F470601

General Info

Members Datasets Scaffolds Average Seq Length
627 265 627 247

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_634766_c1|nmdc:mga0a205_634766_c1_13_876
Length 287
Sequence MPAEANVPADEKGNPAMSIDRDVFFDVLGGEQAAAAMSDEAKADALEHYLIESLNDTAYLDSPGYVEEQATFLQSSTPVNRRGTGAIFGDGHRDPPPLAPMPERPTLVDFFLLRMSMPTVRHLLQSATDAMKTDASEEQILACLLHDLGQAVMKVDHGWWGAQMVEPYVSEKVAWAIRYHQALRFFPDESVGYTYPELYVHIYGQDYVPEPYIRQAYQHARQHRWYMDARMVTVHDLYAFDPHATVSLDPFLDIIGRNFRQPEEGLGFDGSPVAHMWRSLIYPDHRL

Samples

Sample ID Description Type Environment
1 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 2.39
Rhizosphere 95.37
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1000333 3300003347 Bacteria 2439
2 Ga0065715_10132737 3300005293 Bacteria 1980
3 Ga0065707_10005661 3300005295 Bacteria 3073
4 Ga0065707_10215216 3300005295 Unclassified 1248
5 Ga0065707_10255577 3300005295 Bacteria 1112
6 Ga0070676_10032931 3300005328 Bacteria 2971
7 Ga0070676_10115422 3300005328 Unclassified 1678
8 Ga0070683_100065748 3300005329 Bacteria 3377
9 Ga0070690_100217698 3300005330 Bacteria 1336
10 Ga0070670_100019652 3300005331 Bacteria 5798
11 Ga0070670_100602666 3300005331 Bacteria 983
12 Ga0068869_100005890 3300005334 Bacteria 7740
13 Ga0068869_100032040 3300005334 Bacteria 3702
14 Ga0070680_100001053 3300005336 Bacteria 19744
15 Ga0070680_100006965 3300005336 Bacteria 8616
16 Ga0070680_100292440 3300005336 Bacteria 1381
17 Ga0070682_100001390 3300005337 Bacteria 13645
18 Ga0070660_100004277 3300005339 Bacteria 9863
19 Ga0070689_100035910 3300005340 Bacteria 3789
20 Ga0070691_10009887 3300005341 Bacteria 4345
21 Ga0070691_10012022 3300005341 Bacteria 3963
22 Ga0070691_10016034 3300005341 Bacteria 3444
23 Ga0070661_100000703 3300005344 Bacteria 24523
24 Ga0070692_10000029 3300005345 Bacteria 27136
25 Ga0070692_10312275 3300005345 Bacteria 963
26 Ga0070668_100560034 3300005347 Bacteria 996
27 Ga0070669_100077149 3300005353 Unclassified 2475
28 Ga0070669_100099212 3300005353 Bacteria 2195
29 Ga0070671_100511103 3300005355 Unclassified 1034
30 Ga0070673_100245417 3300005364 Bacteria 1559
31 Ga0070659_100006955 3300005366 Bacteria 8192
32 Ga0070703_10000101 3300005406 Bacteria 44068
33 Ga0070703_10001000 3300005406 Bacteria 8889
34 Ga0070709_10098936 3300005434 Bacteria 1939
35 Ga0070713_100089195 3300005436 Bacteria 2648
36 Ga0070701_10025563 3300005438 Bacteria 2868
37 Ga0070701_10058869 3300005438 Bacteria 2018
38 Ga0070701_10130553 3300005438 Unclassified 1427
39 Ga0070711_100195644 3300005439 Bacteria 1557
40 Ga0070705_100000062 3300005440 Bacteria 56407
41 Ga0070705_100000347 3300005440 Bacteria 27333
42 Ga0070705_100017961 3300005440 Bacteria 3699
43 Ga0070705_100020002 3300005440 Bacteria 3533
44 Ga0070705_100157956 3300005440 Unclassified 1513
45 Ga0070700_100019741 3300005441 Bacteria 3893
46 Ga0070700_100037663 3300005441 Bacteria 2943
47 Ga0070700_100110093 3300005441 Unclassified 1830
48 Ga0070694_100002904 3300005444 Bacteria 10181
49 Ga0070694_100007439 3300005444 Bacteria 6677
50 Ga0070694_100030812 3300005444 Bacteria 3512
51 Ga0070694_100055735 3300005444 Bacteria 2682
52 Ga0070694_100178808 3300005444 Unclassified 1568
53 Ga0070694_100694073 3300005444 Bacteria 827
54 Ga0070708_100004094 3300005445 Bacteria 11456
55 Ga0070708_100038285 3300005445 Bacteria 4190
56 Ga0070708_100184561 3300005445 Bacteria 1950
57 Ga0070708_100190967 3300005445 Bacteria 1915
58 Ga0070708_100374035 3300005445 Unclassified 1343
59 Ga0070708_100433169 3300005445 Bacteria 1240
60 Ga0070708_100453119 3300005445 Bacteria 1210
61 Ga0070663_100008299 3300005455 Bacteria 6381
62 Ga0070663_100543991 3300005455 Bacteria 970
63 Ga0070678_100340143 3300005456 Bacteria 1287
64 Ga0070662_100012635 3300005457 Bacteria 5603
65 Ga0070681_10046542 3300005458 Bacteria 4337
66 Ga0068867_100000705 3300005459 Bacteria 22254
67 Ga0068867_100089046 3300005459 Bacteria 2340
68 Ga0068867_100376348 3300005459 Bacteria 1192
69 Ga0070706_100000947 3300005467 Bacteria 31676
70 Ga0070706_100003119 3300005467 Bacteria 16410
71 Ga0070706_100009125 3300005467 Bacteria 9237
72 Ga0070706_100022643 3300005467 Bacteria 5786
73 Ga0070706_100075397 3300005467 Bacteria 3121
74 Ga0070706_100085711 3300005467 Bacteria 2919
75 Ga0070707_100000653 3300005468 Bacteria 34576
76 Ga0070707_100004905 3300005468 Bacteria 12540
77 Ga0070707_100009854 3300005468 Bacteria 8892
78 Ga0070707_100026589 3300005468 Bacteria 5496
79 Ga0070707_100091021 3300005468 Bacteria 2953
80 Ga0070707_100295675 3300005468 Bacteria 1573
81 Ga0070698_100002225 3300005471 Bacteria 21473
82 Ga0070698_100032216 3300005471 Bacteria 5430
83 Ga0070698_100043266 3300005471 Bacteria 4618
84 Ga0070698_100171917 3300005471 Bacteria 2107
85 Ga0070698_100354270 3300005471 Bacteria 1399
