F470616

General Info

Members Datasets Scaffolds Average Seq Length
628 276 1256 447

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10095716|Ga0065715_100957165
Length 483
Sequence LWLPPSGGRKISVTLRGAAKIVAAPFLFSRRLLADLAAPTRTLPHSLDAEKSVLGAILIYNDAFNAAAEVIDAGDFFRDAHRRIFDRMVALNERGDAIDFVTLKEELLRRGDLDEVGGPAYIAALADGVPRSANVEYYAKIVKEKSTLRNLIHSANKILADAYEAEEEPDLLLDSAERAIFAIAEDRIRTGFVPLRDLXXXXFATIEALQQHKGLVTGVPTGFVDLDEMTSGLQPSDLILVAARPSMGKTSFVLNVAQHVGTSTDMTVGFFSLEMSKEQLFMRLLTSEARIDAHRFRSGYLSEKDYGRLSHALGTLAEARVFIDDTASLGVLEMRAKARRLKAEHGLHLLIIDYIQLMQGRGRFESRQVELASISRSLKGLAKELQVPIIALSQLSRAPETRSDHRPQLSDLRESGALEQDADVVMFIYREEQYRDADGAPNEGAEGVAEIIIGKQRNGPVGTAKLAFIKEHTRFENLAHGAP

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 4.94
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10095716 3300005293 Bacteria 4020
2 JGI24751J29686_10011478 3300002459 Bacteria 1827
3 Ga0065712_10003788 3300005290 Bacteria 3743
4 Ga0065712_10070494 3300005290 Bacteria 5960
5 Ga0065712_10072809 3300005290 Bacteria 4591
6 Ga0065712_10074835 3300005290 Bacteria 3996
7 Ga0065712_10081865 3300005290 Bacteria 2946
8 Ga0065715_10000948 3300005293 Bacteria 10836
9 Ga0065707_10001756 3300005295 Bacteria 6829
10 Ga0065707_10019567 3300005295 Bacteria 1986
11 Ga0065707_10099613 3300005295 Bacteria 2993
12 Ga0065707_10141556 3300005295 Bacteria 1746
13 Ga0070676_10024444 3300005328 Bacteria 3403
14 Ga0070683_100000094 3300005329 Bacteria 58242
15 Ga0070683_100015813 3300005329 Bacteria 6635
16 Ga0070670_100004478 3300005331 Bacteria 11706
17 Ga0070670_100006909 3300005331 Bacteria 9618
18 Ga0070670_100008888 3300005331 Bacteria 8576
19 Ga0070670_100020449 3300005331 Bacteria 5691
20 Ga0070670_100034099 3300005331 Bacteria 4382
21 Ga0070670_100103477 3300005331 Bacteria 2452
22 Ga0068869_100149393 3300005334 Bacteria 1811
23 Ga0070666_10016999 3300005335 Bacteria 4659
24 Ga0070660_100011435 3300005339 Bacteria 6305
25 Ga0070691_10088045 3300005341 Bacteria 1528
26 Ga0070687_100074041 3300005343 Bacteria 1838
27 Ga0070661_100001504 3300005344 Bacteria 16216
28 Ga0070668_100033204 3300005347 Bacteria 3928
29 Ga0070669_100001822 3300005353 Bacteria 15344
30 Ga0070669_100001826 3300005353 Bacteria 15339
31 Ga0070669_100071654 3300005353 Bacteria 2564
32 Ga0070669_100197626 3300005353 Bacteria 1581
33 Ga0070675_100000126 3300005354 Bacteria 45585
34 Ga0070675_100030848 3300005354 Bacteria 4329
35 Ga0070675_100034056 3300005354 Bacteria 4132
36 Ga0070675_100069557 3300005354 Bacteria 2917
37 Ga0070675_100173071 3300005354 Bacteria 1863
38 Ga0070671_100014812 3300005355 Bacteria 6300
39 Ga0070671_100030807 3300005355 Bacteria 4427
40 Ga0070671_100034791 3300005355 Bacteria 4171
41 Ga0070671_100096726 3300005355 Bacteria 2476
42 Ga0070674_100009134 3300005356 Bacteria 5930
43 Ga0070674_100025038 3300005356 Bacteria 3879
44 Ga0070674_100079368 3300005356 Bacteria 2341
45 Ga0070673_100014365 3300005364 Bacteria 5511
46 Ga0070673_100024733 3300005364 Bacteria 4408
47 Ga0070673_100042176 3300005364 Bacteria 3516
48 Ga0070688_100161770 3300005365 Bacteria 1538
49 Ga0070667_100023967 3300005367 Bacteria 5068
50 Ga0070714_100007866 3300005435 Bacteria 8305
51 Ga0070701_10027212 3300005438 Bacteria 2798
52 Ga0070711_100102635 3300005439 Bacteria 2083
53 Ga0070705_100012340 3300005440 Bacteria 4341
54 Ga0070708_100000162 3300005445 Bacteria 47341
55 Ga0070663_100031649 3300005455 Bacteria 3638
56 Ga0070662_100156363 3300005457 Bacteria 1780
57 Ga0068867_100228558 3300005459 Bacteria 1503
58 Ga0070698_100046350 3300005471 Bacteria 4445
59 Ga0070698_100054713 3300005471 Bacteria 4051
60 Ga0070699_100001694 3300005518 Bacteria 20061
61 Ga0070699_100028109 3300005518 Bacteria 4850
62 Ga0070679_100028072 3300005530 Bacteria 5545
63 Ga0070679_100074307 3300005530 Bacteria 3390
64 Ga0070684_100000166 3300005535 Bacteria 45212
65 Ga0070672_100056176 3300005543 Bacteria 3086
66 Ga0070686_100000486 3300005544 Bacteria 24080
67 Ga0070695_100011283 3300005545 Bacteria 5344
68 Ga0070695_100032173 3300005545 Bacteria 3279
69 Ga0070665_100001142 3300005548 Bacteria 32621
70 Ga0070665_100023391 3300005548 Bacteria 6221
71 Ga0070665_100111511 3300005548 Bacteria 2738
72 Ga0070665_100218077 3300005548 Bacteria 1908
73 Ga0070704_100008602 3300005549 Bacteria 6131
74 Ga0070664_100000479 3300005564 Bacteria 30222
75 Ga0070664_100017862 3300005564 Bacteria 5824
76 Ga0070664_100092357 3300005564 Bacteria 2621
77 Ga0068857_100088516 3300005577 Bacteria 2770
78 Ga0068854_100012140 3300005578 Bacteria 5634
79 Ga0068854_100060652 3300005578 Bacteria 2737
80 Ga0068856_100194009 3300005614 Bacteria 2045
81 Ga0068859_100012501 3300005617 Bacteria 8540
82 Ga0068859_100043379 3300005617 Bacteria 4520
83 Ga0068859_100155036 3300005617 Bacteria 2367
84 Ga0068859_100187387 3300005617 Bacteria 2153
85 Ga0068864_100105780 3300005618 Bacteria 2501
86 Ga0068864_100138272 3300005618 Bacteria 2195
87 Ga0068866_10051816 3300005718 Bacteria 2091
88 Ga0068861_100044855 3300005719 Bacteria 3327
89 Ga0068863_100002641 3300005841 Bacteria 17739
90 Ga0068863_100091208 3300005841 Bacteria 2889
91 Ga0068863_100187754 3300005841 Bacteria 1986
92 Ga0068858_100001750 3300005842 Bacteria 22134
93 Ga0068858_100044229 3300005842 Bacteria 4128
94 Ga0068858_100058941 3300005842 Bacteria 3549
95 Ga0068858_100110332 3300005842 Bacteria 2569
96 Ga0068858_100181638 3300005842 Bacteria 1987
97 Ga0068858_100250448 3300005842 Bacteria 1682
98 Ga0068860_100204813 3300005843 Bacteria 1913
99 Ga0068860_100337354 3300005843 Bacteria 1481
100 Ga0068862_100003872 3300005844 Bacteria 12736
101 Ga0068862_100032463 3300005844 Bacteria 4412
102 Ga0068862_100069193 3300005844 Bacteria 3046
103 Ga0068862_100103821 3300005844 Bacteria 2489
104 Ga0081455_10033236 3300005937 Bacteria 4638
105 Ga0081539_10032414 3300005985 Bacteria 3200
106 Ga0075365_10023639 3300006038 Bacteria 3868
107 Ga0075368_10010990 3300006042 Bacteria 3286
108 Ga0075368_10029383 3300006042 Bacteria 2125
109 Ga0075364_10012231 3300006051 Bacteria 5244
110 Ga0075364_10094940 3300006051 Bacteria 1982
111 Ga0075367_10006328 3300006178 Bacteria 5972
112 Ga0075367_10021992 3300006178 Bacteria 3570
113 Ga0075367_10042952 3300006178 Bacteria 2647
114 Ga0075367_10047619 3300006178 Bacteria 2523
115 Ga0075366_10005550 3300006195 Bacteria 6838
116 Ga0075366_10019318 3300006195 Bacteria 3941
117 Ga0075366_10063890 3300006195 Bacteria 2188
118 Ga0097621_100001492 3300006237 Bacteria 16045
119 Ga0097621_100002965 3300006237 Bacteria 11648
120 Ga0097621_100028749 3300006237 Bacteria 4384
121 Ga0097621_100054521 3300006237 Bacteria 3261
