F470619

General Info

Members Datasets Scaffolds Average Seq Length
628 305 1256 159

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100114558|Ga0070683_1001145582
Length 181
Sequence MVASAARVRHNPRFRTSQVMVMPSFDTVSELNAHEVANAVDQANRELGQRFDFKDTGAVFELEEFTVKMRAQVEFQLKQMLEILKLRLSKRGIDLSCLEVKDPVVNLAAAVQDVVLKQGIDQEIGKKLVRIIKDSKLKVQASMQGDKVRVTGKSRDDLQSAIQLLRASKVEMPLQFNNFRD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
216 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
296 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
297 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
298 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
304 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
305 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.16
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0
Rhizoplane 5.1
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100114558 3300005329 Bacteria 2544
2 JGI24750J21931_1011950 3300002070 Unclassified 1146
3 JGI24742J22300_10077035 3300002244 Bacteria 627
4 JGI25406J46586_10007823 3300003203 Bacteria 4862
5 Ga0065704_10188060 3300005289 Bacteria 1203
6 Ga0065707_10081964 3300005295 Bacteria 27001
7 Ga0070676_10213937 3300005328 Bacteria 1270
8 Ga0070683_100611616 3300005329 Bacteria 1043
9 Ga0070690_100001718 3300005330 Bacteria 11553
10 Ga0070690_100450478 3300005330 Unclassified 954
11 Ga0070670_100106673 3300005331 Bacteria 2414
12 Ga0070677_10001619 3300005333 Bacteria 7120
13 Ga0070677_10026094 3300005333 Bacteria 2188
14 Ga0068869_100028799 3300005334 Bacteria 3885
15 Ga0068869_100130355 3300005334 Bacteria 1932
16 Ga0070666_10004699 3300005335 Bacteria 8345
17 Ga0070666_10040128 3300005335 Bacteria 3123
18 Ga0070666_10461355 3300005335 Bacteria 918
19 Ga0070680_100107958 3300005336 Bacteria 2315
20 Ga0070680_100108758 3300005336 Bacteria 2307
21 Ga0070682_100079295 3300005337 Bacteria 2120
22 Ga0070682_100175776 3300005337 Bacteria 1491
23 Ga0068868_100008181 3300005338 Bacteria 7482
24 Ga0070689_100119703 3300005340 Bacteria 2102
25 Ga0070689_100270157 3300005340 Bacteria 1407
26 Ga0070689_100284458 3300005340 Bacteria 1373
27 Ga0070687_100252638 3300005343 Bacteria 1096
28 Ga0070661_100066944 3300005344 Bacteria 2639
29 Ga0070661_100700325 3300005344 Unclassified 825
30 Ga0070692_10228360 3300005345 Bacteria 1104
31 Ga0070668_100732146 3300005347 Bacteria 874
32 Ga0070669_100162066 3300005353 Bacteria 1738
33 Ga0070669_100188535 3300005353 Bacteria 1617
34 Ga0070669_101064022 3300005353 Bacteria 696
35 Ga0070675_100142946 3300005354 Bacteria 2046
36 Ga0070675_100253180 3300005354 Bacteria 1542
37 Ga0070675_100311748 3300005354 Bacteria 1388
38 Ga0070671_100009823 3300005355 Bacteria 7680
39 Ga0070671_100041007 3300005355 Bacteria 3846
40 Ga0070671_100399834 3300005355 Bacteria 1175
41 Ga0070674_100064797 3300005356 Bacteria 2562
42 Ga0070674_100261119 3300005356 Bacteria 1364
43 Ga0070673_100055774 3300005364 Bacteria 3115
44 Ga0070673_100070710 3300005364 Bacteria 2801
45 Ga0070659_100508760 3300005366 Bacteria 1027
46 Ga0070667_100000011 3300005367 Bacteria 269772
47 Ga0070667_100028928 3300005367 Bacteria 4614
48 Ga0070667_100066887 3300005367 Bacteria 3054
49 Ga0070667_100172119 3300005367 Bacteria 1912
50 Ga0070667_100300565 3300005367 Bacteria 1445
51 Ga0070667_101182702 3300005367 Bacteria 716
52 Ga0070709_10014721 3300005434 Bacteria 4430
53 Ga0070709_10082383 3300005434 Bacteria 2102
54 Ga0070709_10479584 3300005434 Bacteria 941
55 Ga0070714_100005056 3300005435 Bacteria 10031
56 Ga0070714_100088056 3300005435 Bacteria 2716
57 Ga0070713_100002957 3300005436 Bacteria 11153
58 Ga0070713_100044091 3300005436 Bacteria 3649
59 Ga0070713_100116217 3300005436 Bacteria 2339
60 Ga0070713_100994505 3300005436 Bacteria 809
61 Ga0070710_10011721 3300005437 Bacteria 4337
62 Ga0070710_10391763 3300005437 Bacteria 929
63 Ga0070701_10012758 3300005438 Bacteria 3798
64 Ga0070701_10129937 3300005438 Bacteria 1430
65 Ga0070701_10208987 3300005438 Bacteria 1158
66 Ga0070711_100006013 3300005439 Bacteria 7288
67 Ga0070711_100069036 3300005439 Bacteria 2485
68 Ga0070711_100528820 3300005439 Bacteria 976
69 Ga0070711_100929242 3300005439 Bacteria 744
70 Ga0070705_100011013 3300005440 Bacteria 4547
71 Ga0070705_100017641 3300005440 Bacteria 3728
72 Ga0070705_100438218 3300005440 Bacteria 977
73 Ga0070700_100041285 3300005441 Bacteria 2827
74 Ga0070700_100055959 3300005441 Bacteria 2471
75 Ga0070700_100697348 3300005441 Bacteria 807
76 Ga0070694_100093419 3300005444 Bacteria 2115
77 Ga0070694_100459918 3300005444 Bacteria 1006
78 Ga0070663_100484768 3300005455 Bacteria 1024
79 Ga0070678_100037207 3300005456 Bacteria 3415
80 Ga0070678_100556265 3300005456 Bacteria 1019
81 Ga0070662_101435202 3300005457 Bacteria 595
82 Ga0070681_10150078 3300005458 Bacteria 2257
83 Ga0070681_10150826 3300005458 Bacteria 2251
84 Ga0068867_100117370 3300005459 Bacteria 2052
85 Ga0068867_100290931 3300005459 Bacteria 1343
86 Ga0068867_100392234 3300005459 Bacteria 1169
87 Ga0068867_100647447 3300005459 Bacteria 927
88 Ga0070685_10031918 3300005466 Bacteria 2947
89 Ga0070685_10312008 3300005466 Bacteria 1063
90 Ga0070685_10317954 3300005466 Bacteria 1054
91 Ga0070685_10687359 3300005466 Bacteria 745
92 Ga0070698_100043297 3300005471 Unclassified 4616
93 Ga0070699_100037910 3300005518 Bacteria 4173
94 Ga0070699_100826351 3300005518 Bacteria 848
95 Ga0070679_100043004 3300005530 Bacteria 4499
96 Ga0070679_100405863 3300005530 Bacteria 1308
97 Ga0070684_100054831 3300005535 Bacteria 3473
98 Ga0070684_100150528 3300005535 Bacteria 2108
99 Ga0070672_100005412 3300005543 Bacteria 8458
100 Ga0070672_100010380 3300005543 Bacteria 6460
101 Ga0070672_100196452 3300005543 Bacteria 1686
102 Ga0070672_100276885 3300005543 Bacteria 1418
103 Ga0070686_100022369 3300005544 Bacteria 3765
104 Ga0070686_100056021 3300005544 Bacteria 2527