86 Ga0070698_100374862 3300005471 Bacteria 1355
87 Ga0070699_100000102 3300005518 Bacteria 80731
88 Ga0070699_100001487 3300005518 Bacteria 21471
89 Ga0070699_100005189 3300005518 Bacteria 11456
90 Ga0070699_100012466 3300005518 Bacteria 7336
91 Ga0070699_100068829 3300005518 Bacteria 3075
92 Ga0070699_100077173 3300005518 Bacteria 2900
93 Ga0070699_100394615 3300005518 Bacteria 1250
94 Ga0070699_100498566 3300005518 Bacteria 1106
95 Ga0070699_100559116 3300005518 Bacteria 1042
96 Ga0070679_100000403 3300005530 Bacteria 36876
97 Ga0070679_100282801 3300005530 Bacteria 1611
98 Ga0070697_100002396 3300005536 Bacteria 14432
99 Ga0070697_100013678 3300005536 Bacteria 6368
100 Ga0070697_100048309 3300005536 Bacteria 3450
101 Ga0070697_100132629 3300005536 Bacteria 2090
102 Ga0070697_100185627 3300005536 Bacteria 1763
103 Ga0070697_100363921 3300005536 Unclassified 1250
104 Ga0070697_100394342 3300005536 Bacteria 1200
105 Ga0068853_100000808 3300005539 Bacteria 21801
106 Ga0070672_100108634 3300005543 Bacteria 2259
107 Ga0070695_100000668 3300005545 Bacteria 18292
108 Ga0070695_100005074 3300005545 Bacteria 7755
109 Ga0070695_100008983 3300005545 Bacteria 5939
110 Ga0070695_100093448 3300005545 Bacteria 2013
111 Ga0070695_100099461 3300005545 Bacteria 1956
112 Ga0070695_100125574 3300005545 Bacteria 1761
113 Ga0070695_100165317 3300005545 Unclassified 1557
114 Ga0070696_100007451 3300005546 Bacteria 7320
115 Ga0070696_100012891 3300005546 Bacteria 5611
116 Ga0070696_100020025 3300005546 Bacteria 4536
117 Ga0070696_100026754 3300005546 Bacteria 3926
118 Ga0070696_100066579 3300005546 Bacteria 2526
119 Ga0070696_100180847 3300005546 Bacteria 1564
120 Ga0070693_100000573 3300005547 Bacteria 16335
121 Ga0070693_100111513 3300005547 Unclassified 1683
122 Ga0070665_100118010 3300005548 Bacteria 2656
123 Ga0070704_100000240 3300005549 Bacteria 23438
124 Ga0070704_100059179 3300005549 Bacteria 2732
125 Ga0070704_100122536 3300005549 Bacteria 2000
126 Ga0070704_100205974 3300005549 Bacteria 1591
127 Ga0070704_100224831 3300005549 Unclassified 1528
128 Ga0070704_100365073 3300005549 Bacteria 1223
129 Ga0070704_100379879 3300005549 Bacteria 1200
130 Ga0068855_100000462 3300005563 Bacteria 50016
131 Ga0070664_100002902 3300005564 Bacteria 13870
132 Ga0068857_100110323 3300005577 Bacteria 2472
133 Ga0068857_100931225 3300005577 Bacteria 834
134 Ga0068854_100001177 3300005578 Bacteria 15680
135 Ga0068856_100004303 3300005614 Bacteria 14209
136 Ga0068856_100694763 3300005614 Bacteria 1038
137 Ga0070702_100370122 3300005615 Bacteria 1016
138 Ga0068852_100000409 3300005616 Bacteria 28651
139 Ga0068852_100071274 3300005616 Bacteria 3051
140 Ga0068859_100001671 3300005617 Bacteria 22591
141 Ga0068864_100002356 3300005618 Bacteria 15634
142 Ga0068864_100046193 3300005618 Unclassified 3736
143 Ga0068861_100000004 3300005719 Bacteria 105907
144 Ga0068870_10003549 3300005840 Bacteria 6617
145 Ga0068870_10070296 3300005840 Bacteria 1907
146 Ga0068863_100020982 3300005841 Bacteria 6239
147 Ga0068863_100124552 3300005841 Bacteria 2458
148 Ga0068858_100049390 3300005842 Bacteria 3897
149 Ga0068860_100022487 3300005843 Bacteria 6097
150 Ga0068862_100002540 3300005844 Bacteria 16145
151 Ga0068862_100117166 3300005844 Bacteria 2344
152 Ga0068862_100127618 3300005844 Bacteria 2247
153 Ga0068862_100134605 3300005844 Bacteria 2189
154 Ga0068862_100732280 3300005844 Unclassified 960
155 Ga0081455_10000074 3300005937 Bacteria 107319
156 Ga0081455_10000263 3300005937 Bacteria 69205
157 Ga0081455_10217852 3300005937 Bacteria 1417
158 Ga0081540_1000017 3300005983 Bacteria 164991
159 Ga0081540_1033550 3300005983 Bacteria 2785
160 Ga0081540_1051903 3300005983 Unclassified 2024
161 Ga0081540_1114350 3300005983 Bacteria 1133
162 Ga0081539_10055381 3300005985 Bacteria 2207
163 Ga0070716_100007739 3300006173 Bacteria 5303
164 Ga0070712_100137021 3300006175 Bacteria 1863
165 Ga0097621_100090915 3300006237 Bacteria 2555
166 Ga0068871_100039961 3300006358 Bacteria 3756
167 Ga0075428_100020538 3300006844 Bacteria 7313
168 Ga0075428_100028643 3300006844 Bacteria 6162
169 Ga0075428_100037429 3300006844 Bacteria 5341
170 Ga0075428_100103663 3300006844 Bacteria 3102
171 Ga0075428_100416938 3300006844 Bacteria 1439
172 Ga0075430_100003928 3300006846 Bacteria 12538
173 Ga0075430_100007711 3300006846 Bacteria 9094
174 Ga0075431_100004634 3300006847 Bacteria 13505
175 Ga0075431_100030654 3300006847 Bacteria 5540
176 Ga0075431_100051731 3300006847 Bacteria 4235
177 Ga0075431_100169181 3300006847 Bacteria 2246
178 Ga0075431_100186509 3300006847 Bacteria 2127
179 Ga0075431_100560364 3300006847 Bacteria 1129
180 Ga0075431_100575073 3300006847 Bacteria 1113
181 Ga0075433_10001643 3300006852 Bacteria 16609
182 Ga0075433_10001928 3300006852 Bacteria 15611
