Bacteria 11602
111 Ga0097620_100021352 3300006931 Bacteria 6497
112 Ga0097620_100026904 3300006931 Bacteria 5770
113 Ga0097620_100081749 3300006931 Bacteria 3273
114 Ga0079104_1005054 3300006946 Bacteria 5387
115 Ga0075435_100004243 3300007076 Bacteria 9847
116 Ga0105251_10005530 3300009011 Bacteria 8228
117 Ga0105244_10000014 3300009036 Bacteria 257018
118 Ga0105244_10000181 3300009036 Bacteria 63616
119 Ga0105244_10001115 3300009036 Bacteria 22347
120 Ga0105244_10003143 3300009036 Bacteria 12020
121 Ga0105244_10029405 3300009036 Bacteria 2937
122 Ga0105244_10051728 3300009036 Bacteria 2093
123 Ga0105244_10114681 3300009036 Bacteria 1308
124 Ga0105250_10000015 3300009092 Bacteria 262683
125 Ga0105250_10000509 3300009092 Bacteria 27263
126 Ga0105250_10001434 3300009092 Bacteria 12868
127 Ga0105250_10016862 3300009092 Bacteria 2973
128 Ga0105250_10024394 3300009092 Bacteria 2437
129 Ga0105240_10512416 3300009093 Bacteria 1332
130 Ga0105245_10222735 3300009098 Bacteria 1821
131 Ga0105245_10426219 3300009098 Bacteria 1331
132 Ga0105247_10124709 3300009101 Bacteria 1672
133 Ga0105243_10003560 3300009148 Bacteria 12573
134 Ga0105243_10023478 3300009148 Bacteria 4697
135 Ga0105242_10445491 3300009176 Bacteria 1219
136 Ga0105242_10555057 3300009176 Bacteria 1102
137 Ga0105248_10016321 3300009177 Bacteria 8173
138 Ga0105248_10127709 3300009177 Bacteria 2869
139 Ga0105248_10203501 3300009177 Bacteria 2231
140 Ga0105237_10086339 3300009545 Bacteria 3127
141 Ga0105238_10000686 3300009551 Bacteria 35493
142 Ga0105249_10001255 3300009553 Bacteria 22245
143 Ga0105239_10052103 3300010375 Bacteria 4487
144 Ga0157320_1001195 3300012481 Bacteria 1268
145 Ga0157371_10001496 3300013102 Bacteria 24185
146 Ga0157370_10000786 3300013104 Bacteria 39874
147 Ga0157370_10267355 3300013104 Bacteria 1580
148 Ga0157369_10003138 3300013105 Bacteria 19744
149 Ga0157369_10010223 3300013105 Bacteria 10709
150 Ga0157378_10152047 3300013297 Bacteria 2157
151 Ga0163162_10006618 3300013306 Bacteria 11230
152 Ga0163162_10030922 3300013306 Bacteria 5308
153 Ga0163162_10085056 3300013306 Bacteria 3239
154 Ga0157375_10000050 3300013308 Bacteria 134913
155 Ga0163163_10014030 3300014325 Bacteria 7353
156 Ga0157380_10000529 3300014326 Bacteria 23486
157 Ga0157379_10008870 3300014968 Bacteria 8767
158 Ga0157379_10050019 3300014968 Bacteria 3730
159 Ga0157376_10254568 3300014969 Bacteria 1642
160 Ga0182005_1013119 3300015265 Bacteria 2333
161 Ga0183366_1001 3300015679 Bacteria 2743932
162 Ga0183370_1001 3300015680 Bacteria 2743932
163 Ga0183369_1001 3300015685 Bacteria 2743932
164 Ga0183368_1001 3300015687 Bacteria 2743932
165 Ga0213874_10022172 3300021377 Bacteria 1759
166 Ga0213876_10000448 3300021384 Bacteria 33257
167 Ga0213876_10005728 3300021384 Bacteria 6809
168 Ga0213875_10000522 3300021388 Bacteria 31812
169 Ga0209760_100075 3300025207 Bacteria 80269
170 Ga0209784_100001 3300025224 Bacteria 3600592
171 Ga0209566_100001 3300025225 Bacteria 3600765
172 Ga0209674_100002 3300025226 Bacteria 3600592
173 Ga0209563_100002 3300025230 Bacteria 2045675
174 Ga0207427_100012 3300025231 Bacteria 585657
175 Ga0209437_100001 3300025233 Bacteria 2045675
176 Ga0209437_100249 3300025233 Bacteria 85649
177 Ga0209677_100002 3300025253 Bacteria 2045675
178 Ga0209673_1000025 3300025273 Bacteria 404572
179 Ga0209673_1001546 3300025273 Eukaryota 20786
180 Ga0209564_1000644 3300025295 Bacteria 52727
181 Ga0209256_1000940 3300025299 Bacteria 35371
182 Ga0207696_1000006 3300025711 Bacteria 616498
183 Ga0207696_1000017 3300025711 Bacteria 491130
184 Ga0207696_1000352 3300025711 Bacteria 47130
185 Ga0207696_1000410 3300025711 Bacteria 39989
186 Ga0207696_1008797 3300025711 Bacteria 3821
187 Ga0207655_1000063 3300025728 Bacteria 257028
188 Ga0207655_1005388 3300025728 Bacteria 8714
189 Ga0207655_1010773 3300025728 Bacteria 5516
190 Ga0207655_1018312 3300025728 Bacteria 3722
191 Ga0207655_1071808 3300025728 Bacteria 1282
192 Ga0207713_1015601 3300025735 Bacteria 3891
193 Ga0207713_1017236 3300025735 Bacteria 3632
194 Ga0207692_10125623 3300025898 Bacteria 1442
195 Ga0207710_10011592 3300025900 Bacteria 3710
196 Ga0207710_10015883 3300025900 Bacteria 3185
197 Ga0207710_10067622 3300025900 Bacteria 1632
198 Ga0207680_10003925 3300025903 Bacteria 7017
199 Ga0207680_10028872 3300025903 Bacteria 3109
200 Ga0207680_10195285 3300025903 Bacteria 1376
201 Ga0207685_10034043 3300025905 Bacteria 1847
202 Ga0207699_10016039 3300025906 Bacteria 3908
203 Ga0207699_10062165 3300025906 Bacteria 2250
204 Ga0207707_10000137 3300025912 Bacteria 75096
205 Ga0207707_10000364 3300025912 Bacteria 47458
206 Ga0207707_10001691 3300025912 Bacteria 20295
207 Ga0207707_10226669 3300025912 Bacteria 1626
208 Ga0207695_10000844 3300025913 Bacteria 56228
209 Ga0207671_10138439 3300025914 Bacteria 1874
210 Ga0207671_10139605 3300025914 Bacteria 1866
211 Ga0207671_10182649 3300025914 Bacteria 1633
212 Ga0207693_10002169 3300025915 Bacteria 17108
213 Ga0207693_10201294 3300025915 Bacteria 1566