122 Ga0097621_100223723 3300006237 Bacteria 1641
123 Ga0075370_10006583 3300006353 Bacteria 5853
124 Ga0068871_100007809 3300006358 Bacteria 7661
125 Ga0068871_100037728 3300006358 Bacteria 3855
126 Ga0068871_100060378 3300006358 Bacteria 3093
127 Ga0068871_100085065 3300006358 Bacteria 2625
128 Ga0068871_100131725 3300006358 Bacteria 2120
129 Ga0068871_100172716 3300006358 Bacteria 1854
130 Ga0075428_100000017 3300006844 Bacteria 147833
131 Ga0075428_100003278 3300006844 Bacteria 17699
132 Ga0075428_100005429 3300006844 Bacteria 14163
133 Ga0075428_100008684 3300006844 Bacteria 11272
134 Ga0075428_100036637 3300006844 Bacteria 5402
135 Ga0075428_100303756 3300006844 Bacteria 1716
136 Ga0075430_100005222 3300006846 Bacteria 10947
137 Ga0075430_100017112 3300006846 Bacteria 6175
138 Ga0075430_100055833 3300006846 Bacteria 3321
139 Ga0075430_100172356 3300006846 Bacteria 1800
140 Ga0075431_100003437 3300006847 Bacteria 15361
141 Ga0075431_100031118 3300006847 Bacteria 5496
142 Ga0075431_100188792 3300006847 Bacteria 2112
143 Ga0075431_100321780 3300006847 Bacteria 1559
144 Ga0075433_10026586 3300006852 Bacteria 4901
145 Ga0075433_10029168 3300006852 Bacteria 4698
146 Ga0075433_10084562 3300006852 Bacteria 2801
147 Ga0075433_10138524 3300006852 Bacteria 2163
148 Ga0075433_10147817 3300006852 Bacteria 2089
149 Ga0075433_10200726 3300006852 Bacteria 1773
150 Ga0075434_100001891 3300006871 Bacteria 18122
151 Ga0075434_100014324 3300006871 Bacteria 7578
152 Ga0075434_100022053 3300006871 Bacteria 6200
153 Ga0075429_100112902 3300006880 Bacteria 2375
154 Ga0068865_100000768 3300006881 Bacteria 17997
155 Ga0068865_100158979 3300006881 Bacteria 1722
156 Ga0075436_100001121 3300006914 Bacteria 18122
157 Ga0075436_100020929 3300006914 Bacteria 4486
158 Ga0075436_100027279 3300006914 Bacteria 3931
159 Ga0097620_100012502 3300006931 Bacteria 8540
160 Ga0097620_100043380 3300006931 Bacteria 4520
161 Ga0097620_100155039 3300006931 Bacteria 2367
162 Ga0097620_100187389 3300006931 Bacteria 2153
163 Ga0075435_100000342 3300007076 Bacteria 28702
164 Ga0075435_100001286 3300007076 Bacteria 16131
165 Ga0075435_100001999 3300007076 Bacteria 13346
166 Ga0075435_100002624 3300007076 Bacteria 11969
167 Ga0075435_100009261 3300007076 Bacteria 7116
168 Ga0075435_100046688 3300007076 Bacteria 3475
169 Ga0105240_10055960 3300009093 Bacteria 4938
170 Ga0105240_10105162 3300009093 Bacteria 3427
171 Ga0111539_10000002 3300009094 Bacteria 983359
172 Ga0111539_10007496 3300009094 Bacteria 13967
173 Ga0111539_10019212 3300009094 Bacteria 8441
174 Ga0111539_10034772 3300009094 Bacteria 6105
175 Ga0111539_10120022 3300009094 Bacteria 3080
176 Ga0111539_10165743 3300009094 Bacteria 2583
177 Ga0105245_10059423 3300009098 Bacteria 3443
178 Ga0105245_10063005 3300009098 Bacteria 3347
179 Ga0114129_10000509 3300009147 Bacteria 47512
180 Ga0114129_10001667 3300009147 Bacteria 30241
181 Ga0114129_10003035 3300009147 Bacteria 23547
182 Ga0114129_10009415 3300009147 Bacteria 13923
183 Ga0114129_10009699 3300009147 Bacteria 13740
184 Ga0114129_10014680 3300009147 Bacteria 11160
185 Ga0114129_10020336 3300009147 Bacteria 9444
186 Ga0114129_10054015 3300009147 Bacteria 5634
187 Ga0114129_10058610 3300009147 Bacteria 5386
188 Ga0114129_10186842 3300009147 Bacteria 2816
189 Ga0105241_10047376 3300009174 Bacteria 3269
190 Ga0105248_10004266 3300009177 Bacteria 15819
191 Ga0105248_10024004 3300009177 Bacteria 6778
192 Ga0105248_10026969 3300009177 Bacteria 6389
193 Ga0105248_10102509 3300009177 Bacteria 3225
194 Ga0105248_10138322 3300009177 Bacteria 2747
195 Ga0105248_10184596 3300009177 Bacteria 2350
196 Ga0105248_10266326 3300009177 Bacteria 1929
197 Ga0105249_10005969 3300009553 Bacteria 10554
198 Ga0105249_10040966 3300009553 Bacteria 4208
199 Ga0105249_10110728 3300009553 Bacteria 2595
200 Ga0105249_10251709 3300009553 Bacteria 1752
201 Ga0157374_10058802 3300013296 Bacteria 3593
202 Ga0157374_10333221 3300013296 Bacteria 1505
203 Ga0157374_10360290 3300013296 Bacteria 1446
204 Ga0157378_10100195 3300013297 Bacteria 2644
205 Ga0163162_10012905 3300013306 Bacteria 8158
206 Ga0163162_10219281 3300013306 Bacteria 2032
207 Ga0157375_10167031 3300013308 Bacteria 2346
208 Ga0157375_10382497 3300013308 Bacteria 1574
209 Ga0163163_10003727 3300014325 Bacteria 12970
210 Ga0163163_10029039 3300014325 Bacteria 5317
211 Ga0163163_10219336 3300014325 Bacteria 1950
212 Ga0157380_10011831 3300014326 Bacteria 6310
213 Ga0157380_10012730 3300014326 Bacteria 6109
214 Ga0157380_10050159 3300014326 Bacteria 3295
215 Ga0157380_10063406 3300014326 Bacteria 2963
216 Ga0157377_10040929 3300014745 Bacteria 2568
217 Ga0157379_10006964 3300014968 Bacteria 9776
218 Ga0157379_10046448 3300014968 Bacteria 3874
219 Ga0157379_10050038 3300014968 Bacteria 3730
220 Ga0157379_10050918 3300014968 Bacteria 3698
221 Ga0157379_10084538 3300014968 Bacteria 2844
222 Ga0157376_10007845 3300014969 Bacteria 7654
223 Ga0157376_10008007 3300014969 Bacteria 7586
224 Ga0157376_10172096 3300014969 Bacteria 1973
225 Ga0207697_10011895 3300025315 Bacteria 3667
226 Ga0207688_10028214 3300025901 Bacteria 3089
227 Ga0207647_10058576 3300025904 Bacteria 2359
228 Ga0207645_10033518 3300025907 Bacteria 3301
229 Ga0207643_10037681 3300025908 Bacteria 2713
230 Ga0207654_10086014 3300025911 Bacteria 1905
231 Ga0207707_10197614 3300025912 Bacteria 1754
232 Ga0207695_10039395 3300025913 Bacteria 5080
233 Ga0207663_10084762 3300025916 Bacteria 2085
234 Ga0207662_10011144 3300025918 Bacteria 4976
235 Ga0207662_10018922 3300025918 Bacteria 3912
236 Ga0207657_10005005 3300025919 Bacteria 13923
237 Ga0207657_10067902 3300025919 Bacteria 3030
238 Ga0207649_10010919 3300025920 Bacteria 4994
239 Ga0207652_10022007 3300025921 Bacteria 5268
240 Ga0207652_10084407 3300025921 Bacteria 2782
241 Ga0207681_10004627 3300025923 Bacteria 8460
242 Ga0207681_10014196 3300025923 Bacteria 4944
243 Ga0207681_10072528 3300025923 Bacteria 2405
244 Ga0207681_10114895 3300025923 Bacteria 1964
245 Ga0207650_10003836 3300025925 Bacteria 10275
246 Ga0207650_10014293 3300025925 Bacteria 5515
247 Ga0207650_10015514 3300025925 Bacteria 5307
248 Ga0207659_10000390 3300025926 Bacteria 26422
249 Ga0207659_10042679 3300025926 Bacteria 3181
250 Ga0207659_10107442 3300025926 Bacteria 2115
251 Ga0207644_10010148 3300025931 Bacteria 6204
252 Ga0207644_10142973 3300025931 Bacteria 1844
253 Ga0207706_10019072 3300025933 Bacteria 6170
254 Ga0207706_10076550 3300025933 Bacteria 2943
255 Ga0207706_10114722 3300025933 Bacteria 2370
256 Ga0207686_10007943 3300025934 Bacteria 5720