183 Ga0075433_10008706 3300006852 Bacteria 8098
184 Ga0075433_10037698 3300006852 Unclassified 4171
185 Ga0075433_10057068 3300006852 Bacteria 3412
186 Ga0075433_10169180 3300006852 Bacteria 1945
187 Ga0075433_10184112 3300006852 Bacteria 1858
188 Ga0075434_100009146 3300006871 Bacteria 9229
189 Ga0075434_100015061 3300006871 Bacteria 7404
190 Ga0075434_100016891 3300006871 Bacteria 7021
191 Ga0075434_100019048 3300006871 Bacteria 6634
192 Ga0075434_100054352 3300006871 Bacteria 3978
193 Ga0075434_100055537 3300006871 Bacteria 3935
194 Ga0075434_100091903 3300006871 Bacteria 3036
195 Ga0075434_100659468 3300006871 Unclassified 1064
196 Ga0075434_100712580 3300006871 Bacteria 1021
197 Ga0075429_100000661 3300006880 Bacteria 26632
198 Ga0075429_100008728 3300006880 Bacteria 8815
199 Ga0075429_100026834 3300006880 Bacteria 5000
200 Ga0075429_100033193 3300006880 Bacteria 4484
201 Ga0075429_100045162 3300006880 Bacteria 3833
202 Ga0075429_100274623 3300006880 Bacteria 1476
203 Ga0068865_100398082 3300006881 Bacteria 1127
204 Ga0075436_100099323 3300006914 Bacteria 2026
205 Ga0075436_100118035 3300006914 Bacteria 1855
206 Ga0097620_100001671 3300006931 Bacteria 22591
207 Ga0075435_100017972 3300007076 Bacteria 5362
208 Ga0075435_100021823 3300007076 Bacteria 4933
209 Ga0075435_100052771 3300007076 Bacteria 3276
210 Ga0075435_100054091 3300007076 Bacteria 3239
211 Ga0075435_100193054 3300007076 Bacteria 1724
212 Ga0075435_100499359 3300007076 Unclassified 1052
213 Ga0099794_10003812 3300007265 Bacteria 5824
214 Ga0099794_10010552 3300007265 Bacteria 3927
215 Ga0099794_10040605 3300007265 Bacteria 2213
216 Ga0111539_10096615 3300009094 Bacteria 3470
217 Ga0111539_10115750 3300009094 Bacteria 3144
218 Ga0111539_10116432 3300009094 Bacteria 3134
219 Ga0111539_10191407 3300009094 Bacteria 2387
220 Ga0114129_10015925 3300009147 Bacteria 10693
221 Ga0114129_10016561 3300009147 Bacteria 10498
222 Ga0114129_10040884 3300009147 Bacteria 6535
223 Ga0114129_10058855 3300009147 Bacteria 5374
224 Ga0114129_10077184 3300009147 Bacteria 4635
225 Ga0114129_10086041 3300009147 Unclassified 4360
226 Ga0114129_10124701 3300009147 Bacteria 3542
227 Ga0114129_10146929 3300009147 Bacteria 3229
228 Ga0114129_10169545 3300009147 Bacteria 2977
229 Ga0114129_10196723 3300009147 Bacteria 2733
230 Ga0114129_10250744 3300009147 Unclassified 2376
231 Ga0114129_10308054 3300009147 Bacteria 2109
232 Ga0105243_10061656 3300009148 Bacteria 3000
233 Ga0105243_10074268 3300009148 Unclassified 2757
234 Ga0105243_10406403 3300009148 Bacteria 1266
235 Ga0105243_10429285 3300009148 Bacteria 1235
236 Ga0105241_10000334 3300009174 Bacteria 35635
237 Ga0105241_10039866 3300009174 Bacteria 3543
238 Ga0105242_10010946 3300009176 Bacteria 6968
239 Ga0105248_10095937 3300009177 Bacteria 3339
240 Ga0105248_10135151 3300009177 Bacteria 2782
241 Ga0105238_10797112 3300009551 Bacteria 960
242 Ga0105249_10063722 3300009553 Unclassified 3387
243 Ga0105249_10127839 3300009553 Bacteria 2422
244 Ga0105249_10128176 3300009553 Bacteria 2419
245 Ga0105249_10603500 3300009553 Unclassified 1152
246 Ga0105249_10739007 3300009553 Unclassified 1046
247 Ga0105239_10053250 3300010375 Bacteria 4439
248 Ga0105246_10077064 3300011119 Bacteria 2364
249 Ga0157373_10000379 3300013100 Bacteria 35641
250 Ga0157371_10129203 3300013102 Bacteria 1797
251 Ga0157378_10129944 3300013297 Bacteria 2331
252 Ga0163162_10126896 3300013306 Unclassified 2658
253 Ga0163162_10511084 3300013306 Bacteria 1331
254 Ga0163162_10711046 3300013306 Bacteria 1126
255 Ga0163162_10727201 3300013306 Bacteria 1113
256 Ga0157372_10000135 3300013307 Bacteria 81209
257 Ga0157375_10086056 3300013308 Bacteria 3193
258 Ga0157375_10780244 3300013308 Bacteria 1105
259 Ga0163163_10458433 3300014325 Bacteria 1335
260 Ga0157379_10095352 3300014968 Bacteria 2669
261 Ga0157379_10136266 3300014968 Bacteria 2212
262 Ga0157379_10178804 3300014968 Unclassified 1917
263 Ga0157376_10320987 3300014969 Bacteria 1472
264 Ga0206356_10892825 3300020070 Bacteria 1200
265 Ga0206352_10926330 3300020078 Bacteria 1088
266 Ga0206350_10906670 3300020080 Bacteria 1020
267 Ga0213875_10075658 3300021388 Bacteria 1571
268 Ga0213875_10081146 3300021388 Bacteria 1513
269 Ga0207653_10000051 3300025885 Bacteria 88512
270 Ga0207653_10000475 3300025885 Bacteria 16005
271 Ga0207653_10013346 3300025885 Bacteria 2572
272 Ga0207653_10022438 3300025885 Unclassified 2005
273 Ga0207647_10034110 3300025904 Bacteria 3252
274 Ga0207685_10019191 3300025905 Bacteria 2249
275 Ga0207685_10210260 3300025905 Bacteria 919
276 Ga0207699_10157986 3300025906 Bacteria 1507
277 Ga0207645_10000075 3300025907 Bacteria 71333
278 Ga0207643_10001707 3300025908 Bacteria 12325
279 Ga0207643_10016247 3300025908 Bacteria 4060
280 Ga0207684_10000593 3300025910 Bacteria 43455