105 Ga0070686_100368507 3300005544 Bacteria 1084
106 Ga0070695_100019343 3300005545 Bacteria 4146
107 Ga0070695_100321663 3300005545 Bacteria 1150
108 Ga0070693_100051683 3300005547 Bacteria 2354
109 Ga0070693_100169712 3300005547 Bacteria 1396
110 Ga0070665_100001687 3300005548 Bacteria 25457
111 Ga0070665_100006965 3300005548 Bacteria 11494
112 Ga0070665_100007026 3300005548 Bacteria 11438
113 Ga0070665_100031335 3300005548 Bacteria 5351
114 Ga0070665_100186023 3300005548 Bacteria 2078
115 Ga0070665_100360717 3300005548 Unclassified 1459
116 Ga0070704_100209427 3300005549 Bacteria 1579
117 Ga0070704_101635986 3300005549 Bacteria 594
118 Ga0068855_100001279 3300005563 Bacteria 31174
119 Ga0068855_100355826 3300005563 Bacteria 1612
120 Ga0068855_101508108 3300005563 Bacteria 690
121 Ga0070664_100657619 3300005564 Bacteria 974
122 Ga0068854_101802215 3300005578 Bacteria 561
123 Ga0068856_100002595 3300005614 Bacteria 18601
124 Ga0068856_100111359 3300005614 Bacteria 2735
125 Ga0070702_100037285 3300005615 Bacteria 2699
126 Ga0068859_100059209 3300005617 Bacteria 3859
127 Ga0068859_100371086 3300005617 Unclassified 1526
128 Ga0068859_101843040 3300005617 Bacteria 668
129 Ga0068864_100111331 3300005618 Bacteria 2439
130 Ga0068864_100513988 3300005618 Bacteria 1154
131 Ga0068866_10086563 3300005718 Bacteria 1696
132 Ga0068861_100007228 3300005719 Bacteria 7607
133 Ga0068861_100188898 3300005719 Bacteria 1721
134 Ga0068861_100418397 3300005719 Unclassified 1193
135 Ga0068870_10002484 3300005840 Bacteria 7692
136 Ga0068870_10211848 3300005840 Bacteria 1181
137 Ga0068863_100002979 3300005841 Bacteria 16748
138 Ga0068863_100023812 3300005841 Bacteria 5844
139 Ga0068863_100190932 3300005841 Unclassified 1968
140 Ga0068863_100298840 3300005841 Bacteria 1561
141 Ga0068858_100005149 3300005842 Bacteria 12811
142 Ga0068858_100014520 3300005842 Bacteria 7420
143 Ga0068858_100130605 3300005842 Bacteria 2355
144 Ga0068858_100249642 3300005842 Bacteria 1685
145 Ga0068858_101083163 3300005842 Bacteria 786
146 Ga0068860_100010920 3300005843 Bacteria 8953
147 Ga0068860_100021903 3300005843 Bacteria 6183
148 Ga0068860_100078183 3300005843 Bacteria 3147
149 Ga0068862_100058443 3300005844 Bacteria 3308
150 Ga0068862_100080225 3300005844 Bacteria 2829
151 Ga0068862_100173493 3300005844 Bacteria 1931
152 Ga0068862_100379892 3300005844 Bacteria 1317
153 Ga0081539_10000055 3300005985 Bacteria 257359
154 Ga0070717_10004372 3300006028 Bacteria 10195
155 Ga0070715_10001448 3300006163 Bacteria 6880
156 Ga0070715_10111717 3300006163 Bacteria 1290
157 Ga0070715_10149164 3300006163 Bacteria 1144
158 Ga0070715_10427377 3300006163 Bacteria 742
159 Ga0070716_100022234 3300006173 Bacteria 3348
160 Ga0070716_100042426 3300006173 Bacteria 2540
161 Ga0070716_100051532 3300006173 Bacteria 2340
162 Ga0070712_100001982 3300006175 Bacteria 12540
163 Ga0097621_100002893 3300006237 Bacteria 11786
164 Ga0097621_100004031 3300006237 Bacteria 10186
165 Ga0097621_100007605 3300006237 Bacteria 7766
166 Ga0097621_100044587 3300006237 Bacteria 3578
167 Ga0097621_100085851 3300006237 Bacteria 2626
168 Ga0097621_100355650 3300006237 Bacteria 1303
169 Ga0075370_10028236 3300006353 Bacteria 3118
170 Ga0068871_100004778 3300006358 Bacteria 9470
171 Ga0068871_100048275 3300006358 Bacteria 3436
172 Ga0068871_100101878 3300006358 Bacteria 2406
173 Ga0068871_100125486 3300006358 Bacteria 2172
174 Ga0075428_101278525 3300006844 Bacteria 772
175 Ga0075433_10261445 3300006852 Bacteria 1534
176 Ga0068865_100007820 3300006881 Bacteria 6596
177 Ga0068865_100337541 3300006881 Bacteria 1217
178 Ga0097620_100059208 3300006931 Bacteria 3859
179 Ga0097620_100371089 3300006931 Unclassified 1526
180 Ga0097620_101461031 3300006931 Bacteria 754
181 Ga0097620_101843083 3300006931 Bacteria 668
182 Ga0075435_100078467 3300007076 Bacteria 2708
183 Ga0075435_100243403 3300007076 Bacteria 1530
184 Ga0105250_10092442 3300009092 Bacteria 1231
185 Ga0105240_10024084 3300009093 Bacteria 8037
186 Ga0105240_10056702 3300009093 Bacteria 4901
187 Ga0105240_10146182 3300009093 Bacteria 2820
188 Ga0105240_10168081 3300009093 Unclassified 2600
189 Ga0105240_10387916 3300009093 Bacteria 1576
190 Ga0111539_10123434 3300009094 Bacteria 3035
191 Ga0105245_10014403 3300009098 Bacteria 6889
192 Ga0105245_12040199 3300009098 Bacteria 627
193 Ga0105247_10002776 3300009101 Bacteria 11724
194 Ga0105247_10006388 3300009101 Bacteria 7296
195 Ga0105247_10073219 3300009101 Bacteria 2146
196 Ga0105247_10092493 3300009101 Bacteria 1921
197 Ga0105243_10232014 3300009148 Bacteria 1638
198 Ga0105241_10046774 3300009174 Bacteria 3287
199 Ga0105241_10052850 3300009174 Bacteria 3104
200 Ga0105241_10688534 3300009174 Bacteria 932
201 Ga0105242_10000894 3300009176 Bacteria 23159
202 Ga0105242_10023298 3300009176 Bacteria 4880
203 Ga0105242_10769127 3300009176 Bacteria 950
204 Ga0105248_10009456 3300009177 Bacteria 10731
205 Ga0105248_10065102 3300009177 Bacteria 4092
206 Ga0105248_10070718 3300009177 Bacteria 3919
207 Ga0105248_10247671 3300009177 Bacteria 2006
208 Ga0105237_10009386 3300009545 Bacteria 10480
209 Ga0105237_10040756 3300009545 Bacteria 4683
210 Ga0105237_10159095 3300009545 Bacteria 2256
211 Ga0105237_11193726 3300009545 Unclassified 767
212 Ga0105238_10116532 3300009551 Bacteria 2651
213 Ga0105238_10223741 3300009551 Bacteria 1858
214 Ga0105238_11199424 3300009551 Bacteria 783
215 Ga0105249_10118161 3300009553 Bacteria 2516
216 Ga0105249_10137543 3300009553 Bacteria 2339
217 Ga0105249_10297054 3300009553 Bacteria 1619
218 Ga0105249_10475798 3300009553 Bacteria 1291
219 Ga0105249_11714327 3300009553 Unclassified 701
220 Ga0105239_10027633 3300010375 Bacteria 6243
221 Ga0105239_10054026 3300010375 Bacteria 4405
222 Ga0105246_10315987 3300011119 Bacteria 1267
223 Ga0105246_10931890 3300011119 Bacteria 781
224 Ga0157374_10055348 3300013296 Bacteria 3702
225 Ga0157374_10455268 3300013296 Bacteria 1281