214 Ga0207663_10020413 3300025916 Bacteria 3751
215 Ga0207660_10009076 3300025917 Bacteria 6440
216 Ga0207660_10101528 3300025917 Bacteria 2149
217 Ga0207657_10074280 3300025919 Bacteria 2871
218 Ga0207652_10001893 3300025921 Bacteria 18103
219 Ga0207652_10033211 3300025921 Bacteria 4344
220 Ga0207681_10319494 3300025923 Bacteria 1234
221 Ga0207694_10152445 3300025924 Bacteria 1862
222 Ga0207650_10000065 3300025925 Bacteria 140452
223 Ga0207659_10130953 3300025926 Bacteria 1936
224 Ga0207687_10251331 3300025927 Bacteria 1406
225 Ga0207700_10018201 3300025928 Bacteria 4714
226 Ga0207700_10106296 3300025928 Bacteria 2250
227 Ga0207664_10029047 3300025929 Bacteria 4209
228 Ga0207664_10039976 3300025929 Bacteria 3643
229 Ga0207644_10000118 3300025931 Bacteria 58554
230 Ga0207644_10010922 3300025931 Bacteria 5999
231 Ga0207644_10014113 3300025931 Bacteria 5343
232 Ga0207644_10080551 3300025931 Bacteria 2405
233 Ga0207706_10162994 3300025933 Bacteria 1960
234 Ga0207709_10044305 3300025935 Bacteria 2687
235 Ga0207669_10112190 3300025937 Bacteria 1830
236 Ga0207691_10451627 3300025940 Bacteria 1094
237 Ga0207689_10005901 3300025942 Bacteria 10848
238 Ga0207689_10285204 3300025942 Bacteria 1367
239 Ga0207679_10212376 3300025945 Bacteria 1623
240 Ga0207667_10175112 3300025949 Bacteria 2204
241 Ga0207667_10230785 3300025949 Bacteria 1895
242 Ga0207651_10084677 3300025960 Bacteria 2298
243 Ga0207651_10085503 3300025960 Bacteria 2289
244 Ga0207712_10001428 3300025961 Bacteria 16325
245 Ga0207668_10000227 3300025972 Bacteria 37774
246 Ga0207668_10003902 3300025972 Bacteria 8787
247 Ga0207668_10009871 3300025972 Bacteria 5737
248 Ga0207668_10022433 3300025972 Bacteria 4041
249 Ga0207658_10020691 3300025986 Bacteria 4557
250 Ga0207703_10000629 3300026035 Bacteria 35516
251 Ga0207703_10002391 3300026035 Bacteria 16315
252 Ga0207703_10003541 3300026035 Bacteria 13067
253 Ga0207678_10017807 3300026067 Bacteria 6237
254 Ga0207678_10039578 3300026067 Bacteria 4091
255 Ga0207708_10201067 3300026075 Bacteria 1590
256 Ga0207702_10018843 3300026078 Bacteria 5709
257 Ga0207641_10000024 3300026088 Bacteria 250751
258 Ga0207641_10000049 3300026088 Bacteria 177222
259 Ga0207641_10004475 3300026088 Bacteria 12099
260 Ga0207641_10043275 3300026088 Bacteria 3781
261 Ga0207676_10000062 3300026095 Bacteria 112045
262 Ga0207676_10103572 3300026095 Bacteria 2365
263 Ga0207676_10239710 3300026095 Bacteria 1626
264 Ga0207674_10073222 3300026116 Bacteria 3439
265 Ga0207683_10031783 3300026121 Bacteria 4583
266 Ga0207683_10075269 3300026121 Bacteria 2988
267 Ga0209371_1000017 3300027312 Bacteria 625776
268 Ga0268266_10175056 3300028379 Bacteria 1950
269 Ga0268265_10006528 3300028380 Bacteria 7903
270 Ga0268264_10000172 3300028381 Bacteria 140393
271 Ga0268264_10010823 3300028381 Bacteria 7535
272 Ga0265323_10000022 3300028653 Bacteria 86774
273 Ga0265323_10011234 3300028653 Bacteria 3614
274 Ga0265323_10015755 3300028653 Bacteria 2967
275 Ga0265323_10018534 3300028653 Bacteria 2693
276 Ga0265322_10000773 3300028654 Bacteria 11509
277 Ga0307517_10084933 3300028786 Eukaryota 2658
278 Ga0307515_10046441 3300028794 Bacteria 6637
279 Ga0268256_1000091 3300030500 Bacteria 148069
280 Ga0265330_10000761 3300031235 Bacteria 20237
281 Ga0265325_10013116 3300031241 Bacteria 4723
282 Ga0265339_10030112 3300031249 Bacteria 3075
283 Ga0265339_10065231 3300031249 Bacteria 1953
284 Ga0265327_10014418 3300031251 Bacteria 5172
285 Ga0265327_10016630 3300031251 Bacteria 4660
286 Ga0265316_10005338 3300031344 Bacteria 12521
287 Ga0265316_10024544 3300031344 Bacteria 5047
288 Ga0265316_10112025 3300031344 Bacteria 2066
289 Ga0307513_10003237 3300031456 Bacteria 22198
290 Ga0307513_10081833 3300031456 Bacteria 3326
291 Ga0265313_10007209 3300031595 Bacteria 7653
292 Ga0265313_10011615 3300031595 Bacteria 5460
293 Ga0265313_10030125 3300031595 Bacteria 2798
294 Ga0307508_10217192 3300031616 Bacteria 1512
295 Ga0316575_10000148 3300031665 Bacteria 17878
296 Ga0316575_10009851 3300031665 Bacteria 3504
297 Ga0316579_10005524 3300031691 Bacteria 5112
298 Ga0265314_10001636 3300031711 Bacteria 24553
299 Ga0265342_10057177 3300031712 Bacteria 2309
300 Ga0265342_10083229 3300031712 Bacteria 1845
301 Ga0316576_10000162 3300031727 Bacteria 27087
302 Ga0316578_10001547 3300031728 Bacteria 9468
303 Ga0307405_10036781 3300031731 Bacteria 2936
304 Ga0316577_10000161 3300031733 Bacteria 21168
305 Ga0307518_10174344 3300031838 Bacteria 1462
306 Ga0307416_100738086 3300032002 Bacteria 1076
307 Ga0307415_100185683 3300032126 Bacteria 1636
308 Ga0316583_10006854 3300032133 Bacteria 4103
309 Ga0316583_10071196 3300032133 Bacteria 1216
310 Ga0316585_10001202 3300032137 Bacteria 6763
311 Ga0307510_10167409 3300033180 Bacteria 1783
312 Ga0373930_0025328 3300034816 Bacteria 1190
313 Ga0373934_0010456 3300035086 Bacteria 3482
314 Ga0373944_0004433 3300035089 Bacteria 3656
315 Ga0373923_0010014 3300035111 Bacteria 3434
316 Ga0373936_0014545 3300035113 Bacteria 3011
317 Ga0373945_0003407 3300035116 Bacteria 5000