257 Ga0207686_10096590 3300025934 Bacteria 1963
258 Ga0207670_10105661 3300025936 Bacteria 2019
259 Ga0207669_10016642 3300025937 Bacteria 3743
260 Ga0207704_10095550 3300025938 Bacteria 1965
261 Ga0207691_10035100 3300025940 Bacteria 4659
262 Ga0207691_10053787 3300025940 Bacteria 3674
263 Ga0207691_10079823 3300025940 Bacteria 2944
264 Ga0207711_10010209 3300025941 Bacteria 7796
265 Ga0207711_10019590 3300025941 Bacteria 5632
266 Ga0207711_10044920 3300025941 Bacteria 3773
267 Ga0207711_10135936 3300025941 Bacteria 2208
268 Ga0207711_10207639 3300025941 Bacteria 1789
269 Ga0207711_10287012 3300025941 Bacteria 1516
270 Ga0207661_10065930 3300025944 Bacteria 2940
271 Ga0207661_10124148 3300025944 Bacteria 2203
272 Ga0207679_10002245 3300025945 Bacteria 11932
273 Ga0207679_10029861 3300025945 Bacteria 3800
274 Ga0207679_10043426 3300025945 Bacteria 3236
275 Ga0207679_10106771 3300025945 Bacteria 2201
276 Ga0207651_10082337 3300025960 Bacteria 2323
277 Ga0207712_10200293 3300025961 Bacteria 1583
278 Ga0207668_10199597 3300025972 Bacteria 1592
279 Ga0207658_10032627 3300025986 Bacteria 3708
280 Ga0207658_10051075 3300025986 Bacteria 3046
281 Ga0207677_10145233 3300026023 Bacteria 1822
282 Ga0207703_10003700 3300026035 Bacteria 12733
283 Ga0207703_10014502 3300026035 Bacteria 6147
284 Ga0207703_10052596 3300026035 Bacteria 3308
285 Ga0207703_10159697 3300026035 Bacteria 1973
286 Ga0207678_10040510 3300026067 Bacteria 4040
287 Ga0207678_10181967 3300026067 Bacteria 1795
288 Ga0207708_10010053 3300026075 Bacteria 7025
289 Ga0207708_10030974 3300026075 Bacteria 4059
290 Ga0207708_10033577 3300026075 Bacteria 3899
291 Ga0207641_10012095 3300026088 Bacteria 7078
292 Ga0207641_10191323 3300026088 Bacteria 1881
293 Ga0207641_10194986 3300026088 Bacteria 1864
294 Ga0207648_10023964 3300026089 Bacteria 5456
295 Ga0207648_10042908 3300026089 Bacteria 3972
296 Ga0207648_10083579 3300026089 Bacteria 2784
297 Ga0207648_10141879 3300026089 Bacteria 2117
298 Ga0207676_10006796 3300026095 Bacteria 8098
299 Ga0207676_10017193 3300026095 Bacteria 5241
300 Ga0207676_10155794 3300026095 Bacteria 1973
301 Ga0207674_10089536 3300026116 Bacteria 3070
302 Ga0207674_10095976 3300026116 Bacteria 2950
303 Ga0207675_100009283 3300026118 Bacteria 9224
304 Ga0207675_100085552 3300026118 Bacteria 2959
305 Ga0207683_10030430 3300026121 Bacteria 4678
306 Ga0209971_1013155 3300027682 Bacteria 1961
307 Ga0207428_10000004 3300027907 Bacteria 727800
308 Ga0207428_10004630 3300027907 Bacteria 13038
309 Ga0207428_10005890 3300027907 Bacteria 11357
310 Ga0207428_10024129 3300027907 Bacteria 5107
311 Ga0207428_10027128 3300027907 Bacteria 4770
312 Ga0207428_10036140 3300027907 Bacteria 4032
313 Ga0268266_10028632 3300028379 Bacteria 4734
314 Ga0268266_10033789 3300028379 Bacteria 4347
315 Ga0268266_10035948 3300028379 Bacteria 4213
316 Ga0268265_10001769 3300028380 Bacteria 17327
317 Ga0268265_10049460 3300028380 Bacteria 3162
318 Ga0268265_10097487 3300028380 Bacteria 2365
319 Ga0268264_10072000 3300028381 Bacteria 2930
320 Ga0268264_10211732 3300028381 Bacteria 1780
321 Ga0268264_10229424 3300028381 Bacteria 1714
322 Ga0265336_10008570 3300028666 Bacteria 3579
323 Ga0307408_100087751 3300031548 Bacteria 2341
324 Ga0307408_100114902 3300031548 Bacteria 2075
325 Ga0265314_10112931 3300031711 Bacteria 1723
326 Ga0307405_10040699 3300031731 Bacteria 2816
327 Ga0307410_10014419 3300031852 Bacteria 4650
328 Ga0307410_10028237 3300031852 Bacteria 3556
329 Ga0307410_10104215 3300031852 Bacteria 2039
330 Ga0307412_10061545 3300031911 Bacteria 2524
331 Ga0307409_100049813 3300031995 Bacteria 3196
332 Ga0307409_100155745 3300031995 Bacteria 1990
333 Ga0307416_100054406 3300032002 Bacteria 3217
334 Ga0307414_10020289 3300032004 Bacteria 4140
335 Ga0307411_10016973 3300032005 Bacteria 4133
336 Ga0307411_10054969 3300032005 Bacteria 2617
337 Ga0307415_100057639 3300032126 Bacteria 2670
338 Ga0373930_0000441 3300034816 Bacteria 5541
339 Ga0373948_0000557 3300034817 Bacteria 4719
340 Ga0373958_0000887 3300034819 Bacteria 3859
341 Ga0373938_0001804 3300034957 Bacteria 3419
342 Ga0373928_0001759 3300035084 Bacteria 4218
343 Ga0373929_0001613 3300035085 Bacteria 4274
344 Ga0373940_0008255 3300035088 Bacteria 2382
345 Ga0373944_0016400 3300035089 Bacteria 2089
346 Ga0373951_0000690 3300035091 Bacteria 9267
347 Ga0373952_0001034 3300035092 Bacteria 5082
348 Ga0373923_0061173 3300035111 Bacteria 1600
349 Ga0373932_0003685 3300035112 Bacteria 3664
350 Ga0373939_0001367 3300035114 Bacteria 5907
351 Ga0373941_0000981 3300035115 Bacteria 5914
352 Ga0373960_0026152 3300035121 Bacteria 1592
353 Ga0373946_0003457 3300035171 Bacteria 5607
354 Ga0373942_0001306 3300035207 Bacteria 6502
355 Ga0373962_0021961 3300035242 Bacteria 1688
356 Ga0373962_0024712 3300035242 Bacteria 1609
357 Ga0373931_0005785 3300035691 Bacteria 5747
358 Ga0373935_0079353 3300035692 Bacteria 2131
359 Ga0373947_0017466 3300035725 Bacteria 4126
360 Ga0373947_0043246 3300035725 Bacteria 2691
361 Ga0373947_0073076 3300035725 Bacteria 2107
362 Ga0373937_0005827 3300036401 Bacteria 10593
363 Ga0373937_0077236 3300036401 Bacteria 3077
364 Ga0373937_0095858 3300036401 Bacteria 2751
365 Ga0373937_0300884 3300036401 Bacteria 1516
366 Ga0373925_0003124 3300037068 Bacteria 12999
367 Ga0373925_0078527 3300037068 Bacteria 2506
368 Ga0400483_039556 3300039062 Bacteria 10415
369 Ga0436365_0524534 3300039437 Bacteria 2654
370 Ga0439453_0014082 3300041408 Bacteria 1367
371 Ga0451855_0795620 3300041511 Bacteria 1542
372 Ga0439433_0016785 3300041999 Bacteria 1622
373 Ga0450923_002608 3300042125 Bacteria 2612
374 Ga0439446_0008260 3300042156 Bacteria 2759
375 Ga0439446_0017105 3300042156 Bacteria 2024
376 Ga0450908_004137 3300042184 Bacteria 2804
377 Ga0439460_0027810 3300042461 Bacteria 1591
378 Ga0451577_0030159 3300042876 Bacteria 4900
379 Ga0453684_0056633 3300044712 Bacteria 5083
380 Ga0453684_0076262 3300044712 Bacteria 4210
381 Ga0451576_0005235 3300045051 Bacteria 16381
382 Ga0451576_0052316 3300045051 Bacteria 4279
383 Ga0466967_0041952 3300045976 Bacteria 3950
384 Ga0495592_0064223 3300046454 Bacteria 2691
385 Ga0495603_0031140 3300046455 Bacteria 3212
386 Ga0495653_0055782 3300046463 Bacteria 3014
387 Ga0495584_0099036 3300046491 Bacteria 1473
388 Ga0495608_0051364 3300046511 Bacteria 2732
389 Ga0495628_0044481 3300046516 Bacteria 3532
390 Ga0495630_0009657 3300046517 Bacteria 6938
391 Ga0495586_0107331 3300046535 Bacteria 1553
392 Ga0495587_0091378 3300046536 Bacteria 1758
393 Ga0495645_0001970 3300046543 Bacteria 13950
394 Ga0495645_0109708 3300046543 Bacteria 1953