226 Ga0157374_10599132 3300013296 Bacteria 1112
227 Ga0157378_10021679 3300013297 Bacteria 5649
228 Ga0163162_10138314 3300013306 Bacteria 2547
229 Ga0163162_10155934 3300013306 Unclassified 2403
230 Ga0163162_10176688 3300013306 Bacteria 2261
231 Ga0157372_10228518 3300013307 Bacteria 2157
232 Ga0157372_13058045 3300013307 Bacteria 534
233 Ga0157375_10008581 3300013308 Bacteria 8947
234 Ga0157375_10131562 3300013308 Bacteria 2622
235 Ga0157375_10275746 3300013308 Bacteria 1844
236 Ga0163163_10016247 3300014325 Bacteria 6910
237 Ga0163163_10089867 3300014325 Bacteria 3084
238 Ga0163163_10148497 3300014325 Bacteria 2388
239 Ga0163163_10169945 3300014325 Bacteria 2227
240 Ga0163163_10268491 3300014325 Bacteria 1757
241 Ga0163163_10326977 3300014325 Unclassified 1587
242 Ga0163163_10739649 3300014325 Bacteria 1047
243 Ga0157380_10005671 3300014326 Bacteria 8732
244 Ga0157380_10130488 3300014326 Bacteria 2143
245 Ga0157380_10311833 3300014326 Bacteria 1454
246 Ga0157380_10582148 3300014326 Bacteria 1104
247 Ga0157379_10033762 3300014968 Bacteria 4564
248 Ga0157379_10064559 3300014968 Bacteria 3272
249 Ga0157379_10075542 3300014968 Bacteria 3017
250 Ga0157379_10111463 3300014968 Bacteria 2457
251 Ga0157379_10125014 3300014968 Bacteria 2314
252 Ga0157379_10283207 3300014968 Bacteria 1508
253 Ga0157379_10314679 3300014968 Bacteria 1429
254 Ga0157379_11437178 3300014968 Unclassified 669
255 Ga0157376_10004323 3300014969 Bacteria 9871
256 Ga0157376_10120786 3300014969 Bacteria 2322
257 Ga0157376_10164780 3300014969 Bacteria 2013
258 Ga0157376_10296120 3300014969 Bacteria 1530
259 Ga0157376_10578461 3300014969 Bacteria 1115
260 Ga0163161_10041798 3300017792 Bacteria 3295
261 Ga0163161_10073388 3300017792 Bacteria 2507
262 Ga0163161_11717852 3300017792 Bacteria 556
263 Ga0213874_10007168 3300021377 Bacteria 2666
264 Ga0213871_10102048 3300021441 Unclassified 840
265 Ga0207682_10001277 3300025893 Bacteria 11561
266 Ga0207682_10001747 3300025893 Bacteria 9971
267 Ga0207692_10007578 3300025898 Bacteria 4450
268 Ga0207692_10922195 3300025898 Bacteria 575
269 Ga0207642_10915855 3300025899 Bacteria 562
270 Ga0207710_10000989 3300025900 Bacteria 14887
271 Ga0207710_10141838 3300025900 Bacteria 1160
272 Ga0207688_10096365 3300025901 Bacteria 1704
273 Ga0207688_10447851 3300025901 Bacteria 805
274 Ga0207680_10053183 3300025903 Bacteria 2430
275 Ga0207680_10438721 3300025903 Bacteria 926
276 Ga0207685_10004176 3300025905 Bacteria 3633
277 Ga0207685_10191916 3300025905 Bacteria 954
278 Ga0207685_10215338 3300025905 Bacteria 910
279 Ga0207685_10233587 3300025905 Bacteria 881
280 Ga0207699_10145040 3300025906 Bacteria 1564
281 Ga0207699_10240235 3300025906 Bacteria 1244
282 Ga0207699_10449222 3300025906 Bacteria 924
283 Ga0207643_10001199 3300025908 Bacteria 15312
284 Ga0207643_10048448 3300025908 Bacteria 2407
285 Ga0207654_10231571 3300025911 Bacteria 1231
286 Ga0207707_10031192 3300025912 Bacteria 4663
287 Ga0207707_10057677 3300025912 Bacteria 3380
288 Ga0207707_10132798 3300025912 Bacteria 2177
289 Ga0207707_10211193 3300025912 Bacteria 1690
290 Ga0207695_10000395 3300025913 Bacteria 98285
291 Ga0207695_10006944 3300025913 Bacteria 14538
292 Ga0207695_10028788 3300025913 Bacteria 6151
293 Ga0207695_10272242 3300025913 Bacteria 1589
294 Ga0207695_10343598 3300025913 Unclassified 1380
295 Ga0207671_10035994 3300025914 Unclassified 3671
296 Ga0207671_10129689 3300025914 Bacteria 1934
297 Ga0207671_10315540 3300025914 Bacteria 1236
298 Ga0207693_10000343 3300025915 Bacteria 42997
299 Ga0207693_10022858 3300025915 Bacteria 4964
300 Ga0207663_10222519 3300025916 Bacteria 1374
301 Ga0207663_10646873 3300025916 Bacteria 834
302 Ga0207660_10024054 3300025917 Bacteria 4120
303 Ga0207660_10424771 3300025917 Bacteria 1072
304 Ga0207662_10364475 3300025918 Bacteria 973
305 Ga0207649_10073046 3300025920 Bacteria 2196
306 Ga0207649_10422003 3300025920 Unclassified 1002
307 Ga0207652_10100252 3300025921 Bacteria 2557
308 Ga0207652_10183876 3300025921 Bacteria 1879
309 Ga0207652_10356903 3300025921 Bacteria 1319
310 Ga0207694_10322973 3300025924 Bacteria 1274
311 Ga0207659_10081321 3300025926 Bacteria 2395
312 Ga0207659_10178646 3300025926 Bacteria 1680
313 Ga0207659_11602755 3300025926 Bacteria 556
314 Ga0207687_10996590 3300025927 Bacteria 718
315 Ga0207700_10030174 3300025928 Bacteria 3836
316 Ga0207700_10053554 3300025928 Bacteria 3024
317 Ga0207664_10010005 3300025929 Bacteria 6683
318 Ga0207664_10060321 3300025929 Unclassified 3023
319 Ga0207664_10334603 3300025929 Bacteria 1338
320 Ga0207644_10018906 3300025931 Bacteria 4670
321 Ga0207690_11184249 3300025932 Bacteria 638
322 Ga0207706_10166944 3300025933 Bacteria 1934
323 Ga0207686_10011191 3300025934 Bacteria 4906
324 Ga0207686_10198771 3300025934 Bacteria 1434
325 Ga0207709_10271256 3300025935 Bacteria 1249
326 Ga0207709_11120620 3300025935 Bacteria 646
327 Ga0207670_10034959 3300025936 Bacteria 3254
328 Ga0207670_10092327 3300025936 Bacteria 2143
329 Ga0207670_10685291 3300025936 Bacteria 847
330 Ga0207670_11488588 3300025936 Bacteria 575
331 Ga0207669_10078364 3300025937 Bacteria 2105
332 Ga0207669_10108569 3300025937 Bacteria 1853
333 Ga0207704_10071935 3300025938 Bacteria 2196
334 Ga0207704_10416086 3300025938 Bacteria 1065
335 Ga0207704_10980835 3300025938 Bacteria 714
336 Ga0207665_10011292 3300025939 Bacteria 5862
337 Ga0207665_10263029 3300025939 Bacteria 1279
338 Ga0207691_10005856 3300025940 Bacteria 11884
339 Ga0207691_10088316 3300025940 Bacteria 2780
340 Ga0207691_10097546 3300025940 Unclassified 2627
341 Ga0207691_10107530 3300025940 Bacteria 2483
342 Ga0207691_10736527 3300025940 Bacteria 830
343 Ga0207711_10044802 3300025941 Bacteria 3778
344 Ga0207711_10168512 3300025941 Unclassified 1986
345 Ga0207711_10174927 3300025941 Unclassified 1950
346 Ga0207711_10536914 3300025941 Bacteria 1091
347 Ga0207689_10192414 3300025942 Bacteria 1683