318 Ga0373953_0009595 3300035117 Bacteria 3338
319 Ga0373943_0001162 3300035170 Bacteria 11753
320 Ga0373946_0002275 3300035171 Bacteria 6785
321 Ga0373946_0091836 3300035171 Bacteria 1346
322 Ga0373955_0023621 3300035172 Bacteria 3134
323 Ga0373962_0019819 3300035242 Bacteria 1762
324 Ga0316574_0000106 3300035398 Bacteria 24723
325 Ga0316574_0002419 3300035398 Bacteria 9366
326 Ga0316574_0112850 3300035398 Bacteria 1743
327 Ga0373924_0067466 3300035410 Bacteria 1505
328 Ga0373931_0029047 3300035691 Bacteria 2835
329 Ga0373933_0028604 3300035724 Bacteria 3217
330 Ga0373933_0066382 3300035724 Bacteria 2186
331 Ga0373947_0047628 3300035725 Bacteria 2569
332 Ga0316582_0000056 3300036647 Bacteria 28079
333 Ga0373925_0012089 3300037068 Bacteria 6250
334 Ga0395900_0009362 3300037418 Bacteria 10044
335 Ga0395900_0059571 3300037418 Bacteria 3931
336 Ga0395898_0007612 3300037466 Bacteria 11496
337 Ga0395905_0002608 3300037471 Bacteria 19850
338 Ga0395905_0304090 3300037471 Bacteria 1482
339 Ga0436364_0353909 3300037853 Bacteria 90577
340 Ga0436364_0929910 3300037853 Bacteria 1410
341 Ga0436364_1394533 3300037853 Bacteria 1488
342 Ga0395901_0066927 3300038443 Bacteria 3741
343 Ga0395901_0108002 3300038443 Bacteria 2921
344 Ga0395901_0264914 3300038443 Bacteria 1788
345 Ga0436365_0184325 3300039437 Bacteria 1002
346 Ga0436365_0731400 3300039437 Bacteria 7266
347 Ga0436365_0856475 3300039437 Bacteria 11639
348 Ga0436365_0861404 3300039437 Bacteria 4877
349 Ga0436363_1384809 3300039450 Bacteria 4058
350 Ga0451837_1102736 3300041494 Bacteria 4275
351 Ga0451839_0078825 3300041496 Bacteria 1555
352 Ga0439432_028844 3300042006 Bacteria 1806
353 Ga0451577_0003137 3300042876 Bacteria 18623
354 Ga0466966_0027370 3300044684 Bacteria 3718
355 Ga0466961_0021598 3300044693 Bacteria 4141
356 Ga0466961_0078626 3300044693 Bacteria 2089
357 Ga0453684_0297918 3300044712 Bacteria 1834
358 Ga0495592_0015572 3300046454 Eukaryota 5769
359 Ga0495592_0079749 3300046454 Eukaryota 2369
360 Ga0495592_0099608 3300046454 Bacteria 2073
361 Ga0495592_0132645 3300046454 Eukaryota 1741
362 Ga0495603_0001625 3300046455 Bacteria 13190
363 Ga0495638_0039418 3300046460 Bacteria 2999
364 Ga0495638_0142545 3300046460 Bacteria 1397
365 Ga0495641_0003067 3300046461 Eukaryota 12765
366 Ga0495641_0005171 3300046461 Bacteria 8916
367 Ga0495641_0021762 3300046461 Eukaryota 3219
368 Ga0495651_0031545 3300046462 Eukaryota 4133
369 Ga0495653_0057445 3300046463 Bacteria 2961
370 Ga0495653_0077375 3300046463 Bacteria 2470
371 Ga0495653_0105826 3300046463 Eukaryota 2030
372 Ga0495582_0019097 3300046473 Bacteria 3750
373 Ga0495639_0001386 3300046475 Bacteria 10873
374 Ga0495585_0000087 3300046492 Bacteria 97091
375 Ga0495594_0006393 3300046499 Bacteria 6061
376 Ga0495594_0100267 3300046499 Bacteria 1629
377 Ga0495606_0080820 3300046507 Eukaryota 2022
378 Ga0495608_0077399 3300046511 Eukaryota 2165
379 Ga0495616_0000180 3300046513 Bacteria 54040
380 Ga0495618_0013357 3300046514 Eukaryota 4998
381 Ga0495618_0029744 3300046514 Bacteria 3408
382 Ga0495618_0046749 3300046514 Eukaryota 2732
383 Ga0495620_0042348 3300046515 Eukaryota 1989
384 Ga0495628_0002875 3300046516 Eukaryota 15427
385 Ga0495628_0003313 3300046516 Eukaryota 14406
386 Ga0495628_0120951 3300046516 Eukaryota 2009
387 Ga0495630_0059637 3300046517 Bacteria 2863
388 Ga0495666_0071406 3300046526 Bacteria 1650
389 Ga0495652_0002012 3300046529 Eukaryota 21623
390 Ga0495652_0008854 3300046529 Eukaryota 9158
391 Ga0495652_0036368 3300046529 Eukaryota 4283
392 Ga0495654_0032452 3300046530 Bacteria 2647
393 Ga0495665_0099269 3300046531 Bacteria 1528
394 Ga0495586_0219448 3300046535 Bacteria 1080
395 Ga0495587_0005677 3300046536 Bacteria 8135
396 Ga0495597_0000116 3300046542 Bacteria 72210
397 Ga0495597_0039236 3300046542 Bacteria 2121
398 Ga0495645_0045218 3300046543 Eukaryota 3212
399 Ga0495645_0064867 3300046543 Eukaryota 2642
400 Ga0495667_0012429 3300046559 Bacteria 5773
401 Ga0495668_0005343 3300046616 Bacteria 8762
402 Ga0495634_0002865 3300046642 Eukaryota 14143
403 Ga0495634_0009318 3300046642 Bacteria 7241
404 Ga0495625_0006910 3300046660 Bacteria 10015
405 Ga0495625_0021996 3300046660 Bacteria 4897
406 Ga0495635_0011974 3300046663 Eukaryota 6077
407 Ga0495635_0254221 3300046663 Bacteria 1184
408 Ga0495588_0211005 3300046674 Bacteria 1025
409 Ga0495657_0001718 3300046675 Eukaryota 18780
410 Ga0495657_0016827 3300046675 Bacteria 5318
411 Ga0495657_0169452 3300046675 Bacteria 1345
412 Ga0495623_0000229 3300046679 Eukaryota 36065
413 Ga0495646_0032282 3300046680 Bacteria 3258
414 Ga0495646_0034002 3300046680 Eukaryota 3168
415 Ga0495658_0038772 3300046683 Bacteria 2639
416 Ga0495613_0000711 3300046689 Bacteria 26036
417 Ga0495613_0028817 3300046689 Bacteria 4129
418 Ga0495624_0010281 3300046690 Eukaryota 6448
419 Ga0495624_0012873 3300046690 Bacteria 5708
420 Ga0495624_0107525 3300046690 Eukaryota 1716
421 Ga0495670_0009952 3300046691 Bacteria 4673
422 Ga0495649_0129599 3300046694 Bacteria 1331