395 Ga0495599_0027828 3300046678 Bacteria 3542
396 Ga0495623_0029105 3300046679 Bacteria 3556
397 Ga0495647_0035491 3300046681 Bacteria 1873
398 Ga0495658_0050694 3300046683 Bacteria 2349
399 Ga0495658_0066925 3300046683 Bacteria 2076
400 Ga0495669_0088007 3300046684 Bacteria 1431
401 Ga0495613_0070257 3300046689 Bacteria 2553
402 Ga0495600_0029435 3300046809 Bacteria 3556
403 Ga0495604_0063069 3300047317 Bacteria 2828
404 Ga0495674_0071787 3300047319 Bacteria 2987
405 Ga0495674_0138611 3300047319 Bacteria 2046
406 Ga0495684_0003170 3300047471 Bacteria 12891
407 Ga0496100_0002904 3300048903 Bacteria 8800
408 Ga0496101_0029791 3300048904 Bacteria 3819
409 Ga0496102_0012018 3300048905 Bacteria 7480
410 Ga0496102_0094309 3300048905 Bacteria 2773
411 Ga0496102_0304985 3300048905 Bacteria 1501
412 Ga0496104_0002167 3300048907 Bacteria 17038
413 Ga0496104_0003182 3300048907 Bacteria 14111
414 Ga0496104_0020436 3300048907 Bacteria 6070
415 Ga0496104_0319615 3300048907 Bacteria 1465
416 Ga0496105_0043898 3300048908 Bacteria 3687
417 Ga0496105_0065453 3300048908 Bacteria 3000
418 Ga0496105_0080185 3300048908 Bacteria 2696
419 Ga0496106_0129581 3300048909 Bacteria 1978
420 Ga0496108_0004769 3300048911 Bacteria 10933
421 Ga0496108_0046024 3300048911 Bacteria 3644
422 Ga0496108_0155789 3300048911 Bacteria 1973
423 Ga0496109_0000869 3300048912 Bacteria 25170
424 Ga0496109_0012600 3300048912 Bacteria 7303
425 Ga0496110_0009331 3300048913 Bacteria 7939
426 Ga0496110_0065613 3300048913 Bacteria 3210
427 Ga0496111_0030399 3300048914 Bacteria 3840
428 Ga0496111_0080652 3300048914 Bacteria 2374
429 Ga0496112_0000918 3300048915 Bacteria 21281
430 Ga0496112_0006389 3300048915 Bacteria 10345
431 Ga0496112_0039457 3300048915 Bacteria 4615
432 Ga0496112_0044954 3300048915 Bacteria 4328
433 Ga0496112_0088413 3300048915 Bacteria 3066
434 Ga0496113_0038387 3300048916 Bacteria 3521
435 Ga0496114_0000494 3300048917 Bacteria 28861
436 Ga0496114_0195861 3300048917 Bacteria 1769
437 Ga0496114_0273397 3300048917 Bacteria 1489
438 Ga0496116_0000815 3300048919 Bacteria 39464
439 Ga0496122_0000349 3300048925 Bacteria 99749
440 Ga0496122_0023007 3300048925 Bacteria 5515
441 Ga0496123_0024362 3300048926 Bacteria 4602
442 Ga0496125_0000574 3300048928 Bacteria 62986
443 Ga0496125_0014145 3300048928 Bacteria 7786
444 Ga0496125_0039832 3300048928 Bacteria 4040
445 Ga0496126_0000424 3300048929 Bacteria 85019
446 Ga0496126_0066038 3300048929 Bacteria 3236
447 Ga0501032_0004704 3300049569 Bacteria 10237
448 Ga0501033_0045609 3300049570 Bacteria 3261
449 Ga0501034_0013282 3300049571 Bacteria 8486
450 Ga0501034_0013896 3300049571 Bacteria 8289
451 Ga0501034_0015056 3300049571 Bacteria 7951
452 Ga0501034_0032055 3300049571 Bacteria 5339
453 Ga0501036_0009593 3300049572 Bacteria 7960
454 Ga0501036_0016338 3300049572 Bacteria 6201
455 Ga0501036_0101653 3300049572 Bacteria 2432
456 Ga0501036_0124735 3300049572 Bacteria 2174
457 Ga0501036_0126719 3300049572 Bacteria 2156
458 Ga0501037_0002266 3300049573 Bacteria 13901
459 Ga0501037_0002567 3300049573 Bacteria 13115
460 Ga0501038_0005902 3300049574 Bacteria 11316
461 Ga0501039_0018193 3300049575 Bacteria 5394
462 Ga0501040_0004136 3300049576 Bacteria 9443
463 Ga0501040_0006238 3300049576 Bacteria 7740
464 Ga0501040_0045941 3300049576 Bacteria 2981
465 Ga0501041_0010308 3300049577 Bacteria 5507
466 Ga0501041_0022760 3300049577 Bacteria 3754
467 Ga0501041_0149784 3300049577 Bacteria 1456
468 Ga0501042_0001424 3300049578 Bacteria 14078
469 Ga0501042_0002431 3300049578 Bacteria 11427
470 Ga0501042_0086827 3300049578 Bacteria 2244
471 Ga0501043_0003546 3300049579 Bacteria 12818
472 Ga0501043_0031965 3300049579 Bacteria 4136
473 Ga0501043_0039369 3300049579 Bacteria 3715
474 Ga0501046_0002275 3300049580 Bacteria 18106
475 Ga0501046_0054732 3300049580 Bacteria 3137
476 Ga0501046_0063267 3300049580 Bacteria 2889
477 Ga0501046_0070814 3300049580 Bacteria 2710
478 Ga0501047_0030091 3300049581 Bacteria 5234
479 Ga0501047_0038630 3300049581 Bacteria 4618
480 Ga0501047_0043788 3300049581 Bacteria 4324
481 Ga0501048_0002414 3300049582 Bacteria 14253
482 Ga0501048_0003455 3300049582 Bacteria 12008
483 Ga0501048_0045271 3300049582 Bacteria 3143
484 Ga0501048_0052050 3300049582 Bacteria 2913
485 Ga0501048_0099953 3300049582 Bacteria 2046
486 Ga0501067_0000782 3300049583 Bacteria 17114
487 Ga0501067_0070322 3300049583 Bacteria 1938
488 Ga0501068_0004277 3300049584 Bacteria 7755
489 Ga0501069_0002468 3300049585 Bacteria 9433
490 Ga0501069_0038187 3300049585 Bacteria 2651
491 Ga0501070_0005948 3300049586 Bacteria 10398
492 Ga0501071_0006748 3300049587 Bacteria 7472
493 Ga0501071_0016306 3300049587 Bacteria 5109
494 Ga0501071_0019912 3300049587 Bacteria 4660
495 Ga0501071_0056395 3300049587 Bacteria 2838
496 Ga0501071_0067384 3300049587 Bacteria 2603
497 Ga0501071_0067647 3300049587 Bacteria 2598
498 Ga0501071_0119224 3300049587 Bacteria 1955
499 Ga0501072_0016341 3300049588 Bacteria 5694
500 Ga0501072_0017659 3300049588 Bacteria 5487
501 Ga0501072_0061899 3300049588 Bacteria 2952
502 Ga0501072_0099199 3300049588 Bacteria 2315
503 Ga0501073_0002917 3300049589 Bacteria 12835
504 Ga0501073_0005139 3300049589 Bacteria 9820
505 Ga0501073_0007964 3300049589 Bacteria 7864
506 Ga0501074_0002067 3300049590 Bacteria 13873
507 Ga0501075_0001274 3300049591 Bacteria 16341
508 Ga0501075_0007335 3300049591 Bacteria 7647
509 Ga0501076_0005066 3300049592 Bacteria 9434
510 Ga0501076_0065901 3300049592 Bacteria 2889
511 Ga0501076_0089690 3300049592 Bacteria 2472
512 Ga0501076_0101039 3300049592 Bacteria 2324
513 Ga0501076_0138260 3300049592 Bacteria 1978
514 Ga0501076_0158808 3300049592 Bacteria 1841
515 Ga0501077_0015655 3300049593 Bacteria 4777
516 Ga0501077_0090010 3300049593 Bacteria 1945
517 Ga0501079_0001902 3300049741 Bacteria 14973
518 Ga0501079_0050762 3300049741 Bacteria 3201
519 Ga0501079_0177126 3300049741 Bacteria 1663
520 Ga0501080_0015434 3300049742 Bacteria 7041
521 Ga0501080_0021766 3300049742 Bacteria 5939
522 Ga0501080_0050302 3300049742 Bacteria 3879
523 Ga0501080_0087756 3300049742 Bacteria 2889
524 Ga0501081_0001000 3300049743 Bacteria 16843
525 Ga0501081_0052995 3300049743 Bacteria 2800
526 Ga0501083_0018618 3300049744 Bacteria 4838
527 Ga0501083_0085637 3300049744 Bacteria 2085
528 Ga0501083_0098078 3300049744 Bacteria 1933
529 Ga0501035_0019824 3300049822 Bacteria 6178
530 Ga0501035_0099096 3300049822 Bacteria 2558
531 Ga0501035_0143590 3300049822 Bacteria 2074
532 Ga0501044_0101794 3300049823 Bacteria 2889
533 Ga0501045_0001367 3300049824 Bacteria 16231