348 Ga0207689_10232181 3300025942 Bacteria 1525
349 Ga0207689_10291022 3300025942 Bacteria 1353
350 Ga0207661_10553017 3300025944 Bacteria 1054
351 Ga0207667_10001150 3300025949 Bacteria 33284
352 Ga0207667_10307756 3300025949 Bacteria 1619
353 Ga0207667_11264526 3300025949 Unclassified 715
354 Ga0207651_10574881 3300025960 Bacteria 982
355 Ga0207712_10073199 3300025961 Unclassified 2470
356 Ga0207712_10226586 3300025961 Bacteria 1498
357 Ga0207712_10577428 3300025961 Bacteria 970
358 Ga0207640_11498546 3300025981 Bacteria 606
359 Ga0207658_10000046 3300025986 Bacteria 130772
360 Ga0207658_10096054 3300025986 Bacteria 2310
361 Ga0207658_10108840 3300025986 Bacteria 2187
362 Ga0207658_10530773 3300025986 Bacteria 1051
363 Ga0207677_10019753 3300026023 Bacteria 4076
364 Ga0207703_10072353 3300026035 Bacteria 2850
365 Ga0207703_10230228 3300026035 Bacteria 1661
366 Ga0207703_10285707 3300026035 Bacteria 1500
367 Ga0207703_10412481 3300026035 Unclassified 1255
368 Ga0207703_10909162 3300026035 Bacteria 843
369 Ga0207703_11579776 3300026035 Bacteria 631
370 Ga0207678_10230506 3300026067 Bacteria 1586
371 Ga0207678_10445702 3300026067 Bacteria 1125
372 Ga0207708_10013607 3300026075 Bacteria 6079
373 Ga0207708_10071658 3300026075 Bacteria 2655
374 Ga0207702_10136602 3300026078 Bacteria 2213
375 Ga0207702_10288071 3300026078 Bacteria 1555
376 Ga0207641_10050898 3300026088 Bacteria 3506
377 Ga0207641_10137382 3300026088 Bacteria 2202
378 Ga0207641_10148632 3300026088 Unclassified 2120
379 Ga0207641_10291133 3300026088 Bacteria 1539
380 Ga0207641_10350605 3300026088 Bacteria 1407
381 Ga0207641_11350796 3300026088 Bacteria 713
382 Ga0207648_10114246 3300026089 Bacteria 2372
383 Ga0207648_10234347 3300026089 Bacteria 1633
384 Ga0207648_10422167 3300026089 Bacteria 1211
385 Ga0207676_10092953 3300026095 Bacteria 2482
386 Ga0207676_10157965 3300026095 Bacteria 1961
387 Ga0207675_100008752 3300026118 Bacteria 9508
388 Ga0207675_100022186 3300026118 Bacteria 5911
389 Ga0207675_100031077 3300026118 Bacteria 4973
390 Ga0207675_100236779 3300026118 Bacteria 1763
391 Ga0207675_100425526 3300026118 Bacteria 1312
392 Ga0207675_102170718 3300026118 Bacteria 571
393 Ga0207683_10007235 3300026121 Bacteria 9514
394 Ga0207683_10032910 3300026121 Bacteria 4504
395 Ga0207683_10465274 3300026121 Bacteria 1166
396 Ga0207683_10487978 3300026121 Bacteria 1137
397 Ga0209974_10022040 3300027876 Bacteria 2108
398 Ga0268266_10000702 3300028379 Bacteria 45182
399 Ga0268266_10008042 3300028379 Bacteria 9425
400 Ga0268266_10023248 3300028379 Bacteria 5277
401 Ga0268266_10219100 3300028379 Bacteria 1748
402 Ga0268266_10255725 3300028379 Unclassified 1621
403 Ga0268266_10321368 3300028379 Bacteria 1449
404 Ga0268266_10832884 3300028379 Bacteria 891
405 Ga0268265_10115136 3300028380 Bacteria 2203
406 Ga0268265_10438972 3300028380 Bacteria 1216
407 Ga0268265_11137587 3300028380 Bacteria 776
408 Ga0268264_10120819 3300028381 Unclassified 2308
409 Ga0268264_10134623 3300028381 Bacteria 2195
410 Ga0268264_10705377 3300028381 Unclassified 1002
411 Ga0265319_1045117 3300028563 Bacteria 1475
412 Ga0307515_10008465 3300028794 Bacteria 20043
413 Ga0307515_10125499 3300028794 Bacteria 2871
414 Ga0307515_10150469 3300028794 Bacteria 2436
415 Ga0265338_10136500 3300028800 Bacteria 1927
416 Ga0307511_10001897 3300030521 Bacteria 21953
417 Ga0307511_10334597 3300030521 Bacteria 661
418 Ga0265762_1025559 3300030760 Bacteria 1102
419 Ga0265320_10084919 3300031240 Bacteria 1474
420 Ga0265340_10012150 3300031247 Bacteria 4551
421 Ga0265340_10064490 3300031247 Bacteria 1746
422 Ga0265339_10025281 3300031249 Bacteria 3409
423 Ga0265331_10258857 3300031250 Bacteria 780
424 Ga0307513_10027808 3300031456 Bacteria 6482
425 Ga0307513_10037971 3300031456 Bacteria 5353
426 Ga0307513_10060857 3300031456 Bacteria 4000
427 Ga0307513_10113902 3300031456 Bacteria 2691
428 Ga0307509_10000008 3300031507 Bacteria 354271
429 Ga0307408_100013520 3300031548 Bacteria 5418
430 Ga0307408_100277630 3300031548 Bacteria 1394
431 Ga0307508_10041977 3300031616 Bacteria 4105
432 Ga0316575_10011412 3300031665 Bacteria 3288
433 Ga0316579_10026750 3300031691 Bacteria 2614
434 Ga0316579_10300583 3300031691 Bacteria 776
435 Ga0316576_10090658 3300031727 Bacteria 2277
436 Ga0316578_10116357 3300031728 Bacteria 1606
437 Ga0307516_10000190 3300031730 Bacteria 79464
438 Ga0307405_10143659 3300031731 Bacteria 1668
439 Ga0316577_10048842 3300031733 Bacteria 2362
440 Ga0307413_10000239 3300031824 Bacteria 16377
441 Ga0307413_10125473 3300031824 Bacteria 1747
442 Ga0307410_10067880 3300031852 Bacteria 2461
443 Ga0307410_10474092 3300031852 Bacteria 1025
444 Ga0307406_10013346 3300031901 Bacteria 4706
445 Ga0307406_10776015 3300031901 Bacteria 807
446 Ga0307407_10162151 3300031903 Bacteria 1464
447 Ga0307407_10320913 3300031903 Bacteria 1087
448 Ga0307412_10118398 3300031911 Bacteria 1903
449 Ga0307412_11301651 3300031911 Bacteria 654
450 Ga0307409_100008479 3300031995 Bacteria 6243
451 Ga0307409_100809216 3300031995 Bacteria 945
452 Ga0307416_100036759 3300032002 Bacteria 3760
453 Ga0307411_10007506 3300032005 Bacteria 5563
454 Ga0307415_100009052 3300032126 Bacteria 5558
455 Ga0307415_100234645 3300032126 Bacteria 1480
456 Ga0307415_101686056 3300032126 Bacteria 611
457 Ga0316585_10002604 3300032137 Bacteria 4882
458 Ga0316585_10038888 3300032137 Bacteria 1511
459 Ga0373923_0043940 3300035111 Bacteria 1851
460 Ga0373936_0000391 3300035113 Bacteria 14885
461 Ga0373945_0063772 3300035116 Bacteria 1380
462 Ga0373954_0318332 3300035118 Bacteria 768
463 Ga0373956_0039429 3300035119 Bacteria 2094
464 Ga0373943_0114676 3300035170 Bacteria 1425
465 Ga0373955_0235549 3300035172 Bacteria 1096
466 Ga0316574_0027431 3300035398 Bacteria 3431
467 Ga0316574_0037873 3300035398 Bacteria 2959
468 Ga0316574_0039999 3300035398 Bacteria 2886
469 Ga0316574_0214467 3300035398 Bacteria 1235