423 Ga0495589_0000343 3300046794 Bacteria 36497
424 Ga0495600_0012414 3300046809 Bacteria 5326
425 Ga0495600_0020316 3300046809 Eukaryota 4248
426 Ga0495600_0074812 3300046809 Bacteria 2212
427 Ga0495660_0000004 3300046810 Bacteria 1003183
428 Ga0495604_0016267 3300047317 Bacteria 5944
429 Ga0495604_0016383 3300047317 Eukaryota 5925
430 Ga0495604_0079398 3300047317 Eukaryota 2461
431 Ga0495674_0013201 3300047319 Eukaryota 7764
432 Ga0495674_0045392 3300047319 Bacteria 3901
433 Ga0495676_0001579 3300047321 Eukaryota 19774
434 Ga0495676_0009962 3300047321 Eukaryota 8636
435 Ga0495676_0031414 3300047321 Eukaryota 4492
436 Ga0495676_0035672 3300047321 Bacteria 4158
437 Ga0495680_0097053 3300047322 Bacteria 2200
438 Ga0495679_000051 3300047446 Bacteria 121243
439 Ga0495684_0023399 3300047471 Bacteria 4749
440 Ga0495684_0032668 3300047471 Bacteria 3996
441 Ga0495686_0000086 3300047472 Bacteria 197490
442 Ga0495602_0002021 3300048088 Eukaryota 20411
443 Ga0495602_0010888 3300048088 Eukaryota 9425
444 Ga0495602_0030668 3300048088 Eukaryota 5096
445 Ga0495602_0084897 3300048088 Eukaryota 2647
446 Ga0495602_0150821 3300048088 Eukaryota 1827
447 Ga0495614_0014678 3300048089 Bacteria 3425
448 Ga0495614_0044196 3300048089 Bacteria 1911
449 Ga0495626_0000020 3300048091 Bacteria 222537
450 Ga0496101_0099938 3300048904 Bacteria 2170
451 Ga0496101_0229510 3300048904 Bacteria 1442
452 Ga0496102_0000015 3300048905 Bacteria 304524
453 Ga0496102_0032328 3300048905 Bacteria 4700
454 Ga0496103_0000020 3300048906 Bacteria 234050
455 Ga0496103_0013685 3300048906 Bacteria 4813
456 Ga0496104_0001350 3300048907 Bacteria 21251
457 Ga0496104_0001986 3300048907 Bacteria 17735
458 Ga0496104_0145325 3300048907 Bacteria 2277
459 Ga0496104_0811257 3300048907 Bacteria 842
460 Ga0496105_0039646 3300048908 Bacteria 3883
461 Ga0496106_0095222 3300048909 Bacteria 2303
462 Ga0496106_0317442 3300048909 Bacteria 1250
463 Ga0496108_0167660 3300048911 Bacteria 1899
464 Ga0496108_0453710 3300048911 Bacteria 1120
465 Ga0496109_0037962 3300048912 Bacteria 4353
466 Ga0496109_0127048 3300048912 Bacteria 2377
467 Ga0496110_0020179 3300048913 Bacteria 5623
468 Ga0496110_0070746 3300048913 Bacteria 3092
469 Ga0496110_0086039 3300048913 Bacteria 2806
470 Ga0496110_0159594 3300048913 Bacteria 2044
471 Ga0496111_0024198 3300048914 Bacteria 4273
472 Ga0496111_0079079 3300048914 Bacteria 2398
473 Ga0496112_0094359 3300048915 Bacteria 2962
474 Ga0496113_0317919 3300048916 Bacteria 1247
475 Ga0496114_0052133 3300048917 Bacteria 3408
476 Ga0496114_0167033 3300048917 Bacteria 1916
477 Ga0496116_0000139 3300048919 Bacteria 151501
478 Ga0496116_0000225 3300048919 Bacteria 105470
479 Ga0496117_0000047 3300048920 Bacteria 299632
480 Ga0496117_0007320 3300048920 Bacteria 10824
481 Ga0496118_0000048 3300048921 Bacteria 253404
482 Ga0496118_0000050 3300048921 Bacteria 244124
483 Ga0496118_0000106 3300048921 Bacteria 155884
484 Ga0496118_0005524 3300048921 Bacteria 14342
485 Ga0496118_0150179 3300048921 Bacteria 1460
486 Ga0496119_0003127 3300048922 Bacteria 17432
487 Ga0496119_0004021 3300048922 Bacteria 14862
488 Ga0496120_0002550 3300048923 Bacteria 18169
489 Ga0496120_0009848 3300048923 Bacteria 6732
490 Ga0496121_0000190 3300048924 Bacteria 136607
491 Ga0496121_0018165 3300048924 Bacteria 7110
492 Ga0496121_0033640 3300048924 Bacteria 4634
493 Ga0496121_0047815 3300048924 Bacteria 3646
494 Ga0496121_0131593 3300048924 Bacteria 1871
495 Ga0496122_0000007 3300048925 Bacteria 606493
496 Ga0496122_0000539 3300048925 Bacteria 78416
497 Ga0496122_0013317 3300048925 Bacteria 8060
498 Ga0496122_0015145 3300048925 Bacteria 7391
499 Ga0496123_0000004 3300048926 Bacteria 777230
500 Ga0496123_0000380 3300048926 Bacteria 83326
501 Ga0496123_0000509 3300048926 Bacteria 67751
502 Ga0496123_0005095 3300048926 Bacteria 13418
503 Ga0496123_0125271 3300048926 Bacteria 1436
504 Ga0496124_0000425 3300048927 Bacteria 75572
505 Ga0496124_0004420 3300048927 Bacteria 16396
506 Ga0496124_0007672 3300048927 Bacteria 11414
507 Ga0496124_0016723 3300048927 Bacteria 6956
508 Ga0496124_0229509 3300048927 Bacteria 1389
509 Ga0496125_0000013 3300048928 Bacteria 628761
510 Ga0496125_0000038 3300048928 Bacteria 328120
511 Ga0496125_0004360 3300048928 Bacteria 16403
512 Ga0496125_0016504 3300048928 Bacteria 7087
513 Ga0496125_0023313 3300048928 Bacteria 5715
514 Ga0496125_0059913 3300048928 Bacteria 3064
515 Ga0496126_0000049 3300048929 Bacteria 317568
516 Ga0496126_0000358 3300048929 Bacteria 95082
517 Ga0496126_0003079 3300048929 Bacteria 21570
518 Ga0496126_0015813 3300048929 Bacteria 7579
519 Ga0496126_0056234 3300048929 Bacteria 3557
520 Ga0496126_0094269 3300048929 Bacteria 2627
521 Ga0496126_0222817 3300048929 Bacteria 1583
522 Ga0501300_000369 3300049523 Bacteria 6875
523 Ga0501033_0007683 3300049570 Bacteria 8367
524 Ga0501034_0008322 3300049571 Bacteria 10976
525 Ga0501034_0245379 3300049571 Bacteria 1736
526 Ga0501034_0291782 3300049571 Bacteria 1569
527 Ga0501036_0109741 3300049572 Bacteria 2331