534 Ga0501045_0018171 3300049824 Bacteria 4997
535 Ga0501045_0036744 3300049824 Bacteria 3558
536 Ga0501045_0067868 3300049824 Bacteria 2619
537 Ga0501045_0085246 3300049824 Bacteria 2331
538 Ga0501045_0090057 3300049824 Bacteria 2266
539 nmdc:mga03683_26814_c1 3300050489 Bacteria 2277
540 nmdc:mga00v17_28120_c1 3300050491 Bacteria 3291
541 nmdc:mga00v17_48985_c1 3300050491 Bacteria 2562
542 nmdc:mga00v17_5561_c1 3300050491 Bacteria 6642
543 nmdc:mga0yw44_107822_c1 3300050492 Bacteria 1781
544 nmdc:mga0yw44_22581_c1 3300050492 Bacteria 3530
545 nmdc:mga0k408_12780_c1 3300050493 Bacteria 4593
546 nmdc:mga0k408_2125_c1 3300050493 Bacteria 10615
547 nmdc:mga0k408_4013_c1 3300050493 Bacteria 7810
548 nmdc:mga0k408_42982_c1 3300050493 Bacteria 2603
549 nmdc:mga06z11_101975_c1 3300050494 Bacteria 1576
550 nmdc:mga06z11_7360_c1 3300050494 Bacteria 4524
551 nmdc:mga06z11_76999_c1 3300050494 Bacteria 1780
552 nmdc:mga07m45_3761_c1 3300050496 Bacteria 7342
553 nmdc:mga05p37_10752_c1 3300050507 Bacteria 10865
554 nmdc:mga05p37_174_c1 3300050507 Bacteria 62666
555 nmdc:mga05p37_1991_c1 3300050507 Bacteria 23842
556 nmdc:mga05p37_211412_c1 3300050507 Bacteria 2345
557 nmdc:mga05p37_25037_c1 3300050507 Bacteria 7255
558 nmdc:mga05p37_28754_c1 3300050507 Bacteria 6781
559 nmdc:mga05p37_38671_c1 3300050507 Bacteria 5854
560 nmdc:mga05p37_79286_c1 3300050507 Bacteria 4044
561 nmdc:mga05p37_90050_c1 3300050507 Bacteria 3781
562 nmdc:mga09592_147875_c1 3300050508 Bacteria 2026
563 nmdc:mga09592_36441_c1 3300050508 Bacteria 4120
564 nmdc:mga09592_86359_c1 3300050508 Bacteria 2677
565 nmdc:mga0qj67_11170_c1 3300050509 Bacteria 6725
566 nmdc:mga0qj67_14596_c1 3300050509 Bacteria 5939
567 nmdc:mga0qj67_23016_c1 3300050509 Bacteria 4789
568 nmdc:mga0qj67_41323_c1 3300050509 Bacteria 3626
569 nmdc:mga06r32_16241_c1 3300050510 Bacteria 6781
570 nmdc:mga06r32_25841_c1 3300050510 Bacteria 5466
571 nmdc:mga06r32_297470_c1 3300050510 Bacteria 1600
572 nmdc:mga06r32_43448_c1 3300050510 Bacteria 4276
573 nmdc:mga08y16_141291_c1 3300050511 Bacteria 2503
574 nmdc:mga08y16_22244_c1 3300050511 Bacteria 6690
575 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
576 nmdc:mga08y16_33801_c1 3300050511 Bacteria 5371
577 nmdc:mga08y16_61461_c1 3300050511 Bacteria 3923
578 nmdc:mga08y16_7358_c1 3300050511 Bacteria 11548
579 nmdc:mga08y16_74127_c1 3300050511 Bacteria 3546
580 nmdc:mga08y16_8235_c1 3300050511 Bacteria 10905
581 nmdc:mga0n895_13885_c1 3300050512 Bacteria 7292
582 nmdc:mga0n895_139476_c1 3300050512 Bacteria 2452
583 nmdc:mga0n895_205450_c1 3300050512 Bacteria 2000
584 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
585 nmdc:mga0n895_281415_c1 3300050512 Bacteria 1687
586 nmdc:mga0n895_29979_c1 3300050512 Bacteria 5194
587 nmdc:mga0n895_3182_c1 3300050512 Bacteria 13119
588 nmdc:mga0n895_67811_c1 3300050512 Bacteria 3534
589 nmdc:mga0rr50_132_c1 3300050513 Bacteria 40800
590 nmdc:mga0rr50_145140_c1 3300050513 Bacteria 1913
591 nmdc:mga0rr50_175_c1 3300050513 Bacteria 34417
592 nmdc:mga0rr50_50838_c1 3300050513 Bacteria 3073
593 nmdc:mga0rr50_75340_c1 3300050513 Bacteria 2586
594 nmdc:mga08x19_954_c1 3300050514 Bacteria 18158
595 nmdc:mga0a205_20223_c1 3300050515 Bacteria 6279
596 nmdc:mga0a205_203574_c1 3300050515 Bacteria 1869
597 nmdc:mga0a205_26590_c1 3300050515 Bacteria 4003
598 nmdc:mga0a205_43843_c1 3300050515 Bacteria 4312
599 nmdc:mga0a205_72618_c1 3300050515 Bacteria 3325
600 nmdc:mga0a205_81626_c1 3300050515 Bacteria 3123
601 Ga0495601_0016819 3300053077 Bacteria 4437
602 Ga0495619_0017244 3300053085 Bacteria 4572
603 Ga0495619_0030649 3300053085 Bacteria 3482
604 Ga0495619_0031918 3300053085 Bacteria 3415
605 Ga0500555_000499 3300053103 Bacteria 15999
606 Ga0500556_0044243 3300053104 Bacteria 1584
607 Ga0500568_0003412 3300053139 Bacteria 8870
608 Ga0500616_0000357 3300053153 Bacteria 64980
609 Ga0500645_001011 3300053730 Bacteria 15815
610 Ga0501084_0003838 3300054114 Bacteria 12230
611 Ga0501084_0018012 3300054114 Bacteria 5882
612 Ga0501084_0019295 3300054114 Bacteria 5680
613 Ga0501084_0058046 3300054114 Bacteria 3238
614 Ga0590071_001237 3300059421 Bacteria 6908
615 Ga0590071_002281 3300059421 Bacteria 4854
616 Ga0590074_001098 3300059423 Bacteria 4263
617 Ga0590077_001268 3300059426 Bacteria 6039
618 Ga0501082_0003127 3300060353 Bacteria 14437
619 Ga0501082_0007448 3300060353 Bacteria 9445
620 Ga0501082_0063280 3300060353 Bacteria 3186
621 Ga0501082_0118569 3300060353 Bacteria 2293
622 Ga0501082_0119482 3300060353 Bacteria 2284
623 Ga0501082_0136285 3300060353 Bacteria 2130
624 Ga0530510_0001585 3300061734 Bacteria 15338
625 Ga0530510_0003022 3300061734 Bacteria 11553
626 Ga0530510_0038208 3300061734 Bacteria 3466
627 Ga0530510_0044052 3300061734 Bacteria 3224
628 Ga0530510_0094472 3300061734 Bacteria 2184
629 Ga0065715_10095716
630 JGI24751J29686_10011478
631 Ga0065712_10003788
632 Ga0065712_10070494
633 Ga0065712_10072809
634 Ga0065712_10074835
635 Ga0065712_10081865
636 Ga0065715_10000948
637 Ga0065707_10001756
638 Ga0065707_10019567
639 Ga0065707_10099613
640 Ga0065707_10141556
641 Ga0070676_10024444
642 Ga0070683_100000094
643 Ga0070683_100015813
644 Ga0070670_100004478
645 Ga0070670_100006909
646 Ga0070670_100008888
647 Ga0070670_100020449
648 Ga0070670_100034099
649 Ga0070670_100103477
650 Ga0068869_100149393
651 Ga0070666_10016999
652 Ga0070660_100011435
653 Ga0070691_10088045
654 Ga0070687_100074041
655 Ga0070661_100001504
656 Ga0070668_100033204
657 Ga0070669_100001822
658 Ga0070669_100001826
659 Ga0070669_100071654
660 Ga0070669_100197626
661 Ga0070675_100000126
662 Ga0070675_100030848
663 Ga0070675_100034056
664 Ga0070675_100069557
665 Ga0070675_100173071
666 Ga0070671_100014812
667 Ga0070671_100030807
668 Ga0070671_100034791
669 Ga0070671_100096726
670 Ga0070674_100009134
671 Ga0070674_100025038
672 Ga0070674_100079368
673 Ga0070673_100014365
674 Ga0070673_100024733
675 Ga0070673_100042176
676 Ga0070688_100161770
677 Ga0070667_100023967
678 Ga0070714_100007866
679 Ga0070701_10027212
680 Ga0070711_100102635
681 Ga0070705_100012340
682 Ga0070708_100000162
683 Ga0070663_100031649
684 Ga0070662_100156363
685 Ga0068867_100228558
686 Ga0070698_100046350
687 Ga0070698_100054713
688 Ga0070699_100001694
689 Ga0070699_100028109
690 Ga0070679_100028072
691 Ga0070679_100074307
692 Ga0070684_100000166
693 Ga0070672_100056176
694 Ga0070686_100000486
695 Ga0070695_100011283
696 Ga0070695_100032173
697 Ga0070665_100001142
698 Ga0070665_100023391
699 Ga0070665_100111511
700 Ga0070665_100218077
701 Ga0070704_100008602
702 Ga0070664_100000479