281 Ga0207684_10000746 3300025910 Bacteria 37987
282 Ga0207684_10001638 3300025910 Bacteria 23790
283 Ga0207684_10003090 3300025910 Bacteria 16441
284 Ga0207684_10009055 3300025910 Bacteria 8819
285 Ga0207684_10012194 3300025910 Bacteria 7479
286 Ga0207684_10019452 3300025910 Bacteria 5809
287 Ga0207684_10146764 3300025910 Bacteria 2029
288 Ga0207684_10381520 3300025910 Unclassified 1212
289 Ga0207654_10001071 3300025911 Bacteria 14889
290 Ga0207707_10000135 3300025912 Bacteria 76964
291 Ga0207693_10003315 3300025915 Bacteria 13773
292 Ga0207663_10424003 3300025916 Bacteria 1022
293 Ga0207660_10000688 3300025917 Bacteria 22592
294 Ga0207660_10012425 3300025917 Bacteria 5571
295 Ga0207660_10195556 3300025917 Bacteria 1577
296 Ga0207657_10000037 3300025919 Bacteria 124230
297 Ga0207649_10029372 3300025920 Bacteria 3246
298 Ga0207652_10002292 3300025921 Bacteria 16228
299 Ga0207646_10002863 3300025922 Bacteria 20033
300 Ga0207646_10004177 3300025922 Bacteria 15825
301 Ga0207646_10006979 3300025922 Bacteria 11575
302 Ga0207646_10014266 3300025922 Bacteria 7556
303 Ga0207646_10029483 3300025922 Bacteria 4986
304 Ga0207646_10031519 3300025922 Bacteria 4799
305 Ga0207646_10057995 3300025922 Bacteria 3459
306 Ga0207646_10073172 3300025922 Bacteria 3061
307 Ga0207646_10149492 3300025922 Bacteria 2106
308 Ga0207681_10048883 3300025923 Bacteria 2857
309 Ga0207681_10054501 3300025923 Bacteria 2719
310 Ga0207694_10464337 3300025924 Bacteria 1058
311 Ga0207650_10012455 3300025925 Bacteria 5873
312 Ga0207690_10000562 3300025932 Bacteria 24235
313 Ga0207706_10011250 3300025933 Bacteria 8160
314 Ga0207709_10061209 3300025935 Unclassified 2351
315 Ga0207709_10184358 3300025935 Bacteria 1477
316 Ga0207709_10257457 3300025935 Unclassified 1278
317 Ga0207709_10311090 3300025935 Bacteria 1175
318 Ga0207670_10043530 3300025936 Bacteria 2966
319 Ga0207670_10098468 3300025936 Bacteria 2084
320 Ga0207669_10599598 3300025937 Unclassified 895
321 Ga0207704_10040243 3300025938 Bacteria 2730
322 Ga0207665_10000576 3300025939 Bacteria 24692
323 Ga0207691_10134475 3300025940 Bacteria 2182
324 Ga0207711_10199391 3300025941 Bacteria 1826
325 Ga0207711_10339940 3300025941 Bacteria 1389
326 Ga0207689_10000029 3300025942 Bacteria 100016
327 Ga0207689_10015346 3300025942 Bacteria 6485
328 Ga0207689_10289428 3300025942 Bacteria 1357
329 Ga0207679_10003224 3300025945 Bacteria 10063
330 Ga0207667_10000652 3300025949 Bacteria 45007
331 Ga0207651_10279365 3300025960 Unclassified 1379
332 Ga0207651_10317319 3300025960 Bacteria 1302
333 Ga0207712_10014975 3300025961 Bacteria 4997
334 Ga0207712_10667215 3300025961 Bacteria 905
335 Ga0207640_10008161 3300025981 Bacteria 5800
336 Ga0207640_10160318 3300025981 Bacteria 1663
337 Ga0207639_10063006 3300026041 Bacteria 2869
338 Ga0207678_10017042 3300026067 Bacteria 6379
339 Ga0207678_10452490 3300026067 Unclassified 1116
340 Ga0207708_10031915 3300026075 Bacteria 4000
341 Ga0207708_10041994 3300026075 Bacteria 3487
342 Ga0207708_10080563 3300026075 Bacteria 2502
343 Ga0207708_10426395 3300026075 Unclassified 1101
344 Ga0207702_10014520 3300026078 Bacteria 6538
345 Ga0207641_10061004 3300026088 Bacteria 3216
346 Ga0207641_10444180 3300026088 Unclassified 1252
347 Ga0207648_10000552 3300026089 Bacteria 41984
348 Ga0207648_10376304 3300026089 Bacteria 1283
349 Ga0207674_10000306 3300026116 Bacteria 62216
350 Ga0207674_10042965 3300026116 Bacteria 4663
351 Ga0207674_10106088 3300026116 Bacteria 2787
352 Ga0207675_100000032 3300026118 Bacteria 108677
353 Ga0207675_100032074 3300026118 Bacteria 4893
354 Ga0207675_100107562 3300026118 Bacteria 2630
355 Ga0207683_10385365 3300026121 Bacteria 1289
356 Ga0207698_10000321 3300026142 Bacteria 28668
357 Ga0209969_1002067 3300027360 Bacteria 2767
358 Ga0209984_1001656 3300027424 Bacteria 2428
359 Ga0209984_1011237 3300027424 Bacteria 1158
360 Ga0210000_1002112 3300027462 Bacteria 2818
361 Ga0209995_1011423 3300027471 Bacteria 1444
362 Ga0209995_1021065 3300027471 Bacteria 1080
363 Ga0209999_1004084 3300027543 Bacteria 2622
364 Ga0209982_1014340 3300027552 Bacteria 1197
365 Ga0209970_1005428 3300027614 Bacteria 2104
366 Ga0210002_1001653 3300027617 Bacteria 3176
367 Ga0209983_1000146 3300027665 Bacteria 13016
368 Ga0209588_1024370 3300027671 Bacteria 1910
369 Ga0209971_1000008 3300027682 Bacteria 102612
370 Ga0209966_1000187 3300027695 Bacteria 25599
371 Ga0209998_10000016 3300027717 Bacteria 85166
372 Ga0209998_10007971 3300027717 Bacteria 2198
373 Ga0209974_10001677 3300027876 Bacteria 8020
374 Ga0207428_10000013 3300027907 Bacteria 346742
375 Ga0207428_10087469 3300027907 Bacteria 2424
376 Ga0207428_10288822 3300027907 Bacteria 1216
377 Ga0268265_10003670 3300028380 Bacteria 10947
378 Ga0268265_10074257 3300028380 Unclassified 2659