528 Ga0501037_0139871 3300049573 Bacteria 1733
529 Ga0501043_0013552 3300049579 Bacteria 6379
530 Ga0501043_0023822 3300049579 Bacteria 4802
531 Ga0501046_0019676 3300049580 Bacteria 5595
532 Ga0501046_0166906 3300049580 Bacteria 1654
533 Ga0501047_0003897 3300049581 Bacteria 14024
534 Ga0501047_0007227 3300049581 Bacteria 10438
535 Ga0501048_0047571 3300049582 Bacteria 3061
536 Ga0501068_0103348 3300049584 Bacteria 1767
537 Ga0501070_0144253 3300049586 Bacteria 1965
538 Ga0501079_0194312 3300049741 Bacteria 1584
539 Ga0501080_0012958 3300049742 Bacteria 7655
540 Ga0501280_005218 3300049776 Bacteria 1867
541 Ga0501035_0002524 3300049822 Bacteria 17902
542 Ga0501044_0030358 3300049823 Bacteria 5697
543 nmdc:mga03683_320_c1 3300050489 Bacteria 8903
544 nmdc:mga03n38_22667_c1 3300050490 Bacteria 2545
545 nmdc:mga00v17_12172_c1 3300050491 Bacteria 4742
546 nmdc:mga00v17_44659_c1 3300050491 Bacteria 2673
547 nmdc:mga0yw44_112547_c1 3300050492 Bacteria 1746
548 nmdc:mga0k408_37918_c1 3300050493 Bacteria 2767
549 nmdc:mga06z11_3286_c1 3300050494 Bacteria 6255
550 nmdc:mga07m45_2296_c1 3300050496 Bacteria 8946
551 nmdc:mga07m45_8920_c1 3300050496 Bacteria 5177
552 nmdc:mga0n895_158070_c1 3300050512 Bacteria 2298
553 nmdc:mga0n895_612110_c1 3300050512 Bacteria 1091
554 nmdc:mga0rr50_14608_c1 3300050513 Bacteria 5157
555 nmdc:mga08x19_77065_c1 3300050514 Bacteria 2183
556 Ga0495601_0008529 3300053077 Bacteria 6052
557 Ga0495612_0014764 3300053078 Bacteria 3135
558 Ga0500641_0024474 3300053096 Bacteria 2328
559 Ga0500555_001112 3300053103 Bacteria 8890
560 Ga0500607_000690 3300053121 Eukaryota 32593
561 Ga0500568_0003896 3300053139 Bacteria 8123
562 Ga0500588_0005979 3300053146 Bacteria 2731
563 Ga0500616_0002329 3300053153 Bacteria 16019
564 Ga0500645_000658 3300053730 Bacteria 21670
565 Ga0501084_0122190 3300054114 Bacteria 2190
566 Ga0500661_017542 3300055283 Bacteria 1279
567 Ga0590075_024138 3300059424 Bacteria 1525
568 2509376630 2509276019 Bacteria 6802256
569 2514018136 2513237162 Bacteria 7468464
570 2547406275 2547132111 Bacteria 8013147
571 2558864009 2558860100 Bacteria 8458965
572 2587742619 2585428059 Bacteria 8696589
573 2599326382 2599185155 Bacteria 5827168
574 2603702908 2602042067 Bacteria 4863713
575 2603866785 2602042109 Bacteria 5152801
576 2616700937 2616644814 Bacteria 11555299
577 2643736290 2643221543 Bacteria 6628015
578 2644090131 2643221615 Bacteria 5487866
579 2644319975 2643221657 Bacteria 5490246
580 2644667397 2643221722 Bacteria 4247614
581 2671108619 2667528173 Bacteria 5375747
582 2719637303 2718217991 Bacteria 7829542
583 2738697972 2738541272 Bacteria 6848551
584 2739207168 2738543005 Bacteria 5278128
585 2757565058 2757320391 Bacteria 4746095
586 2765584082 2765235841 Bacteria 6137024
587 2791916549 2791354901 Bacteria 8322202
588 2809143586 2808606418 Bacteria 6724496
589 2821113042 2821111986 Bacteria 6894338
590 2831428900 2831426010 Bacteria 8662725
591 2841862680 2841859092 Bacteria 5436171
592 2842519802 2842515876 Bacteria 5436280
593 2842697315 2842694124 Bacteria 4063419
594 2848697369 2848694841 Bacteria 9205737
595 2849667816 2849660919 Bacteria 8251853
596 2850081629 2850079185 Bacteria 6848280
597 2855734972 2855730933 Bacteria 7047938
598 2855770756 2855767633 Bacteria 7049357
599 2870625083 2870622029 Bacteria 3643329
600 2873319062 2873314349 Bacteria 8512634
601 2886630996 2886627955 Bacteria 7618130
602 2889045501 2889042446 Bacteria 7618936
603 2897562976 2897561785 Bacteria 3256946
604 2904164754 2904162308 Bacteria 7086713
605 2904475686 2904474040 Bacteria 5504324
606 2904492373 2904490793 Bacteria 7046938
607 2904772041 2904770941 Bacteria 5580202
608 2913914913 2913912277 Bacteria 9037797
609 2913943513 2913939268 Bacteria 8559644
610 2915651959 2915650412 Bacteria 4288180
611 2919151855 2919150387 Bacteria 5500879
612 2919161515 2919160200 Bacteria 6929020
613 2919161597 2919160200 Bacteria 6929020
614 2919422060 2919420072 Bacteria 5390363
615 2919434382 2919432681 Bacteria 5390474
616 2927144524 2927143783 Bacteria 5504251
617 2931388934 2931384279 Bacteria 7299545
618 2933011907 2933011516 Bacteria 5439334
619 2933598677 2933594066 Bacteria 5594265
620 2935647785 2935638405 Bacteria 10015038
621 2935666840 2935665750 Bacteria 9571747
622 2935837269 2935827899 Bacteria 10038562
623 2945992494 2945991243 Bacteria 7008369
624 2946055243 2946053406 Bacteria 6978655
625 2946055326 2946053406 Bacteria 6978655
626 2984559063 2984555340 Bacteria 4247089
627 2984589032 2984587000 Bacteria 5263363
628 2988228121 2988225383 Bacteria 7221625
629 2993357617 2993356040 Bacteria 4247105
630 8054934608 8054929484 Bacteria 5599761
631 8056451506 8056447290 Bacteria 7680491
632 Ga0466968_0011296
633 SwRhRL2b_contig_15820
634 LJNas_1000436
635 JGI25162J39368_1000035
636 JGI25163J39215_1000058
637 JGI25164J39214_1000019
638 JGI25406J46586_10001580
639 rootH2_10101188
640 Ga0055538_1000039
641 Ga0055539_1000050
642 Ga0055533_1000062
643 Ga0055525_1000072
644 Ga0055526_1007305