470 Ga0373935_0192365 3300035692 Bacteria 1406
471 Ga0373927_0007466 3300035695 Bacteria 7394
472 Ga0373933_0076989 3300035724 Bacteria 2038
473 Ga0373933_0470452 3300035724 Bacteria 823
474 Ga0373937_0020774 3300036401 Bacteria 5889
475 Ga0373937_0064457 3300036401 Bacteria 3370
476 Ga0373937_0265966 3300036401 Bacteria 1618
477 Ga0373937_0802386 3300036401 Unclassified 889
478 Ga0373937_1654886 3300036401 Bacteria 587
479 Ga0316582_0056952 3300036647 Bacteria 2496
480 Ga0316582_0391225 3300036647 Bacteria 957
481 Ga0316584_0003035 3300036712 Bacteria 10812
482 Ga0316584_0104093 3300036712 Bacteria 2125
483 Ga0316584_0163244 3300036712 Bacteria 1654
484 Ga0373925_0275376 3300037068 Bacteria 1354
485 Ga0373925_0723919 3300037068 Bacteria 820
486 Ga0395898_0288797 3300037466 Bacteria 1564
487 Ga0316581_0074036 3300037588 Bacteria 1046
488 Ga0395901_0872164 3300038443 Bacteria 884
489 Ga0436365_0513051 3300039437 Bacteria 2964
490 Ga0436360_0009506 3300039438 Bacteria 600
491 Ga0436360_0144678 3300039438 Unclassified 882
492 Ga0436360_0362309 3300039438 Bacteria 4137
493 Ga0436360_0559362 3300039438 Bacteria 3484
494 Ga0436361_0091966 3300039447 Bacteria 606
495 Ga0436361_0288915 3300039447 Bacteria 2393
496 Ga0436361_0422010 3300039447 Bacteria 4240
497 Ga0436361_0597166 3300039447 Bacteria 857
498 Ga0436361_0872614 3300039447 Bacteria 716
499 Ga0436363_0128548 3300039450 Bacteria 1246
500 Ga0436363_0154486 3300039450 Bacteria 3200
501 Ga0436363_0484543 3300039450 Bacteria 2554
502 Ga0436363_0535276 3300039450 Bacteria 630
503 Ga0436363_1507501 3300039450 Bacteria 656
504 Ga0436363_1559932 3300039450 Bacteria 3746
505 Ga0436362_0055414 3300039453 Bacteria 779
506 Ga0451791_1226498 3300041451 Bacteria 749
507 Ga0451800_1393041 3300041459 Bacteria 1671
508 Ga0451802_0358418 3300041460 Bacteria 1879
509 Ga0451804_0426398 3300041463 Bacteria 653
510 Ga0451804_0992074 3300041463 Bacteria 655
511 Ga0451807_0931753 3300041486 Bacteria 1886
512 Ga0451807_1933992 3300041486 Bacteria 729
513 Ga0451853_2655596 3300041512 Bacteria 530
514 Ga0466969_0001621 3300044656 Bacteria 12053
515 Ga0466969_0008870 3300044656 Bacteria 5335
516 Ga0466966_0000352 3300044684 Bacteria 29833
517 Ga0466966_0225579 3300044684 Bacteria 1131
518 Ga0466966_0278019 3300044684 Bacteria 1007
519 Ga0466961_0001755 3300044693 Bacteria 13460
520 Ga0466961_0090268 3300044693 Bacteria 1935
521 Ga0466961_0325620 3300044693 Bacteria 937
522 Ga0466964_0000155 3300044706 Bacteria 18705
523 Ga0466971_0000333 3300044719 Bacteria 18049
524 Ga0466971_0277829 3300044719 Unclassified 801
525 Ga0466970_0000883 3300044765 Bacteria 14454
526 Ga0466959_0002160 3300045049 Bacteria 12495
527 Ga0466959_0012491 3300045049 Bacteria 6138
528 Ga0466959_0046927 3300045049 Bacteria 3179
529 Ga0466959_0073147 3300045049 Bacteria 2480
530 Ga0495592_0406063 3300046454 Bacteria 862
531 Ga0495638_0004744 3300046460 Bacteria 10254
532 Ga0495580_0017539 3300046472 Bacteria 5352
533 Ga0495580_0043039 3300046472 Bacteria 3215
534 Ga0495580_0060514 3300046472 Bacteria 2660
535 Ga0495639_0252821 3300046475 Bacteria 872
536 Ga0495594_0604875 3300046499 Bacteria 621
537 Ga0495596_0278700 3300046500 Bacteria 649
538 Ga0495607_0132536 3300046501 Bacteria 1295
539 Ga0495616_0098255 3300046513 Bacteria 1376
540 Ga0495618_0486636 3300046514 Bacteria 745
541 Ga0495630_0056452 3300046517 Bacteria 2943
542 Ga0495630_0782160 3300046517 Bacteria 729
543 Ga0495632_0101259 3300046519 Bacteria 1358
544 Ga0495644_0012657 3300046523 Bacteria 3244
545 Ga0495665_0231551 3300046531 Bacteria 954
546 Ga0495587_0126753 3300046536 Bacteria 1460
547 Ga0495587_0177988 3300046536 Bacteria 1207
548 Ga0495598_0002744 3300046537 Bacteria 3657
549 Ga0495621_0009721 3300046539 Bacteria 2929
550 Ga0495656_0085558 3300046615 Bacteria 1432
551 Ga0495656_0235773 3300046615 Bacteria 920
552 Ga0495625_0013679 3300046660 Bacteria 6508
553 Ga0495647_0005860 3300046681 Bacteria 4044
554 Ga0495647_0330897 3300046681 Bacteria 691
555 Ga0495658_0136200 3300046683 Unclassified 1498
556 Ga0495613_0549310 3300046689 Bacteria 773
557 Ga0495670_0095887 3300046691 Bacteria 1522
558 Ga0495671_0044580 3300046692 Bacteria 2223
559 Ga0495604_0176455 3300047317 Bacteria 1498
560 Ga0495674_0537851 3300047319 Bacteria 931
561 Ga0495687_025081 3300047443 Bacteria 2825
562 Ga0496100_0138608 3300048903 Bacteria 1721
563 Ga0496100_0156387 3300048903 Bacteria 1630
564 Ga0496101_0044522 3300048904 Bacteria 3176
565 Ga0496101_0134362 3300048904 Bacteria 1881
566 Ga0496101_0167611 3300048904 Bacteria 1687
567 Ga0496102_0011185 3300048905 Bacteria 7728
568 Ga0496102_0017816 3300048905 Bacteria 6227
569 Ga0496102_0327163 3300048905 Bacteria 1444
570 Ga0496103_0269024 3300048906 Bacteria 1096
571 Ga0496103_0517067 3300048906 Bacteria 763
572 Ga0496104_0183259 3300048907 Bacteria 2004
573 Ga0496104_0737156 3300048907 Bacteria 892
574 Ga0496105_0018162 3300048908 Bacteria 5646
575 Ga0496106_0009693 3300048909 Bacteria 7111
576 Ga0496106_0098167 3300048909 Bacteria 2269
577 Ga0496107_0004034 3300048910 Bacteria 9888
578 Ga0496107_0486084 3300048910 Bacteria 916
579 Ga0496108_0114569 3300048911 Bacteria 2308
580 Ga0496109_0145984 3300048912 Bacteria 2213
581 Ga0496110_0031567 3300048913 Bacteria 4571
582 Ga0496112_0006250 3300048915 Bacteria 10439
583 Ga0496113_0368067 3300048916 Unclassified 1153
584 Ga0496114_0013160 3300048917 Bacteria 6631
585 Ga0496115_0275067 3300048918 Bacteria 1383
586 Ga0496115_0315228 3300048918 Bacteria 1280
587 Ga0496118_0059706 3300048921 Bacteria 2837
588 Ga0496121_0085727 3300048924 Bacteria 2478
589 Ga0496125_0039821 3300048928 Unclassified 4040
590 Ga0496126_0003192 3300048929 Bacteria 21047
591 Ga0501033_0348923 3300049570 Bacteria 1037
592 Ga0501042_0534614 3300049578 Bacteria 852
593 Ga0501067_0008504 3300049583 Bacteria 5691
594 Ga0501068_0005402 3300049584 Bacteria 6989