379 Ga0268265_10186104 3300028380 Unclassified 1789
380 Ga0268265_10205963 3300028380 Unclassified 1710
381 Ga0268264_10045908 3300028381 Bacteria 3628
382 Ga0265338_10009552 3300028800 Bacteria 11541
383 Ga0265324_10070486 3300029957 Bacteria 1191
384 Ga0265327_10001037 3300031251 Bacteria 39182
385 Ga0307408_100024744 3300031548 Bacteria 4104
386 Ga0307408_100248057 3300031548 Bacteria 1467
387 Ga0307413_10074005 3300031824 Bacteria 2156
388 Ga0307413_10230357 3300031824 Bacteria 1360
389 Ga0307412_10366696 3300031911 Bacteria 1162
390 Ga0307409_100302282 3300031995 Bacteria 1489
391 Ga0307416_100128963 3300032002 Bacteria 2272
392 Ga0307416_100356753 3300032002 Bacteria 1482
393 Ga0307416_100881606 3300032002 Bacteria 994
394 Ga0307414_10807191 3300032004 Unclassified 856
395 Ga0373950_0026318 3300034818 Unclassified 1055
396 Ga0373958_0018006 3300034819 Bacteria 1276
397 Ga0373959_0055580 3300034820 Unclassified 865
398 Ga0373928_0018085 3300035084 Bacteria 1457
399 Ga0373928_0034492 3300035084 Unclassified 1136
400 Ga0373940_0010152 3300035088 Unclassified 2207
401 Ga0373940_0069545 3300035088 Unclassified 1022
402 Ga0373949_0010111 3300035090 Bacteria 2065
403 Ga0373949_0015057 3300035090 Bacteria 1725
404 Ga0373932_0084718 3300035112 Bacteria 1007
405 Ga0373941_0018071 3300035115 Bacteria 1943
406 Ga0373960_0002818 3300035121 Bacteria 3937
407 Ga0373942_0015299 3300035207 Bacteria 1868
408 Ga0373962_0010180 3300035242 Bacteria 2340
409 Ga0373962_0020678 3300035242 Bacteria 1730
410 Ga0373962_0053405 3300035242 Unclassified 1169
411 Ga0373931_0004831 3300035691 Bacteria 6190
412 Ga0373931_0128835 3300035691 Bacteria 1454
413 Ga0373927_0185620 3300035695 Bacteria 1364
414 Ga0395900_0130218 3300037418 Bacteria 2579
415 Ga0395905_0357030 3300037471 Unclassified 1354
416 Ga0436364_0436153 3300037853 Bacteria 3844
417 Ga0242420_035721 3300038996 Bacteria 936
418 Ga0436365_0488470 3300039437 Bacteria 27098
419 Ga0436365_1654887 3300039437 Unclassified 3198
420 Ga0436360_0219999 3300039438 Bacteria 3479
421 Ga0436360_1256473 3300039438 Bacteria 1503
422 Ga0436363_1083672 3300039450 Bacteria 801
423 Ga0439458_0003469 3300042157 Bacteria 3682
424 Ga0439459_0003082 3300042438 Bacteria 2616
425 Ga0439460_0002029 3300042461 Bacteria 4852
426 Ga0451577_0043881 3300042876 Bacteria 4003
427 Ga0451577_0081542 3300042876 Bacteria 2886
428 Ga0451577_0089884 3300042876 Bacteria 2740
429 Ga0453683_0026309 3300044673 Bacteria 3694
430 Ga0453683_0043142 3300044673 Bacteria 2831
431 Ga0453683_0142708 3300044673 Unclassified 1512
432 Ga0453684_0120577 3300044712 Bacteria 3167
433 Ga0453684_1195965 3300044712 Bacteria 798
434 Ga0451576_0017221 3300045051 Bacteria 7948
435 Ga0451576_0021782 3300045051 Bacteria 6957
436 Ga0451576_0031255 3300045051 Bacteria 5680
437 Ga0451576_0040420 3300045051 Bacteria 4936
438 Ga0451576_0088044 3300045051 Bacteria 3230
439 Ga0451576_0179881 3300045051 Unclassified 2208
440 Ga0451576_0489550 3300045051 Bacteria 1292
441 Ga0495580_0001659 3300046472 Bacteria 19563
442 Ga0495580_0010780 3300046472 Bacteria 7099
443 Ga0495580_0165883 3300046472 Unclassified 1528
444 Ga0495584_0077036 3300046491 Unclassified 1677
445 Ga0495637_0140381 3300046520 Bacteria 917
446 Ga0495669_0089882 3300046684 Bacteria 1417
447 Ga0495613_0001713 3300046689 Bacteria 16704
448 Ga0495636_0168280 3300047318 Bacteria 990
449 Ga0496102_0085407 3300048905 Bacteria 2914
450 Ga0496104_0100178 3300048907 Bacteria 2773
451 Ga0496105_0049557 3300048908 Bacteria 3468
452 Ga0496106_0016979 3300048909 Bacteria 5386
453 Ga0496106_0021548 3300048909 Bacteria 4786
454 Ga0496106_0199775 3300048909 Bacteria 1591
455 Ga0496107_0447070 3300048910 Bacteria 960
456 Ga0496108_0009227 3300048911 Bacteria 7985
457 Ga0496109_0044402 3300048912 Bacteria 4032
458 Ga0496110_0073040 3300048913 Bacteria 3044
459 Ga0496111_0197834 3300048914 Bacteria 1494
460 Ga0496112_0134716 3300048915 Unclassified 2441
461 Ga0496113_0250016 3300048916 Bacteria 1415
462 Ga0496115_0003412 3300048918 Bacteria 11410
463 Ga0496115_0061969 3300048918 Bacteria 3017
464 Ga0501031_0058974 3300049568 Bacteria 2501
465 Ga0501031_0276383 3300049568 Bacteria 1090
466 Ga0501032_0278586 3300049569 Bacteria 1083
467 Ga0501036_0097293 3300049572 Bacteria 2488
468 Ga0501037_0066402 3300049573 Bacteria 2628
469 Ga0501038_0053638 3300049574 Bacteria 3470
470 Ga0501038_0166189 3300049574 Bacteria 1790
471 Ga0501039_0015798 3300049575 Bacteria 5779
472 Ga0501039_0038758 3300049575 Bacteria 3680
473 Ga0501039_0079363 3300049575 Bacteria 2553
474 Ga0501039_0237515 3300049575 Bacteria 1433
475 Ga0501040_0001982 3300049576 Bacteria 13201
476 Ga0501040_0010799 3300049576 Bacteria 5970
477 Ga0501040_0135585 3300049576 Bacteria 1733
478 Ga0501040_0309001 3300049576 Bacteria 1130