645 Ga0055528_1002649
646 Ga0055528_1005808
647 Ga0055541_1000038
648 Ga0065165_1001819
649 Ga0065714_10064555
650 Ga0065704_10000473
651 Ga0065704_10006453
652 Ga0065707_10082494
653 Ga0070683_100497560
654 Ga0070690_100080327
655 Ga0070670_100000044
656 Ga0068869_100218122
657 Ga0070666_10056294
658 Ga0070666_10074676
659 Ga0070680_100009949
660 Ga0070680_100172600
661 Ga0070680_100189076
662 Ga0070682_100066831
663 Ga0070682_100173210
664 Ga0070689_100232830
665 Ga0070661_100111218
666 Ga0070668_100010477
667 Ga0070668_100027124
668 Ga0070668_100089477
669 Ga0070668_100163085
670 Ga0070671_100006298
671 Ga0070671_100054791
672 Ga0070671_100093766
673 Ga0070673_100049163
674 Ga0070659_100066939
675 Ga0070667_100000442
676 Ga0070667_100112222
677 Ga0070709_10020356
678 Ga0070713_100006764
679 Ga0070713_100114561
680 Ga0070713_100178567
681 Ga0070713_100212390
682 Ga0070711_100124424
683 Ga0070705_100169377
684 Ga0070663_100239829
685 Ga0070678_100182052
686 Ga0070662_100114076
687 Ga0070681_10000086
688 Ga0070681_10004874
689 Ga0070698_100342230
690 Ga0070679_100001324
691 Ga0070679_100041191
692 Ga0070679_100046356
693 Ga0068853_100102030
694 Ga0070672_100065304
695 Ga0070672_100333520
696 Ga0070665_100009789
697 Ga0070665_100035864
698 Ga0070665_100192429
699 Ga0068855_100002756
700 Ga0068855_100234926
701 Ga0070664_100199933
702 Ga0068852_100028683
703 Ga0068852_100464041
704 Ga0068852_100522593
705 Ga0068859_100006822
706 Ga0068859_100021352
707 Ga0068859_100026905
708 Ga0068859_100081744
709 Ga0068864_100000061
710 Ga0068864_100227803
711 Ga0068863_100000012
712 Ga0068863_100000029
713 Ga0068863_100000943
714 Ga0068863_100005461
715 Ga0068863_100038790
716 Ga0068858_100000904
717 Ga0068858_100008350
718 Ga0068858_100014640
719 Ga0068858_100250693
720 Ga0068860_100000122
721 Ga0068860_100030648
722 Ga0068860_100283935
723 Ga0068862_100000175
724 Ga0068862_100087506
725 Ga0068862_100107694
726 Ga0081455_10113102
727 Ga0081539_10000299
728 Ga0070717_10133960
729 Ga0075365_10109823
730 Ga0075363_100024348
731 Ga0075364_10022181
732 Ga0075432_10070033
733 Ga0070716_100029213
734 Ga0070712_100032446
735 Ga0070712_100168775
736 Ga0075367_10055498
737 Ga0075367_10068556
738 Ga0075366_10081578
739 Ga0075370_10014645
740 Ga0075370_10100708
741 Ga0097620_100006822
742 Ga0097620_100021352
743 Ga0097620_100026904
744 Ga0097620_100081749
745 Ga0079104_1005054
746 Ga0075435_100004243
747 Ga0105251_10005530
748 Ga0105244_10000014
749 Ga0105244_10000181
750 Ga0105244_10001115
751 Ga0105244_10003143
752 Ga0105244_10029405
753 Ga0105244_10051728
754 Ga0105244_10114681
755 Ga0105250_10000015
756 Ga0105250_10000509
757 Ga0105250_10001434
758 Ga0105250_10016862
759 Ga0105250_10024394
760 Ga0105240_10512416
761 Ga0105245_10222735
762 Ga0105245_10426219
763 Ga0105247_10124709
764 Ga0105243_10003560
765 Ga0105243_10023478
766 Ga0105242_10445491
767 Ga0105242_10555057
768 Ga0105248_10016321
769 Ga0105248_10127709
770 Ga0105248_10203501
771 Ga0105237_10086339
772 Ga0105238_10000686
773 Ga0105249_10001255
774 Ga0105239_10052103
775 Ga0157320_1001195
776 Ga0157371_10001496
777 Ga0157370_10000786
778 Ga0157370_10267355
779 Ga0157369_10003138
780 Ga0157369_10010223
781 Ga0157378_10152047
782 Ga0163162_10006618
783 Ga0163162_10030922
784 Ga0163162_10085056
785 Ga0157375_10000050
786 Ga0163163_10014030
787 Ga0157380_10000529
788 Ga0157379_10008870
789 Ga0157379_10050019
790 Ga0157376_10254568
791 Ga0182005_1013119
792 Ga0183366_1001
793 Ga0183370_1001
794 Ga0183369_1001
795 Ga0183368_1001
796 Ga0213874_10022172
797 Ga0213876_10000448
798 Ga0213876_10005728
799 Ga0213875_10000522
800 Ga0209760_100075
801 Ga0209784_100001
802 Ga0209566_100001
803 Ga0209674_100002
804 Ga0209563_100002
805 Ga0207427_100012
806 Ga0209437_100001
807 Ga0209437_100249
808 Ga0209677_100002
809 Ga0209673_1000025
810 Ga0209673_1001546
811 Ga0209564_1000644
812 Ga0209256_1000940
813 Ga0207696_1000006
814 Ga0207696_1000017
815 Ga0207696_1000352
816 Ga0207696_1000410
817 Ga0207696_1008797
818 Ga0207655_1000063
819 Ga0207655_1005388
820 Ga0207655_1010773
821 Ga0207655_1018312
822 Ga0207655_1071808
823 Ga0207713_1015601
824 Ga0207713_1017236
825 Ga0207692_10125623
826 Ga0207710_10011592
827 Ga0207710_10015883
828 Ga0207710_10067622
829 Ga0207680_10003925
830 Ga0207680_10028872
831 Ga0207680_10195285
832 Ga0207685_10034043
833 Ga0207699_10016039
834 Ga0207699_10062165
835 Ga0207707_10000137
836 Ga0207707_10000364
837 Ga0207707_10001691
838 Ga0207707_10226669
839 Ga0207695_10000844
840 Ga0207671_10138439
841 Ga0207671_10139605
842 Ga0207671_10182649
843 Ga0207693_10002169
844 Ga0207693_10201294
845 Ga0207663_10020413
846 Ga0207660_10009076
847 Ga0207660_10101528
848 Ga0207657_10074280
849 Ga0207652_10001893
850 Ga0207652_10033211
851 Ga0207681_10319494
852 Ga0207694_10152445
853 Ga0207650_10000065
854 Ga0207659_10130953
855 Ga0207687_10251331
856 Ga0207700_10018201
857 Ga0207700_10106296
858 Ga0207664_10029047
859 Ga0207664_10039976
860 Ga0207644_10000118