595 Ga0501070_0141547 3300049586 Bacteria 1986
596 Ga0501073_0164106 3300049589 Bacteria 1538
597 Ga0501074_0083140 3300049590 Bacteria 2295
598 Ga0501077_0192550 3300049593 Bacteria 1295
599 Ga0501080_0363987 3300049742 Bacteria 1304
600 Ga0501083_0021566 3300049744 Bacteria 4475
601 nmdc:mga07m45_28596_c1 3300050496 Bacteria 3077
602 nmdc:mga07m45_653494_c1 3300050496 Bacteria 606
603 nmdc:mga0qj67_145220_c1 3300050509 Bacteria 1923
604 nmdc:mga0n895_413370_c1 3300050512 Bacteria 1364
605 nmdc:mga0rr50_56185_c1 3300050513 Bacteria 2940
606 nmdc:mga0rr50_818598_c1 3300050513 Bacteria 794
607 nmdc:mga08x19_44524_c1 3300050514 Bacteria 2833
608 nmdc:mga0a205_590042_c1 3300050515 Bacteria 965
609 Ga0495601_0418379 3300053077 Bacteria 868
610 Ga0500644_0050293 3300053088 Bacteria 1426
611 Ga0500556_0001428 3300053104 Bacteria 10205
612 Ga0500556_0115464 3300053104 Bacteria 1044
613 Ga0500595_011945 3300053119 Bacteria 3376
614 Ga0500658_0084174 3300053134 Bacteria 1365
615 Ga0500568_0003535 3300053139 Bacteria 8658
616 Ga0500568_0145202 3300053139 Bacteria 879
617 Ga0500577_0338621 3300053142 Bacteria 657
618 Ga0500622_0090621 3300053156 Bacteria 1517
619 Ga0500633_0253643 3300053160 Bacteria 653
620 Ga0500639_289106 3300053163 Bacteria 625
621 Ga0500637_0091760 3300053178 Bacteria 1759
622 Ga0501084_0171646 3300054114 Bacteria 1830
623 Ga0501082_0064000 3300060353 Bacteria 3167
624 Ga0466962_0000084 3300061719 Bacteria 37853
625 Ga0466962_0419684 3300061719 Bacteria 671
626 Ga0530510_1014233 3300061734 Bacteria 635
627 2894514382 2894510363 Bacteria 5121143
628 2989392729 2989392574 Bacteria 4554005
629 Ga0070683_100114558
630 JGI24750J21931_1011950
631 JGI24742J22300_10077035
632 JGI25406J46586_10007823
633 Ga0065704_10188060
634 Ga0065707_10081964
635 Ga0070676_10213937
636 Ga0070683_100611616
637 Ga0070690_100001718
638 Ga0070690_100450478
639 Ga0070670_100106673
640 Ga0070677_10001619
641 Ga0070677_10026094
642 Ga0068869_100028799
643 Ga0068869_100130355
644 Ga0070666_10004699
645 Ga0070666_10040128
646 Ga0070666_10461355
647 Ga0070680_100107958
648 Ga0070680_100108758
649 Ga0070682_100079295
650 Ga0070682_100175776
651 Ga0068868_100008181
652 Ga0070689_100119703
653 Ga0070689_100270157
654 Ga0070689_100284458
655 Ga0070687_100252638
656 Ga0070661_100066944
657 Ga0070661_100700325
658 Ga0070692_10228360
659 Ga0070668_100732146
660 Ga0070669_100162066
661 Ga0070669_100188535
662 Ga0070669_101064022
663 Ga0070675_100142946
664 Ga0070675_100253180
665 Ga0070675_100311748
666 Ga0070671_100009823
667 Ga0070671_100041007
668 Ga0070671_100399834
669 Ga0070674_100064797
670 Ga0070674_100261119
671 Ga0070673_100055774
672 Ga0070673_100070710
673 Ga0070659_100508760
674 Ga0070667_100000011
675 Ga0070667_100028928
676 Ga0070667_100066887
677 Ga0070667_100172119
678 Ga0070667_100300565
679 Ga0070667_101182702
680 Ga0070709_10014721
681 Ga0070709_10082383
682 Ga0070709_10479584
683 Ga0070714_100005056
684 Ga0070714_100088056
685 Ga0070713_100002957
686 Ga0070713_100044091
687 Ga0070713_100116217
688 Ga0070713_100994505
689 Ga0070710_10011721
690 Ga0070710_10391763
691 Ga0070701_10012758
692 Ga0070701_10129937
693 Ga0070701_10208987
694 Ga0070711_100006013
695 Ga0070711_100069036
696 Ga0070711_100528820
697 Ga0070711_100929242
698 Ga0070705_100011013
699 Ga0070705_100017641
700 Ga0070705_100438218
701 Ga0070700_100041285
702 Ga0070700_100055959
703 Ga0070700_100697348
704 Ga0070694_100093419
705 Ga0070694_100459918
706 Ga0070663_100484768
707 Ga0070678_100037207
708 Ga0070678_100556265
709 Ga0070662_101435202
710 Ga0070681_10150078
711 Ga0070681_10150826
712 Ga0068867_100117370
713 Ga0068867_100290931
714 Ga0068867_100392234
715 Ga0068867_100647447
716 Ga0070685_10031918
717 Ga0070685_10312008
718 Ga0070685_10317954
719 Ga0070685_10687359
720 Ga0070698_100043297
721 Ga0070699_100037910
722 Ga0070699_100826351
723 Ga0070679_100043004
724 Ga0070679_100405863
725 Ga0070684_100054831
726 Ga0070684_100150528
727 Ga0070672_100005412
728 Ga0070672_100010380
729 Ga0070672_100196452
730 Ga0070672_100276885
731 Ga0070686_100022369
732 Ga0070686_100056021
733 Ga0070686_100368507
734 Ga0070695_100019343
735 Ga0070695_100321663
736 Ga0070693_100051683
737 Ga0070693_100169712
738 Ga0070665_100001687
739 Ga0070665_100006965
740 Ga0070665_100007026
741 Ga0070665_100031335
742 Ga0070665_100186023
743 Ga0070665_100360717
744 Ga0070704_100209427
745 Ga0070704_101635986
746 Ga0068855_100001279
747 Ga0068855_100355826
748 Ga0068855_101508108
749 Ga0070664_100657619
750 Ga0068854_101802215
751 Ga0068856_100002595
752 Ga0068856_100111359
753 Ga0070702_100037285
754 Ga0068859_100059209
755 Ga0068859_100371086
756 Ga0068859_101843040
757 Ga0068864_100111331
758 Ga0068864_100513988
759 Ga0068866_10086563
760 Ga0068861_100007228
761 Ga0068861_100188898
762 Ga0068861_100418397
763 Ga0068870_10002484
764 Ga0068870_10211848
765 Ga0068863_100002979
766 Ga0068863_100023812
767 Ga0068863_100190932
768 Ga0068863_100298840
769 Ga0068858_100005149
770 Ga0068858_100014520
771 Ga0068858_100130605
772 Ga0068858_100249642
773 Ga0068858_101083163
774 Ga0068860_100010920
775 Ga0068860_100021903
776 Ga0068860_100078183
777 Ga0068862_100058443
778 Ga0068862_100080225
779 Ga0068862_100173493
780 Ga0068862_100379892
781 Ga0081539_10000055
782 Ga0070717_10004372
783 Ga0070715_10001448
784 Ga0070715_10111717
785 Ga0070715_10149164
786 Ga0070715_10427377
787 Ga0070716_100022234
788 Ga0070716_100042426
789 Ga0070716_100051532
790 Ga0070712_100001982
791 Ga0097621_100002893
792 Ga0097621_100004031
793 Ga0097621_100007605
794 Ga0097621_100044587
795 Ga0097621_100085851
796 Ga0097621_100355650
797 Ga0075370_10028236
798 Ga0068871_100004778
799 Ga0068871_100048275
800 Ga0068871_100101878
801 Ga0068871_100125486
802 Ga0075428_101278525
803 Ga0075433_10261445
804 Ga0068865_100007820
805 Ga0068865_100337541
806 Ga0097620_100059208