479 Ga0501041_0042286 3300049577 Bacteria 2769
480 Ga0501042_0001517 3300049578 Bacteria 13739
481 Ga0501042_0018652 3300049578 Bacteria 4807
482 Ga0501042_0045329 3300049578 Bacteria 3134
483 Ga0501042_0091274 3300049578 Bacteria 2186
484 Ga0501043_0032810 3300049579 Bacteria 4084
485 Ga0501043_0053090 3300049579 Bacteria 3183
486 Ga0501046_0009495 3300049580 Bacteria 8405
487 Ga0501046_0234672 3300049580 Unclassified 1354
488 Ga0501046_0302712 3300049580 Bacteria 1167
489 Ga0501047_0135299 3300049581 Bacteria 2345
490 Ga0501047_0246489 3300049581 Bacteria 1636
491 Ga0501048_0011174 3300049582 Bacteria 6693
492 Ga0501048_0022183 3300049582 Bacteria 4645
493 Ga0501048_0037034 3300049582 Bacteria 3504
494 Ga0501048_0467660 3300049582 Unclassified 903
495 Ga0501067_0103099 3300049583 Unclassified 1585
496 Ga0501068_0112203 3300049584 Unclassified 1696
497 Ga0501069_0317664 3300049585 Bacteria 915
498 Ga0501071_0007379 3300049587 Bacteria 7213
499 Ga0501071_0035050 3300049587 Bacteria 3574
500 Ga0501071_0169304 3300049587 Bacteria 1635
501 Ga0501072_0001276 3300049588 Bacteria 18807
502 Ga0501072_0023626 3300049588 Bacteria 4775
503 Ga0501072_0030081 3300049588 Bacteria 4245
504 Ga0501072_0036089 3300049588 Bacteria 3875
505 Ga0501072_0093101 3300049588 Bacteria 2394
506 Ga0501072_0233585 3300049588 Bacteria 1465
507 Ga0501074_0002117 3300049590 Bacteria 13714
508 Ga0501074_0029284 3300049590 Bacteria 3989
509 Ga0501075_0000955 3300049591 Bacteria 18410
510 Ga0501075_0004974 3300049591 Bacteria 9065
511 Ga0501075_0012336 3300049591 Bacteria 6072
512 Ga0501075_0076112 3300049591 Bacteria 2538
513 Ga0501075_0082154 3300049591 Bacteria 2440
514 Ga0501075_0107129 3300049591 Bacteria 2124
515 Ga0501075_0109497 3300049591 Bacteria 2100
516 Ga0501076_0003931 3300049592 Bacteria 10484
517 Ga0501076_0064042 3300049592 Bacteria 2930
518 Ga0501076_0240422 3300049592 Bacteria 1481
519 Ga0501077_0001617 3300049593 Bacteria 13561
520 Ga0501077_0031565 3300049593 Bacteria 3372
521 Ga0501077_0052455 3300049593 Bacteria 2590
522 Ga0501077_0189257 3300049593 Unclassified 1307
523 Ga0501077_0254007 3300049593 Bacteria 1118
524 Ga0501079_0001548 3300049741 Bacteria 16293
525 Ga0501079_0004258 3300049741 Bacteria 10615
526 Ga0501079_0047343 3300049741 Bacteria 3317
527 Ga0501079_0138844 3300049741 Bacteria 1893
528 Ga0501079_0192782 3300049741 Unclassified 1591
529 Ga0501080_0035335 3300049742 Bacteria 4664
530 Ga0501080_0048431 3300049742 Bacteria 3956
531 Ga0501080_0269885 3300049742 Bacteria 1549
532 Ga0501080_0587591 3300049742 Bacteria 989
533 Ga0501081_0002531 3300049743 Bacteria 11522
534 Ga0501081_0008158 3300049743 Bacteria 6797
535 Ga0501081_0008913 3300049743 Bacteria 6518
536 Ga0501081_0031990 3300049743 Bacteria 3567
537 Ga0501083_0002379 3300049744 Bacteria 12878
538 Ga0501083_0045895 3300049744 Bacteria 2955
539 Ga0501035_0663252 3300049822 Bacteria 845
540 Ga0501045_0000998 3300049824 Bacteria 18589
541 Ga0501045_0004584 3300049824 Bacteria 9541
542 Ga0501045_0155567 3300049824 Bacteria 1701
543 nmdc:mga05p37_12174_c1 3300050507 Bacteria 10271
544 nmdc:mga05p37_207186_c1 3300050507 Bacteria 2371
545 nmdc:mga05p37_221243_c1 3300050507 Bacteria 2285
546 nmdc:mga05p37_232847_c1 3300050507 Bacteria 2218
547 nmdc:mga05p37_255932_c1 3300050507 Bacteria 2098
548 nmdc:mga05p37_300694_c1 3300050507 Bacteria 1907
549 nmdc:mga05p37_33356_c1 3300050507 Bacteria 6306
550 nmdc:mga05p37_52253_c1 3300050507 Bacteria 5025
551 nmdc:mga05p37_55835_c1 3300050507 Unclassified 4862
552 nmdc:mga05p37_61184_c1 3300050507 Bacteria 4636
553 nmdc:mga05p37_73795_c1 3300050507 Bacteria 4199
554 nmdc:mga05p37_93255_c1 3300050507 Bacteria 3710
555 nmdc:mga09592_139170_c1 3300050508 Bacteria 2091
556 nmdc:mga09592_35758_c1 3300050508 Bacteria 4159
557 nmdc:mga09592_49790_c1 3300050508 Bacteria 3533
558 nmdc:mga09592_70650_c1 3300050508 Bacteria 2963
559 nmdc:mga0qj67_257075_c1 3300050509 Bacteria 1417
560 nmdc:mga0qj67_276571_c1 3300050509 Bacteria 1361
561 nmdc:mga0qj67_36838_c1 3300050509 Bacteria 3829
562 nmdc:mga0qj67_452574_c1 3300050509 Bacteria 1034
563 nmdc:mga0qj67_53859_c1 3300050509 Bacteria 3186
564 nmdc:mga06r32_158592_c1 3300050510 Bacteria 2245
565 nmdc:mga06r32_237348_c1 3300050510 Unclassified 1811
566 nmdc:mga06r32_281584_c1 3300050510 Bacteria 1650
567 nmdc:mga06r32_32383_c1 3300050510 Bacteria 4918
568 nmdc:mga06r32_333008_c1 3300050510 Unclassified 1503
569 nmdc:mga06r32_43253_c1 3300050510 Bacteria 4286
570 nmdc:mga06r32_439739_c1 3300050510 Bacteria 1284
571 nmdc:mga06r32_66014_c1 3300050510 Bacteria 3491
572 nmdc:mga08y16_140101_c1 3300050511 Bacteria 2514
573 nmdc:mga08y16_275686_c1 3300050511 Bacteria 1736
574 nmdc:mga08y16_489_c1 3300050511 Bacteria 36710
575 nmdc:mga08y16_513831_c1 3300050511 Bacteria 1216