861 Ga0207644_10010922
862 Ga0207644_10014113
863 Ga0207644_10080551
864 Ga0207706_10162994
865 Ga0207709_10044305
866 Ga0207669_10112190
867 Ga0207691_10451627
868 Ga0207689_10005901
869 Ga0207689_10285204
870 Ga0207679_10212376
871 Ga0207667_10175112
872 Ga0207667_10230785
873 Ga0207651_10084677
874 Ga0207651_10085503
875 Ga0207712_10001428
876 Ga0207668_10000227
877 Ga0207668_10003902
878 Ga0207668_10009871
879 Ga0207668_10022433
880 Ga0207658_10020691
881 Ga0207703_10000629
882 Ga0207703_10002391
883 Ga0207703_10003541
884 Ga0207678_10017807
885 Ga0207678_10039578
886 Ga0207708_10201067
887 Ga0207702_10018843
888 Ga0207641_10000024
889 Ga0207641_10000049
890 Ga0207641_10004475
891 Ga0207641_10043275
892 Ga0207676_10000062
893 Ga0207676_10103572
894 Ga0207676_10239710
895 Ga0207674_10073222
896 Ga0207683_10031783
897 Ga0207683_10075269
898 Ga0209371_1000017
899 Ga0268266_10175056
900 Ga0268265_10006528
901 Ga0268264_10000172
902 Ga0268264_10010823
903 Ga0265323_10000022
904 Ga0265323_10011234
905 Ga0265323_10015755
906 Ga0265323_10018534
907 Ga0265322_10000773
908 Ga0307517_10084933
909 Ga0307515_10046441
910 Ga0268256_1000091
911 Ga0265330_10000761
912 Ga0265325_10013116
913 Ga0265339_10030112
914 Ga0265339_10065231
915 Ga0265327_10014418
916 Ga0265327_10016630
917 Ga0265316_10005338
918 Ga0265316_10024544
919 Ga0265316_10112025
920 Ga0307513_10003237
921 Ga0307513_10081833
922 Ga0265313_10007209
923 Ga0265313_10011615
924 Ga0265313_10030125
925 Ga0307508_10217192
926 Ga0316575_10000148
927 Ga0316575_10009851
928 Ga0316579_10005524
929 Ga0265314_10001636
930 Ga0265342_10057177
931 Ga0265342_10083229
932 Ga0316576_10000162
933 Ga0316578_10001547
934 Ga0307405_10036781
935 Ga0316577_10000161
936 Ga0307518_10174344
937 Ga0307416_100738086
938 Ga0307415_100185683
939 Ga0316583_10006854
940 Ga0316583_10071196
941 Ga0316585_10001202
942 Ga0307510_10167409
943 Ga0373930_0025328
944 Ga0373934_0010456
945 Ga0373944_0004433
946 Ga0373923_0010014
947 Ga0373936_0014545
948 Ga0373945_0003407
949 Ga0373953_0009595
950 Ga0373943_0001162
951 Ga0373946_0002275
952 Ga0373946_0091836
953 Ga0373955_0023621
954 Ga0373962_0019819
955 Ga0316574_0000106
956 Ga0316574_0002419
957 Ga0316574_0112850
958 Ga0373924_0067466
959 Ga0373931_0029047
960 Ga0373933_0028604
961 Ga0373933_0066382
962 Ga0373947_0047628
963 Ga0316582_0000056
964 Ga0373925_0012089
965 Ga0395900_0009362
966 Ga0395900_0059571
967 Ga0395898_0007612
968 Ga0395905_0002608
969 Ga0395905_0304090
970 Ga0436364_0353909
971 Ga0436364_0929910
972 Ga0436364_1394533
973 Ga0395901_0066927
974 Ga0395901_0108002
975 Ga0395901_0264914
976 Ga0436365_0184325
977 Ga0436365_0731400
978 Ga0436365_0856475
979 Ga0436365_0861404
980 Ga0436363_1384809
981 Ga0451837_1102736
982 Ga0451839_0078825
983 Ga0439432_028844
984 Ga0451577_0003137
985 Ga0466966_0027370
986 Ga0466961_0021598
987 Ga0466961_0078626
988 Ga0453684_0297918
989 Ga0495592_0015572
990 Ga0495592_0079749
991 Ga0495592_0099608
992 Ga0495592_0132645
993 Ga0495603_0001625
994 Ga0495638_0039418
995 Ga0495638_0142545
996 Ga0495641_0003067
997 Ga0495641_0005171
998 Ga0495641_0021762
999 Ga0495651_0031545
1000 Ga0495653_0057445
1001 Ga0495653_0077375
1002 Ga0495653_0105826
1003 Ga0495582_0019097
1004 Ga0495639_0001386
1005 Ga0495585_0000087
1006 Ga0495594_0006393
1007 Ga0495594_0100267
1008 Ga0495606_0080820
1009 Ga0495608_0077399
1010 Ga0495616_0000180
1011 Ga0495618_0013357
1012 Ga0495618_0029744
1013 Ga0495618_0046749
1014 Ga0495620_0042348
1015 Ga0495628_0002875
1016 Ga0495628_0003313
1017 Ga0495628_0120951
1018 Ga0495630_0059637
1019 Ga0495666_0071406
1020 Ga0495652_0002012
1021 Ga0495652_0008854
1022 Ga0495652_0036368
1023 Ga0495654_0032452
1024 Ga0495665_0099269
1025 Ga0495586_0219448
1026 Ga0495587_0005677
1027 Ga0495597_0000116
1028 Ga0495597_0039236
1029 Ga0495645_0045218
1030 Ga0495645_0064867
1031 Ga0495667_0012429
1032 Ga0495668_0005343
1033 Ga0495634_0002865
1034 Ga0495634_0009318
1035 Ga0495625_0006910
1036 Ga0495625_0021996
1037 Ga0495635_0011974
1038 Ga0495635_0254221
1039 Ga0495588_0211005
1040 Ga0495657_0001718
1041 Ga0495657_0016827
1042 Ga0495657_0169452
1043 Ga0495623_0000229
1044 Ga0495646_0032282
1045 Ga0495646_0034002
1046 Ga0495658_0038772
1047 Ga0495613_0000711
1048 Ga0495613_0028817
1049 Ga0495624_0010281
1050 Ga0495624_0012873
1051 Ga0495624_0107525
1052 Ga0495670_0009952
1053 Ga0495649_0129599
1054 Ga0495589_0000343
1055 Ga0495600_0012414
1056 Ga0495600_0020316
1057 Ga0495600_0074812
1058 Ga0495660_0000004
1059 Ga0495604_0016267
1060 Ga0495604_0016383
1061 Ga0495604_0079398
1062 Ga0495674_0013201
1063 Ga0495674_0045392
1064 Ga0495676_0001579
1065 Ga0495676_0009962
1066 Ga0495676_0031414
1067 Ga0495676_0035672
1068 Ga0495680_0097053
1069 Ga0495679_000051
1070 Ga0495684_0023399
1071 Ga0495684_0032668
1072 Ga0495686_0000086
1073 Ga0495602_0002021
1074 Ga0495602_0010888
1075 Ga0495602_0030668
1076 Ga0495602_0084897
1077 Ga0495602_0150821
1078 Ga0495614_0014678
1079 Ga0495614_0044196
1080 Ga0495626_0000020