703 Ga0070664_100017862
704 Ga0070664_100092357
705 Ga0068857_100088516
706 Ga0068854_100012140
707 Ga0068854_100060652
708 Ga0068856_100194009
709 Ga0068859_100012501
710 Ga0068859_100043379
711 Ga0068859_100155036
712 Ga0068859_100187387
713 Ga0068864_100105780
714 Ga0068864_100138272
715 Ga0068866_10051816
716 Ga0068861_100044855
717 Ga0068863_100002641
718 Ga0068863_100091208
719 Ga0068863_100187754
720 Ga0068858_100001750
721 Ga0068858_100044229
722 Ga0068858_100058941
723 Ga0068858_100110332
724 Ga0068858_100181638
725 Ga0068858_100250448
726 Ga0068860_100204813
727 Ga0068860_100337354
728 Ga0068862_100003872
729 Ga0068862_100032463
730 Ga0068862_100069193
731 Ga0068862_100103821
732 Ga0081455_10033236
733 Ga0081539_10032414
734 Ga0075365_10023639
735 Ga0075368_10010990
736 Ga0075368_10029383
737 Ga0075364_10012231
738 Ga0075364_10094940
739 Ga0075367_10006328
740 Ga0075367_10021992
741 Ga0075367_10042952
742 Ga0075367_10047619
743 Ga0075366_10005550
744 Ga0075366_10019318
745 Ga0075366_10063890
746 Ga0097621_100001492
747 Ga0097621_100002965
748 Ga0097621_100028749
749 Ga0097621_100054521
750 Ga0097621_100223723
751 Ga0075370_10006583
752 Ga0068871_100007809
753 Ga0068871_100037728
754 Ga0068871_100060378
755 Ga0068871_100085065
756 Ga0068871_100131725
757 Ga0068871_100172716
758 Ga0075428_100000017
759 Ga0075428_100003278
760 Ga0075428_100005429
761 Ga0075428_100008684
762 Ga0075428_100036637
763 Ga0075428_100303756
764 Ga0075430_100005222
765 Ga0075430_100017112
766 Ga0075430_100055833
767 Ga0075430_100172356
768 Ga0075431_100003437
769 Ga0075431_100031118
770 Ga0075431_100188792
771 Ga0075431_100321780
772 Ga0075433_10026586
773 Ga0075433_10029168
774 Ga0075433_10084562
775 Ga0075433_10138524
776 Ga0075433_10147817
777 Ga0075433_10200726
778 Ga0075434_100001891
779 Ga0075434_100014324
780 Ga0075434_100022053
781 Ga0075429_100112902
782 Ga0068865_100000768
783 Ga0068865_100158979
784 Ga0075436_100001121
785 Ga0075436_100020929
786 Ga0075436_100027279
787 Ga0097620_100012502
788 Ga0097620_100043380
789 Ga0097620_100155039
790 Ga0097620_100187389
791 Ga0075435_100000342
792 Ga0075435_100001286
793 Ga0075435_100001999
794 Ga0075435_100002624
795 Ga0075435_100009261
796 Ga0075435_100046688
797 Ga0105240_10055960
798 Ga0105240_10105162
799 Ga0111539_10000002
800 Ga0111539_10007496
801 Ga0111539_10019212
802 Ga0111539_10034772
803 Ga0111539_10120022
804 Ga0111539_10165743
805 Ga0105245_10059423
806 Ga0105245_10063005
807 Ga0114129_10000509
808 Ga0114129_10001667
809 Ga0114129_10003035
810 Ga0114129_10009415
811 Ga0114129_10009699
812 Ga0114129_10014680
813 Ga0114129_10020336
814 Ga0114129_10054015
815 Ga0114129_10058610
816 Ga0114129_10186842
817 Ga0105241_10047376
818 Ga0105248_10004266
819 Ga0105248_10024004
820 Ga0105248_10026969
821 Ga0105248_10102509
822 Ga0105248_10138322
823 Ga0105248_10184596
824 Ga0105248_10266326
825 Ga0105249_10005969
826 Ga0105249_10040966
827 Ga0105249_10110728
828 Ga0105249_10251709
829 Ga0157374_10058802
830 Ga0157374_10333221
831 Ga0157374_10360290
832 Ga0157378_10100195
833 Ga0163162_10012905
834 Ga0163162_10219281
835 Ga0157375_10167031
836 Ga0157375_10382497
837 Ga0163163_10003727
838 Ga0163163_10029039
839 Ga0163163_10219336
840 Ga0157380_10011831
841 Ga0157380_10012730
842 Ga0157380_10050159
843 Ga0157380_10063406
844 Ga0157377_10040929
845 Ga0157379_10006964
846 Ga0157379_10046448
847 Ga0157379_10050038
848 Ga0157379_10050918
849 Ga0157379_10084538
850 Ga0157376_10007845
851 Ga0157376_10008007
852 Ga0157376_10172096
853 Ga0207697_10011895
854 Ga0207688_10028214
855 Ga0207647_10058576
856 Ga0207645_10033518
857 Ga0207643_10037681
858 Ga0207654_10086014
859 Ga0207707_10197614
860 Ga0207695_10039395
861 Ga0207663_10084762
862 Ga0207662_10011144
863 Ga0207662_10018922
864 Ga0207657_10005005
865 Ga0207657_10067902
866 Ga0207649_10010919
867 Ga0207652_10022007
868 Ga0207652_10084407
869 Ga0207681_10004627
870 Ga0207681_10014196
871 Ga0207681_10072528
872 Ga0207681_10114895
873 Ga0207650_10003836
874 Ga0207650_10014293
875 Ga0207650_10015514
876 Ga0207659_10000390
877 Ga0207659_10042679
878 Ga0207659_10107442
879 Ga0207644_10010148
880 Ga0207644_10142973
881 Ga0207706_10019072
882 Ga0207706_10076550
883 Ga0207706_10114722
884 Ga0207686_10007943
885 Ga0207686_10096590
886 Ga0207670_10105661
887 Ga0207669_10016642
888 Ga0207704_10095550
889 Ga0207691_10035100
890 Ga0207691_10053787
891 Ga0207691_10079823
892 Ga0207711_10010209
893 Ga0207711_10019590
894 Ga0207711_10044920
895 Ga0207711_10135936
896 Ga0207711_10207639
897 Ga0207711_10287012
898 Ga0207661_10065930
899 Ga0207661_10124148
900 Ga0207679_10002245
901 Ga0207679_10029861
902 Ga0207679_10043426
903 Ga0207679_10106771
904 Ga0207651_10082337
905 Ga0207712_10200293
906 Ga0207668_10199597
907 Ga0207658_10032627
908 Ga0207658_10051075
909 Ga0207677_10145233
910 Ga0207703_10003700
911 Ga0207703_10014502
912 Ga0207703_10052596
913 Ga0207703_10159697
914 Ga0207678_10040510
915 Ga0207678_10181967
916 Ga0207708_10010053
917 Ga0207708_10030974
918 Ga0207708_10033577
919 Ga0207641_10012095
920 Ga0207641_10191323
921 Ga0207641_10194986
922 Ga0207648_10023964
923 Ga0207648_10042908
924 Ga0207648_10083579
925 Ga0207648_10141879
926 Ga0207676_10006796
927 Ga0207676_10017193
928 Ga0207676_10155794
929 Ga0207674_10089536
930 Ga0207674_10095976
931 Ga0207675_100009283
932 Ga0207675_100085552
933 Ga0207683_10030430
934 Ga0209971_1013155
935 Ga0207428_10000004
936 Ga0207428_10004630
937 Ga0207428_10005890
938 Ga0207428_10024129
939 Ga0207428_10027128
940 Ga0207428_10036140
941 Ga0268266_10028632
942 Ga0268266_10033789
943 Ga0268266_10035948
944 Ga0268265_10001769
945 Ga0268265_10049460
946 Ga0268265_10097487
947 Ga0268264_10072000
948 Ga0268264_10211732
949 Ga0268264_10229424
950 Ga0265336_10008570
951 Ga0307408_100087751
952 Ga0307408_100114902
953 Ga0265314_10112931
954 Ga0307405_10040699
955 Ga0307410_10014419
956 Ga0307410_10028237
957 Ga0307410_10104215
958 Ga0307412_10061545
959 Ga0307409_100049813
960 Ga0307409_100155745
961 Ga0307416_100054406
962 Ga0307414_10020289
963 Ga0307411_10016973
964 Ga0307411_10054969
965 Ga0307415_100057639
966 Ga0373930_0000441
967 Ga0373948_0000557
968 Ga0373958_0000887
969 Ga0373938_0001804
970 Ga0373928_0001759
971 Ga0373929_0001613
972 Ga0373940_0008255
973 Ga0373944_0016400
974 Ga0373951_0000690
975 Ga0373952_0001034
976 Ga0373923_0061173
977 Ga0373932_0003685
978 Ga0373939_0001367
979 Ga0373941_0000981
980 Ga0373960_0026152
981 Ga0373946_0003457
982 Ga0373942_0001306
983 Ga0373962_0021961
984 Ga0373962_0024712
985 Ga0373931_0005785