807 Ga0097620_100371089
808 Ga0097620_101461031
809 Ga0097620_101843083
810 Ga0075435_100078467
811 Ga0075435_100243403
812 Ga0105250_10092442
813 Ga0105240_10024084
814 Ga0105240_10056702
815 Ga0105240_10146182
816 Ga0105240_10168081
817 Ga0105240_10387916
818 Ga0111539_10123434
819 Ga0105245_10014403
820 Ga0105245_12040199
821 Ga0105247_10002776
822 Ga0105247_10006388
823 Ga0105247_10073219
824 Ga0105247_10092493
825 Ga0105243_10232014
826 Ga0105241_10046774
827 Ga0105241_10052850
828 Ga0105241_10688534
829 Ga0105242_10000894
830 Ga0105242_10023298
831 Ga0105242_10769127
832 Ga0105248_10009456
833 Ga0105248_10065102
834 Ga0105248_10070718
835 Ga0105248_10247671
836 Ga0105237_10009386
837 Ga0105237_10040756
838 Ga0105237_10159095
839 Ga0105237_11193726
840 Ga0105238_10116532
841 Ga0105238_10223741
842 Ga0105238_11199424
843 Ga0105249_10118161
844 Ga0105249_10137543
845 Ga0105249_10297054
846 Ga0105249_10475798
847 Ga0105249_11714327
848 Ga0105239_10027633
849 Ga0105239_10054026
850 Ga0105246_10315987
851 Ga0105246_10931890
852 Ga0157374_10055348
853 Ga0157374_10455268
854 Ga0157374_10599132
855 Ga0157378_10021679
856 Ga0163162_10138314
857 Ga0163162_10155934
858 Ga0163162_10176688
859 Ga0157372_10228518
860 Ga0157372_13058045
861 Ga0157375_10008581
862 Ga0157375_10131562
863 Ga0157375_10275746
864 Ga0163163_10016247
865 Ga0163163_10089867
866 Ga0163163_10148497
867 Ga0163163_10169945
868 Ga0163163_10268491
869 Ga0163163_10326977
870 Ga0163163_10739649
871 Ga0157380_10005671
872 Ga0157380_10130488
873 Ga0157380_10311833
874 Ga0157380_10582148
875 Ga0157379_10033762
876 Ga0157379_10064559
877 Ga0157379_10075542
878 Ga0157379_10111463
879 Ga0157379_10125014
880 Ga0157379_10283207
881 Ga0157379_10314679
882 Ga0157379_11437178
883 Ga0157376_10004323
884 Ga0157376_10120786
885 Ga0157376_10164780
886 Ga0157376_10296120
887 Ga0157376_10578461
888 Ga0163161_10041798
889 Ga0163161_10073388
890 Ga0163161_11717852
891 Ga0213874_10007168
892 Ga0213871_10102048
893 Ga0207682_10001277
894 Ga0207682_10001747
895 Ga0207692_10007578
896 Ga0207692_10922195
897 Ga0207642_10915855
898 Ga0207710_10000989
899 Ga0207710_10141838
900 Ga0207688_10096365
901 Ga0207688_10447851
902 Ga0207680_10053183
903 Ga0207680_10438721
904 Ga0207685_10004176
905 Ga0207685_10191916
906 Ga0207685_10215338
907 Ga0207685_10233587
908 Ga0207699_10145040
909 Ga0207699_10240235
910 Ga0207699_10449222
911 Ga0207643_10001199
912 Ga0207643_10048448
913 Ga0207654_10231571
914 Ga0207707_10031192
915 Ga0207707_10057677
916 Ga0207707_10132798
917 Ga0207707_10211193
918 Ga0207695_10000395
919 Ga0207695_10006944
920 Ga0207695_10028788
921 Ga0207695_10272242
922 Ga0207695_10343598
923 Ga0207671_10035994
924 Ga0207671_10129689
925 Ga0207671_10315540
926 Ga0207693_10000343
927 Ga0207693_10022858
928 Ga0207663_10222519
929 Ga0207663_10646873
930 Ga0207660_10024054
931 Ga0207660_10424771
932 Ga0207662_10364475
933 Ga0207649_10073046
934 Ga0207649_10422003
935 Ga0207652_10100252
936 Ga0207652_10183876
937 Ga0207652_10356903
938 Ga0207694_10322973
939 Ga0207659_10081321
940 Ga0207659_10178646
941 Ga0207659_11602755
942 Ga0207687_10996590
943 Ga0207700_10030174
944 Ga0207700_10053554
945 Ga0207664_10010005
946 Ga0207664_10060321
947 Ga0207664_10334603
948 Ga0207644_10018906
949 Ga0207690_11184249
950 Ga0207706_10166944
951 Ga0207686_10011191
952 Ga0207686_10198771
953 Ga0207709_10271256
954 Ga0207709_11120620
955 Ga0207670_10034959
956 Ga0207670_10092327
957 Ga0207670_10685291
958 Ga0207670_11488588
959 Ga0207669_10078364
960 Ga0207669_10108569
961 Ga0207704_10071935
962 Ga0207704_10416086
963 Ga0207704_10980835
964 Ga0207665_10011292
965 Ga0207665_10263029
966 Ga0207691_10005856
967 Ga0207691_10088316
968 Ga0207691_10097546
969 Ga0207691_10107530
970 Ga0207691_10736527
971 Ga0207711_10044802
972 Ga0207711_10168512
973 Ga0207711_10174927
974 Ga0207711_10536914
975 Ga0207689_10192414
976 Ga0207689_10232181
977 Ga0207689_10291022
978 Ga0207661_10553017
979 Ga0207667_10001150
980 Ga0207667_10307756
981 Ga0207667_11264526
982 Ga0207651_10574881
983 Ga0207712_10073199
984 Ga0207712_10226586
985 Ga0207712_10577428
986 Ga0207640_11498546
987 Ga0207658_10000046
988 Ga0207658_10096054
989 Ga0207658_10108840
990 Ga0207658_10530773
991 Ga0207677_10019753
992 Ga0207703_10072353
993 Ga0207703_10230228
994 Ga0207703_10285707
995 Ga0207703_10412481
996 Ga0207703_10909162
997 Ga0207703_11579776
998 Ga0207678_10230506
999 Ga0207678_10445702
1000 Ga0207708_10013607
1001 Ga0207708_10071658
1002 Ga0207702_10136602
1003 Ga0207702_10288071
1004 Ga0207641_10050898
1005 Ga0207641_10137382
1006 Ga0207641_10148632
1007 Ga0207641_10291133
1008 Ga0207641_10350605
1009 Ga0207641_11350796
1010 Ga0207648_10114246
1011 Ga0207648_10234347
1012 Ga0207648_10422167
1013 Ga0207676_10092953
1014 Ga0207676_10157965
1015 Ga0207675_100008752
1016 Ga0207675_100022186
1017 Ga0207675_100031077
1018 Ga0207675_100236779
1019 Ga0207675_100425526
1020 Ga0207675_102170718
1021 Ga0207683_10007235
1022 Ga0207683_10032910
1023 Ga0207683_10465274
1024 Ga0207683_10487978
1025 Ga0209974_10022040
1026 Ga0268266_10000702
1027 Ga0268266_10008042
1028 Ga0268266_10023248
1029 Ga0268266_10219100
1030 Ga0268266_10255725
1031 Ga0268266_10321368
1032 Ga0268266_10832884
1033 Ga0268265_10115136
1034 Ga0268265_10438972
1035 Ga0268265_11137587
1036 Ga0268264_10120819
1037 Ga0268264_10134623
1038 Ga0268264_10705377
1039 Ga0265319_1045117
1040 Ga0307515_10008465
1041 Ga0307515_10125499
1042 Ga0307515_10150469
1043 Ga0265338_10136500
1044 Ga0307511_10001897
1045 Ga0307511_10334597
1046 Ga0265762_1025559
1047 Ga0265320_10084919
1048 Ga0265340_10012150
1049 Ga0265340_10064490
1050 Ga0265339_10025281
1051 Ga0265331_10258857
1052 Ga0307513_10027808
1053 Ga0307513_10037971
1054 Ga0307513_10060857
1055 Ga0307513_10113902
1056 Ga0307509_10000008
1057 Ga0307408_100013520
1058 Ga0307408_100277630