1081 Ga0496101_0099938
1082 Ga0496101_0229510
1083 Ga0496102_0000015
1084 Ga0496102_0032328
1085 Ga0496103_0000020
1086 Ga0496103_0013685
1087 Ga0496104_0001350
1088 Ga0496104_0001986
1089 Ga0496104_0145325
1090 Ga0496104_0811257
1091 Ga0496105_0039646
1092 Ga0496106_0095222
1093 Ga0496106_0317442
1094 Ga0496108_0167660
1095 Ga0496108_0453710
1096 Ga0496109_0037962
1097 Ga0496109_0127048
1098 Ga0496110_0020179
1099 Ga0496110_0070746
1100 Ga0496110_0086039
1101 Ga0496110_0159594
1102 Ga0496111_0024198
1103 Ga0496111_0079079
1104 Ga0496112_0094359
1105 Ga0496113_0317919
1106 Ga0496114_0052133
1107 Ga0496114_0167033
1108 Ga0496116_0000139
1109 Ga0496116_0000225
1110 Ga0496117_0000047
1111 Ga0496117_0007320
1112 Ga0496118_0000048
1113 Ga0496118_0000050
1114 Ga0496118_0000106
1115 Ga0496118_0005524
1116 Ga0496118_0150179
1117 Ga0496119_0003127
1118 Ga0496119_0004021
1119 Ga0496120_0002550
1120 Ga0496120_0009848
1121 Ga0496121_0000190
1122 Ga0496121_0018165
1123 Ga0496121_0033640
1124 Ga0496121_0047815
1125 Ga0496121_0131593
1126 Ga0496122_0000007
1127 Ga0496122_0000539
1128 Ga0496122_0013317
1129 Ga0496122_0015145
1130 Ga0496123_0000004
1131 Ga0496123_0000380
1132 Ga0496123_0000509
1133 Ga0496123_0005095
1134 Ga0496123_0125271
1135 Ga0496124_0000425
1136 Ga0496124_0004420
1137 Ga0496124_0007672
1138 Ga0496124_0016723
1139 Ga0496124_0229509
1140 Ga0496125_0000013
1141 Ga0496125_0000038
1142 Ga0496125_0004360
1143 Ga0496125_0016504
1144 Ga0496125_0023313
1145 Ga0496125_0059913
1146 Ga0496126_0000049
1147 Ga0496126_0000358
1148 Ga0496126_0003079
1149 Ga0496126_0015813
1150 Ga0496126_0056234
1151 Ga0496126_0094269
1152 Ga0496126_0222817
1153 Ga0501300_000369
1154 Ga0501033_0007683
1155 Ga0501034_0008322
1156 Ga0501034_0245379
1157 Ga0501034_0291782
1158 Ga0501036_0109741
1159 Ga0501037_0139871
1160 Ga0501043_0013552
1161 Ga0501043_0023822
1162 Ga0501046_0019676
1163 Ga0501046_0166906
1164 Ga0501047_0003897
1165 Ga0501047_0007227
1166 Ga0501048_0047571
1167 Ga0501068_0103348
1168 Ga0501070_0144253
1169 Ga0501079_0194312
1170 Ga0501080_0012958
1171 Ga0501280_005218
1172 Ga0501035_0002524
1173 Ga0501044_0030358
1174 nmdc:mga03683_320_c1
1175 nmdc:mga03n38_22667_c1
1176 nmdc:mga00v17_12172_c1
1177 nmdc:mga00v17_44659_c1
1178 nmdc:mga0yw44_112547_c1
1179 nmdc:mga0k408_37918_c1
1180 nmdc:mga06z11_3286_c1
1181 nmdc:mga07m45_2296_c1
1182 nmdc:mga07m45_8920_c1
1183 nmdc:mga0n895_158070_c1
1184 nmdc:mga0n895_612110_c1
1185 nmdc:mga0rr50_14608_c1
1186 nmdc:mga08x19_77065_c1
1187 Ga0495601_0008529
1188 Ga0495612_0014764
1189 Ga0500641_0024474
1190 Ga0500555_001112
1191 Ga0500607_000690
1192 Ga0500568_0003896
1193 Ga0500588_0005979
1194 Ga0500616_0002329
1195 Ga0500645_000658
1196 Ga0501084_0122190
1197 Ga0500661_017542
1198 Ga0590075_024138
1199 2509376630
1200 2514018136
1201 2547406275
1202 2558864009
1203 2587742619
1204 2599326382
1205 2603702908
1206 2603866785
1207 2616700937
1208 2643736290
1209 2644090131
1210 2644319975
1211 2644667397
1212 2671108619
1213 2719637303
1214 2738697972
1215 2739207168
1216 2757565058
1217 2765584082
1218 2791916549
1219 2809143586
1220 2821113042
1221 2831428900
1222 2841862680
1223 2842519802
1224 2842697315
1225 2848697369
1226 2849667816
1227 2850081629
1228 2855734972
1229 2855770756
1230 2870625083
1231 2873319062
1232 2886630996
1233 2889045501
1234 2897562976
1235 2904164754
1236 2904475686
1237 2904492373
1238 2904772041
1239 2913914913
1240 2913943513
1241 2915651959
1242 2919151855
1243 2919161515
1244 2919161597
1245 2919422060
1246 2919434382
1247 2927144524
1248 2931388934
1249 2933011907
1250 2933598677
1251 2935647785
1252 2935666840
1253 2935837269
1254 2945992494
1255 2946055243
1256 2946055326
1257 2984559063
1258 2984589032
1259 2988228121
1260 2993357617
1261 8054934608
1262 8056451506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

360

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9381 1 327
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9287 1 321
4ast-assembly1.cif.gz_G the apo structure of a bacterial aldo-keto reductase akr14a1 0.9252 1 321
4ast-assembly1.cif.gz_H the apo structure of a bacterial aldo-keto reductase akr14a1 0.925 1 320
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9248 1 321
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9868 1 329 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9838 1 329 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9498 1 325 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9301 1 325 3.20.20.100
af_G2TRN6_1_317_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9217 23 323 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A517CU99-F1-model_v4 deleted 0.9986 1 331
AF-A0A0W0PK91-F1-model_v4 deleted 0.9979 1 331
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9944 1 217 GO:0005829
GO:0016491
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9931 118 218 GO:0005829
GO:0016491
AF-A0A529HD53-F1-model_v4 Aldo/keto reductase 0.9901 101 226 GO:0005829
GO:0016491

Map