986 Ga0373935_0079353
987 Ga0373947_0017466
988 Ga0373947_0043246
989 Ga0373947_0073076
990 Ga0373937_0005827
991 Ga0373937_0077236
992 Ga0373937_0095858
993 Ga0373937_0300884
994 Ga0373925_0003124
995 Ga0373925_0078527
996 Ga0400483_039556
997 Ga0436365_0524534
998 Ga0439453_0014082
999 Ga0451855_0795620
1000 Ga0439433_0016785
1001 Ga0450923_002608
1002 Ga0439446_0008260
1003 Ga0439446_0017105
1004 Ga0450908_004137
1005 Ga0439460_0027810
1006 Ga0451577_0030159
1007 Ga0453684_0056633
1008 Ga0453684_0076262
1009 Ga0451576_0005235
1010 Ga0451576_0052316
1011 Ga0466967_0041952
1012 Ga0495592_0064223
1013 Ga0495603_0031140
1014 Ga0495653_0055782
1015 Ga0495584_0099036
1016 Ga0495608_0051364
1017 Ga0495628_0044481
1018 Ga0495630_0009657
1019 Ga0495586_0107331
1020 Ga0495587_0091378
1021 Ga0495645_0001970
1022 Ga0495645_0109708
1023 Ga0495599_0027828
1024 Ga0495623_0029105
1025 Ga0495647_0035491
1026 Ga0495658_0050694
1027 Ga0495658_0066925
1028 Ga0495669_0088007
1029 Ga0495613_0070257
1030 Ga0495600_0029435
1031 Ga0495604_0063069
1032 Ga0495674_0071787
1033 Ga0495674_0138611
1034 Ga0495684_0003170
1035 Ga0496100_0002904
1036 Ga0496101_0029791
1037 Ga0496102_0012018
1038 Ga0496102_0094309
1039 Ga0496102_0304985
1040 Ga0496104_0002167
1041 Ga0496104_0003182
1042 Ga0496104_0020436
1043 Ga0496104_0319615
1044 Ga0496105_0043898
1045 Ga0496105_0065453
1046 Ga0496105_0080185
1047 Ga0496106_0129581
1048 Ga0496108_0004769
1049 Ga0496108_0046024
1050 Ga0496108_0155789
1051 Ga0496109_0000869
1052 Ga0496109_0012600
1053 Ga0496110_0009331
1054 Ga0496110_0065613
1055 Ga0496111_0030399
1056 Ga0496111_0080652
1057 Ga0496112_0000918
1058 Ga0496112_0006389
1059 Ga0496112_0039457
1060 Ga0496112_0044954
1061 Ga0496112_0088413
1062 Ga0496113_0038387
1063 Ga0496114_0000494
1064 Ga0496114_0195861
1065 Ga0496114_0273397
1066 Ga0496116_0000815
1067 Ga0496122_0000349
1068 Ga0496122_0023007
1069 Ga0496123_0024362
1070 Ga0496125_0000574
1071 Ga0496125_0014145
1072 Ga0496125_0039832
1073 Ga0496126_0000424
1074 Ga0496126_0066038
1075 Ga0501032_0004704
1076 Ga0501033_0045609
1077 Ga0501034_0013282
1078 Ga0501034_0013896
1079 Ga0501034_0015056
1080 Ga0501034_0032055
1081 Ga0501036_0009593
1082 Ga0501036_0016338
1083 Ga0501036_0101653
1084 Ga0501036_0124735
1085 Ga0501036_0126719
1086 Ga0501037_0002266
1087 Ga0501037_0002567
1088 Ga0501038_0005902
1089 Ga0501039_0018193
1090 Ga0501040_0004136
1091 Ga0501040_0006238
1092 Ga0501040_0045941
1093 Ga0501041_0010308
1094 Ga0501041_0022760
1095 Ga0501041_0149784
1096 Ga0501042_0001424
1097 Ga0501042_0002431
1098 Ga0501042_0086827
1099 Ga0501043_0003546
1100 Ga0501043_0031965
1101 Ga0501043_0039369
1102 Ga0501046_0002275
1103 Ga0501046_0054732
1104 Ga0501046_0063267
1105 Ga0501046_0070814
1106 Ga0501047_0030091
1107 Ga0501047_0038630
1108 Ga0501047_0043788
1109 Ga0501048_0002414
1110 Ga0501048_0003455
1111 Ga0501048_0045271
1112 Ga0501048_0052050
1113 Ga0501048_0099953
1114 Ga0501067_0000782
1115 Ga0501067_0070322
1116 Ga0501068_0004277
1117 Ga0501069_0002468
1118 Ga0501069_0038187
1119 Ga0501070_0005948
1120 Ga0501071_0006748
1121 Ga0501071_0016306
1122 Ga0501071_0019912
1123 Ga0501071_0056395
1124 Ga0501071_0067384
1125 Ga0501071_0067647
1126 Ga0501071_0119224
1127 Ga0501072_0016341
1128 Ga0501072_0017659
1129 Ga0501072_0061899
1130 Ga0501072_0099199
1131 Ga0501073_0002917
1132 Ga0501073_0005139
1133 Ga0501073_0007964
1134 Ga0501074_0002067
1135 Ga0501075_0001274
1136 Ga0501075_0007335
1137 Ga0501076_0005066
1138 Ga0501076_0065901
1139 Ga0501076_0089690
1140 Ga0501076_0101039
1141 Ga0501076_0138260
1142 Ga0501076_0158808
1143 Ga0501077_0015655
1144 Ga0501077_0090010
1145 Ga0501079_0001902
1146 Ga0501079_0050762
1147 Ga0501079_0177126
1148 Ga0501080_0015434
1149 Ga0501080_0021766
1150 Ga0501080_0050302
1151 Ga0501080_0087756
1152 Ga0501081_0001000
1153 Ga0501081_0052995
1154 Ga0501083_0018618
1155 Ga0501083_0085637
1156 Ga0501083_0098078
1157 Ga0501035_0019824
1158 Ga0501035_0099096
1159 Ga0501035_0143590
1160 Ga0501044_0101794
1161 Ga0501045_0001367
1162 Ga0501045_0018171
1163 Ga0501045_0036744
1164 Ga0501045_0067868
1165 Ga0501045_0085246
1166 Ga0501045_0090057
1167 nmdc:mga03683_26814_c1
1168 nmdc:mga00v17_28120_c1
1169 nmdc:mga00v17_48985_c1
1170 nmdc:mga00v17_5561_c1
1171 nmdc:mga0yw44_107822_c1
1172 nmdc:mga0yw44_22581_c1
1173 nmdc:mga0k408_12780_c1
1174 nmdc:mga0k408_2125_c1
1175 nmdc:mga0k408_4013_c1
1176 nmdc:mga0k408_42982_c1
1177 nmdc:mga06z11_101975_c1
1178 nmdc:mga06z11_7360_c1
1179 nmdc:mga06z11_76999_c1
1180 nmdc:mga07m45_3761_c1
1181 nmdc:mga05p37_10752_c1
1182 nmdc:mga05p37_174_c1
1183 nmdc:mga05p37_1991_c1
1184 nmdc:mga05p37_211412_c1
1185 nmdc:mga05p37_25037_c1
1186 nmdc:mga05p37_28754_c1
1187 nmdc:mga05p37_38671_c1
1188 nmdc:mga05p37_79286_c1
1189 nmdc:mga05p37_90050_c1
1190 nmdc:mga09592_147875_c1
1191 nmdc:mga09592_36441_c1
1192 nmdc:mga09592_86359_c1
1193 nmdc:mga0qj67_11170_c1
1194 nmdc:mga0qj67_14596_c1
1195 nmdc:mga0qj67_23016_c1
1196 nmdc:mga0qj67_41323_c1
1197 nmdc:mga06r32_16241_c1
1198 nmdc:mga06r32_25841_c1
1199 nmdc:mga06r32_297470_c1
1200 nmdc:mga06r32_43448_c1
1201 nmdc:mga08y16_141291_c1
1202 nmdc:mga08y16_22244_c1
1203 nmdc:mga08y16_2_c1
1204 nmdc:mga08y16_33801_c1
1205 nmdc:mga08y16_61461_c1
1206 nmdc:mga08y16_7358_c1
1207 nmdc:mga08y16_74127_c1
1208 nmdc:mga08y16_8235_c1
1209 nmdc:mga0n895_13885_c1
1210 nmdc:mga0n895_139476_c1
1211 nmdc:mga0n895_205450_c1
1212 nmdc:mga0n895_227_c1
1213 nmdc:mga0n895_281415_c1
1214 nmdc:mga0n895_29979_c1
1215 nmdc:mga0n895_3182_c1
1216 nmdc:mga0n895_67811_c1
1217 nmdc:mga0rr50_132_c1
1218 nmdc:mga0rr50_145140_c1
1219 nmdc:mga0rr50_175_c1
1220 nmdc:mga0rr50_50838_c1
1221 nmdc:mga0rr50_75340_c1
1222 nmdc:mga08x19_954_c1
1223 nmdc:mga0a205_20223_c1
1224 nmdc:mga0a205_203574_c1
1225 nmdc:mga0a205_26590_c1
1226 nmdc:mga0a205_43843_c1
1227 nmdc:mga0a205_72618_c1
1228 nmdc:mga0a205_81626_c1
1229 Ga0495601_0016819
1230 Ga0495619_0017244
1231 Ga0495619_0030649
1232 Ga0495619_0031918
1233 Ga0500555_000499
1234 Ga0500556_0044243
1235 Ga0500568_0003412
1236 Ga0500616_0000357
1237 Ga0500645_001011
1238 Ga0501084_0003838
1239 Ga0501084_0018012
1240 Ga0501084_0019295
1241 Ga0501084_0058046
1242 Ga0590071_001237
1243 Ga0590071_002281
1244 Ga0590074_001098
1245 Ga0590077_001268
1246 Ga0501082_0003127
1247 Ga0501082_0007448
1248 Ga0501082_0063280
1249 Ga0501082_0118569
1250 Ga0501082_0119482
1251 Ga0501082_0136285
1252 Ga0530510_0001585
1253 Ga0530510_0003022
1254 Ga0530510_0038208
1255 Ga0530510_0044052
1256 Ga0530510_0094472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00772