576 nmdc:mga0n895_14081_c1 3300050512 Bacteria 7251
577 nmdc:mga0n895_153338_c1 3300050512 Bacteria 2335
578 nmdc:mga0n895_16654_c1 3300050512 Bacteria 6751
579 nmdc:mga0n895_22584_c1 3300050512 Bacteria 5901
580 nmdc:mga0n895_263911_c1 3300050512 Bacteria 1747
581 nmdc:mga0n895_29591_c1 3300050512 Bacteria 5227
582 nmdc:mga0n895_38873_c1 3300050512 Bacteria 4613
583 nmdc:mga0n895_42962_c1 3300050512 Bacteria 4402
584 nmdc:mga0n895_666953_c1 3300050512 Bacteria 1038
585 nmdc:mga0rr50_148962_c1 3300050513 Bacteria 1889
586 nmdc:mga0rr50_19985_c1 3300050513 Bacteria 4536
587 nmdc:mga0rr50_2969_c1 3300050513 Bacteria 9704
588 nmdc:mga0rr50_312593_c1 3300050513 Bacteria 1316
589 nmdc:mga0rr50_3935_c1 3300050513 Bacteria 8639
590 nmdc:mga0rr50_50745_c1 3300050513 Bacteria 3075
591 nmdc:mga0rr50_624931_c1 3300050513 Bacteria 919
592 nmdc:mga0rr50_94333_c1 3300050513 Unclassified 2337
593 nmdc:mga08x19_12943_c1 3300050514 Bacteria 5037
594 nmdc:mga08x19_573149_c1 3300050514 Bacteria 799
595 nmdc:mga0a205_160295_c1 3300050515 Bacteria 2147
596 nmdc:mga0a205_16766_c1 3300050515 Bacteria 6860
597 nmdc:mga0a205_259229_c1 3300050515 Unclassified 1617
598 nmdc:mga0a205_2643_c1 3300050515 Bacteria 15831
599 nmdc:mga0a205_26945_c1 3300050515 Bacteria 5487
600 nmdc:mga0a205_405_c1 3300050515 Bacteria 33012
601 nmdc:mga0a205_633476_c1 3300050515 Bacteria 921
602 nmdc:mga0a205_634766_c1 3300050515 Bacteria 920
603 nmdc:mga0a205_78789_c1 3300050515 Bacteria 3183
604 Ga0500647_0004051 3300053091 Bacteria 5830
605 Ga0500572_001507 3300053111 Bacteria 6273
606 Ga0500592_032009 3300053116 Bacteria 848
607 Ga0500658_0161545 3300053134 Bacteria 1014
608 Ga0500568_0037758 3300053139 Bacteria 1958
609 Ga0500622_0007547 3300053156 Bacteria 6164
610 Ga0500627_0001632 3300053158 Bacteria 6335
611 Ga0500627_0257224 3300053158 Bacteria 771
612 Ga0501084_0013356 3300054114 Bacteria 6795
613 Ga0501084_0014517 3300054114 Bacteria 6530
614 Ga0501084_0020379 3300054114 Bacteria 5530
615 Ga0501084_0027753 3300054114 Bacteria 4730
616 Ga0501084_0063021 3300054114 Bacteria 3103
617 Ga0501084_0454340 3300054114 Bacteria 1083
618 Ga0501082_0001040 3300060353 Bacteria 24529
619 Ga0501082_0001716 3300060353 Bacteria 19332
620 Ga0501082_0013358 3300060353 Bacteria 7062
621 Ga0501082_0022856 3300060353 Bacteria 5387
622 Ga0501082_0043382 3300060353 Bacteria 3878
623 Ga0501082_0142627 3300060353 Bacteria 2079
624 Ga0501082_0600677 3300060353 Bacteria 963
625 Ga0530510_0003571 3300061734 Bacteria 10710
626 Ga0530510_0005130 3300061734 Bacteria 9036
627 Ga0530510_0066115 3300061734 Bacteria 2620

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0257224 Ga0500627_0257224_11_682 216
2 3300013306 Ga0163162_10727201 Ga0163162_107272011 222
3 3300005295 Ga0065707_10255577 Ga0065707_102555771 223
4 3300053116 Ga0500592_032009 Ga0500592_032009_26_733 225
5 3300053134 Ga0500658_0161545 Ga0500658_0161545_162_869 225
6 3300053158 Ga0500627_0001632 Ga0500627_0001632_4510_5217 225
7 3300005467 Ga0070706_100085711 Ga0070706_1000857112 227
8 3300035090 Ga0373949_0010111 Ga0373949_0010111_24_713 228
9 3300009551 Ga0105238_10797112 Ga0105238_107971121 230
10 3300025924 Ga0207694_10464337 Ga0207694_104643371 230
11 3300005295 Ga0065707_10005661 Ga0065707_100056613 232
12 3300005406 Ga0070703_10000101 Ga0070703_1000010132 232
13 3300005440 Ga0070705_100000062 Ga0070705_1000000626 232
14 3300005467 Ga0070706_100000947 Ga0070706_1000009478 232
15 3300005518 Ga0070699_100000102 Ga0070699_10000010271 232
16 3300005545 Ga0070695_100165317 Ga0070695_1001653172 232
17 3300005546 Ga0070696_100007451 Ga0070696_1000074515 232
18 3300005546 Ga0070696_100020025 Ga0070696_1000200254 232
19 3300005546 Ga0070696_100180847 Ga0070696_1001808472 232
20 3300005547 Ga0070693_100111513 Ga0070693_1001115132 232
21 3300005549 Ga0070704_100224831 Ga0070704_1002248311 232
22 3300006844 Ga0075428_100028643 Ga0075428_1000286433 232
23 3300006844 Ga0075428_100037429 Ga0075428_1000374293 232
24 3300006844 Ga0075428_100416938 Ga0075428_1004169382 232
25 3300006871 Ga0075434_100055537 Ga0075434_1000555373 232
26 3300009094 Ga0111539_10096615 Ga0111539_100966153 232
27 3300009147 Ga0114129_10086041 Ga0114129_100860411 232
28 3300009147 Ga0114129_10196723 Ga0114129_101967232 232
29 3300025885 Ga0207653_10000051 Ga0207653_1000005153 232
30 3300025910 Ga0207684_10000593 Ga0207684_100005938 232
31 3300037853 Ga0436364_0436153 Ga0436364_0436153_302_1009 232
32 3300039450 Ga0436363_1083672 Ga0436363_1083672_81_788 232
33 3300050509 nmdc:mga0qj67_452574_c1 nmdc:mga0qj67_452574_c1_12_752 232
34 3300050512 nmdc:mga0n895_666953_c1 nmdc:mga0n895_666953_c1_133_927 232
35 3300050513 nmdc:mga0rr50_624931_c1 nmdc:mga0rr50_624931_c1_18_716 232
36 3300050515 nmdc:mga0a205_633476_c1 nmdc:mga0a205_633476_c1_69_863 232