1059 Ga0307508_10041977
1060 Ga0316575_10011412
1061 Ga0316579_10026750
1062 Ga0316579_10300583
1063 Ga0316576_10090658
1064 Ga0316578_10116357
1065 Ga0307516_10000190
1066 Ga0307405_10143659
1067 Ga0316577_10048842
1068 Ga0307413_10000239
1069 Ga0307413_10125473
1070 Ga0307410_10067880
1071 Ga0307410_10474092
1072 Ga0307406_10013346
1073 Ga0307406_10776015
1074 Ga0307407_10162151
1075 Ga0307407_10320913
1076 Ga0307412_10118398
1077 Ga0307412_11301651
1078 Ga0307409_100008479
1079 Ga0307409_100809216
1080 Ga0307416_100036759
1081 Ga0307411_10007506
1082 Ga0307415_100009052
1083 Ga0307415_100234645
1084 Ga0307415_101686056
1085 Ga0316585_10002604
1086 Ga0316585_10038888
1087 Ga0373923_0043940
1088 Ga0373936_0000391
1089 Ga0373945_0063772
1090 Ga0373954_0318332
1091 Ga0373956_0039429
1092 Ga0373943_0114676
1093 Ga0373955_0235549
1094 Ga0316574_0027431
1095 Ga0316574_0037873
1096 Ga0316574_0039999
1097 Ga0316574_0214467
1098 Ga0373935_0192365
1099 Ga0373927_0007466
1100 Ga0373933_0076989
1101 Ga0373933_0470452
1102 Ga0373937_0020774
1103 Ga0373937_0064457
1104 Ga0373937_0265966
1105 Ga0373937_0802386
1106 Ga0373937_1654886
1107 Ga0316582_0056952
1108 Ga0316582_0391225
1109 Ga0316584_0003035
1110 Ga0316584_0104093
1111 Ga0316584_0163244
1112 Ga0373925_0275376
1113 Ga0373925_0723919
1114 Ga0395898_0288797
1115 Ga0316581_0074036
1116 Ga0395901_0872164
1117 Ga0436365_0513051
1118 Ga0436360_0009506
1119 Ga0436360_0144678
1120 Ga0436360_0362309
1121 Ga0436360_0559362
1122 Ga0436361_0091966
1123 Ga0436361_0288915
1124 Ga0436361_0422010
1125 Ga0436361_0597166
1126 Ga0436361_0872614
1127 Ga0436363_0128548
1128 Ga0436363_0154486
1129 Ga0436363_0484543
1130 Ga0436363_0535276
1131 Ga0436363_1507501
1132 Ga0436363_1559932
1133 Ga0436362_0055414
1134 Ga0451791_1226498
1135 Ga0451800_1393041
1136 Ga0451802_0358418
1137 Ga0451804_0426398
1138 Ga0451804_0992074
1139 Ga0451807_0931753
1140 Ga0451807_1933992
1141 Ga0451853_2655596
1142 Ga0466969_0001621
1143 Ga0466969_0008870
1144 Ga0466966_0000352
1145 Ga0466966_0225579
1146 Ga0466966_0278019
1147 Ga0466961_0001755
1148 Ga0466961_0090268
1149 Ga0466961_0325620
1150 Ga0466964_0000155
1151 Ga0466971_0000333
1152 Ga0466971_0277829
1153 Ga0466970_0000883
1154 Ga0466959_0002160
1155 Ga0466959_0012491
1156 Ga0466959_0046927
1157 Ga0466959_0073147
1158 Ga0495592_0406063
1159 Ga0495638_0004744
1160 Ga0495580_0017539
1161 Ga0495580_0043039
1162 Ga0495580_0060514
1163 Ga0495639_0252821
1164 Ga0495594_0604875
1165 Ga0495596_0278700
1166 Ga0495607_0132536
1167 Ga0495616_0098255
1168 Ga0495618_0486636
1169 Ga0495630_0056452
1170 Ga0495630_0782160
1171 Ga0495632_0101259
1172 Ga0495644_0012657
1173 Ga0495665_0231551
1174 Ga0495587_0126753
1175 Ga0495587_0177988
1176 Ga0495598_0002744
1177 Ga0495621_0009721
1178 Ga0495656_0085558
1179 Ga0495656_0235773
1180 Ga0495625_0013679
1181 Ga0495647_0005860
1182 Ga0495647_0330897
1183 Ga0495658_0136200
1184 Ga0495613_0549310
1185 Ga0495670_0095887
1186 Ga0495671_0044580
1187 Ga0495604_0176455
1188 Ga0495674_0537851
1189 Ga0495687_025081
1190 Ga0496100_0138608
1191 Ga0496100_0156387
1192 Ga0496101_0044522
1193 Ga0496101_0134362
1194 Ga0496101_0167611
1195 Ga0496102_0011185
1196 Ga0496102_0017816
1197 Ga0496102_0327163
1198 Ga0496103_0269024
1199 Ga0496103_0517067
1200 Ga0496104_0183259
1201 Ga0496104_0737156
1202 Ga0496105_0018162
1203 Ga0496106_0009693
1204 Ga0496106_0098167
1205 Ga0496107_0004034
1206 Ga0496107_0486084
1207 Ga0496108_0114569
1208 Ga0496109_0145984
1209 Ga0496110_0031567
1210 Ga0496112_0006250
1211 Ga0496113_0368067
1212 Ga0496114_0013160
1213 Ga0496115_0275067
1214 Ga0496115_0315228
1215 Ga0496118_0059706
1216 Ga0496121_0085727
1217 Ga0496125_0039821
1218 Ga0496126_0003192
1219 Ga0501033_0348923
1220 Ga0501042_0534614
1221 Ga0501067_0008504
1222 Ga0501068_0005402
1223 Ga0501070_0141547
1224 Ga0501073_0164106
1225 Ga0501074_0083140
1226 Ga0501077_0192550
1227 Ga0501080_0363987
1228 Ga0501083_0021566
1229 nmdc:mga07m45_28596_c1
1230 nmdc:mga07m45_653494_c1
1231 nmdc:mga0qj67_145220_c1
1232 nmdc:mga0n895_413370_c1
1233 nmdc:mga0rr50_56185_c1
1234 nmdc:mga0rr50_818598_c1
1235 nmdc:mga08x19_44524_c1
1236 nmdc:mga0a205_590042_c1
1237 Ga0495601_0418379
1238 Ga0500644_0050293
1239 Ga0500556_0001428
1240 Ga0500556_0115464
1241 Ga0500595_011945
1242 Ga0500658_0084174
1243 Ga0500568_0003535
1244 Ga0500568_0145202
1245 Ga0500577_0338621
1246 Ga0500622_0090621
1247 Ga0500633_0253643
1248 Ga0500639_289106
1249 Ga0500637_0091760
1250 Ga0501084_0171646
1251 Ga0501082_0064000
1252 Ga0466962_0000084
1253 Ga0466962_0419684
1254 Ga0530510_1014233
1255 2894514382
1256 2989392729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

23

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9045 1 148
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8989 1 148
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8718 2 148
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8611 2 148
6rmo-assembly4.cif.gz_N structure of plasmodium falciparum imp-nucleotidase 0.6479 12 95
ID Description Score Start End Superfamily
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9674 9 97 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9567 9 92 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9476 9 97 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9467 9 97 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9247 9 92 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A2E6E607-F1-model_v4 UPF0234 protein CMO98_00215 0.9797 1 148 GO:0000166
GO:0005829
AF-A0A1G0GSL8-F1-model_v4 UPF0234 protein A3E81_03785 0.9781 1 148 GO:0000166
GO:0005829
AF-A0A2V7YHM7-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9762 3 74 GO:0000166
GO:0005829
AF-A0A2E6E607-F1-model_v4 UPF0234 protein CMO98_00215 0.9732 1 148 GO:0000166
GO:0005829
AF-A0A0S7ZUM6-F1-model_v4 Nucleotide-binding protein 0.9729 1 78 GO:0000166
GO:0005829

Map