DnaB

DnaB-like helicase N terminal domain

42

144

0.99

PF03796

DnaB_C

DnaB-like helicase C terminal domain

218

477

0.96

PF13481

AAA_25

AAA domain

225

400

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwe-assembly1.cif.gz_A nmr structure of the n-terminal domain of e. coli dnab helicase 0.9576 8 119
1b79-assembly2.cif.gz_B n-terminal domain of dna replication protein dnab 0.9546 11 110
2r5u-assembly1.cif.gz_F crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9477 9 148
2r5u-assembly1.cif.gz_E crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9395 9 150
2r5u-assembly1.cif.gz_C crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9388 9 149
ID Description Score Start End Superfamily
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9752 8 130 1.10.860.10
4esvI01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9747 9 130 1.10.860.10
2r6dE01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9708 11 130 1.10.860.10
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9675 8 130 1.10.860.10
2vyfB01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9642 8 130 1.10.860.10
ID Description Score Start End GO Terms
AF-A0A5J4P5R4-F1-model_v4 Replicative DNA helicase (EC 3.6.4.12) 0.9757 185 358 GO:0005524
GO:0005829
GO:0006268
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A358M8H0-F1-model_v4 Replicative DNA helicase 0.9745 206 445 GO:0003678
GO:0005524
GO:0005829
GO:0006268
AF-X1VAQ0-F1-model_v4 DNA 5'-3' helicase (EC 5.6.2.3) 0.9688 185 404 GO:0003678
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0016887
GO:1990077
AF-A0A2V6KQZ5-F1-model_v4 DNA 5'-3' helicase (EC 5.6.2.3) 0.9681 196 445 GO:0003678
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0016887
GO:1990077
AF-R7N0Z2-F1-model_v4 Replicative DNA helicase (EC 5.6.2.3) 0.9654 200 446 GO:0003677
GO:0003689
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0009378
GO:0016887
GO:0036121
GO:0061749
GO:0061775
GO:0140584
GO:0140665
GO:0140849
GO:1990077
GO:1990518

Map