37 3300048909 Ga0496106_0199775 Ga0496106_0199775_268_1041 233
38 3300048910 Ga0496107_0447070 Ga0496107_0447070_87_860 233
39 3300048918 Ga0496115_0061969 Ga0496115_0061969_1977_2750 233
40 3300005616 Ga0068852_100000409 Ga0068852_10000040915 234
41 3300006847 Ga0075431_100051731 Ga0075431_1000517316 234
42 3300026142 Ga0207698_10000321 Ga0207698_1000032113 234
43 3300029957 Ga0265324_10070486 Ga0265324_100704862 234
44 3300031251 Ga0265327_10001037 Ga0265327_1000103742 234
45 3300050508 nmdc:mga09592_35758_c1 nmdc:mga09592_35758_c1_2965_3732 234
46 3300050510 nmdc:mga06r32_43253_c1 nmdc:mga06r32_43253_c1_3428_4195 234
47 3300039438 Ga0436360_1256473 Ga0436360_1256473_86_850 235
48 3300046520 Ga0495637_0140381 Ga0495637_0140381_99_830 235
49 3300053139 Ga0500568_0037758 Ga0500568_0037758_921_1652 235
50 3300005353 Ga0070669_100077149 Ga0070669_1000771493 236
51 3300005434 Ga0070709_10098936 Ga0070709_100989363 236
52 3300005436 Ga0070713_100089195 Ga0070713_1000891953 236
53 3300005440 Ga0070705_100020002 Ga0070705_1000200025 236
54 3300005445 Ga0070708_100038285 Ga0070708_1000382853 236
55 3300005468 Ga0070707_100295675 Ga0070707_1002956752 236
56 3300005471 Ga0070698_100171917 Ga0070698_1001719172 236
57 3300005536 Ga0070697_100394342 Ga0070697_1003943421 236
58 3300005549 Ga0070704_100059179 Ga0070704_1000591792 236
59 3300005719 Ga0068861_100000004 Ga0068861_10000000412 236
60 3300005844 Ga0068862_100127618 Ga0068862_1001276182 236
61 3300005983 Ga0081540_1114350 Ga0081540_11143502 236
62 3300006846 Ga0075430_100003928 Ga0075430_1000039288 236
63 3300006847 Ga0075431_100030654 Ga0075431_1000306545 236
64 3300006852 Ga0075433_10001643 Ga0075433_1000164317 236
65 3300006852 Ga0075433_10037698 Ga0075433_100376985 236
66 3300006852 Ga0075433_10184112 Ga0075433_101841122 236
67 3300006871 Ga0075434_100009146 Ga0075434_1000091467 236
68 3300006871 Ga0075434_100091903 Ga0075434_1000919033 236
69 3300006880 Ga0075429_100000661 Ga0075429_10000066115 236
70 3300006881 Ga0068865_100398082 Ga0068865_1003980821 236
71 3300007076 Ga0075435_100021823 Ga0075435_1000218234 236
72 3300007076 Ga0075435_100052771 Ga0075435_1000527713 236
73 3300009147 Ga0114129_10146929 Ga0114129_101469293 236
74 3300009553 Ga0105249_10603500 Ga0105249_106035002 236
75 3300013297 Ga0157378_10129944 Ga0157378_101299443 236
76 3300014968 Ga0157379_10136266 Ga0157379_101362663 236
77 3300014969 Ga0157376_10320987 Ga0157376_103209872 236
78 3300025910 Ga0207684_10009055 Ga0207684_100090553 236
79 3300025922 Ga0207646_10029483 Ga0207646_100294832 236
80 3300025938 Ga0207704_10040243 Ga0207704_100402434 236
81 3300026118 Ga0207675_100000032 Ga0207675_10000003272 236
82 3300027907 Ga0207428_10000013 Ga0207428_10000013130 236
83 3300028380 Ga0268265_10074257 Ga0268265_100742572 236
84 3300035088 Ga0373940_0069545 Ga0373940_0069545_119_913 236
85 3300035112 Ga0373932_0084718 Ga0373932_0084718_29_772 236
86 3300035242 Ga0373962_0010180 Ga0373962_0010180_1492_2286 236
87 3300035691 Ga0373931_0128835 Ga0373931_0128835_477_1271 236
88 3300038996 Ga0242420_035721 Ga0242420_035721_75_818 236
89 3300044712 Ga0453684_1195965 Ga0453684_1195965_17_760 236
90 3300046472 Ga0495580_0001659 Ga0495580_0001659_15126_15869 236
91 3300046684 Ga0495669_0089882 Ga0495669_0089882_74_817 236
92 3300050507 nmdc:mga05p37_221243_c1 nmdc:mga05p37_221243_c1_1033_1776 236
93 3300050507 nmdc:mga05p37_232847_c1 nmdc:mga05p37_232847_c1_56_799 236
94 3300050507 nmdc:mga05p37_61184_c1 nmdc:mga05p37_61184_c1_1982_2776 236
95 3300050508 nmdc:mga09592_49790_c1 nmdc:mga09592_49790_c1_70_864 236
96 3300050509 nmdc:mga0qj67_53859_c1 nmdc:mga0qj67_53859_c1_1982_2776 236
97 3300050510 nmdc:mga06r32_158592_c1 nmdc:mga06r32_158592_c1_1041_1835 236
98 3300050510 nmdc:mga06r32_66014_c1 nmdc:mga06r32_66014_c1_2460_3203 236
99 3300050511 nmdc:mga08y16_489_c1 nmdc:mga08y16_489_c1_3047_3790 236
100 3300050512 nmdc:mga0n895_153338_c1 nmdc:mga0n895_153338_c1_549_1292 236
101 3300050512 nmdc:mga0n895_16654_c1 nmdc:mga0n895_16654_c1_5176_5919 236
102 3300050512 nmdc:mga0n895_38873_c1 nmdc:mga0n895_38873_c1_1935_2678 236
103 3300050513 nmdc:mga0rr50_148962_c1 nmdc:mga0rr50_148962_c1_894_1637 236
104 3300050513 nmdc:mga0rr50_19985_c1 nmdc:mga0rr50_19985_c1_2758_3501 236
105 3300050513 nmdc:mga0rr50_50745_c1 nmdc:mga0rr50_50745_c1_2149_2901 236
106 3300050514 nmdc:mga08x19_573149_c1 nmdc:mga08x19_573149_c1_20_763 236
107 3300050515 nmdc:mga0a205_16766_c1 nmdc:mga0a205_16766_c1_4292_5035 236
108 3300050515 nmdc:mga0a205_405_c1 nmdc:mga0a205_405_c1_28304_29047 236
109 3300050515 nmdc:mga0a205_78789_c1 nmdc:mga0a205_78789_c1_719_1462 236
110 3300006852 Ga0075433_10169180 Ga0075433_101691801 237
111 3300006871 Ga0075434_100712580 Ga0075434_1007125801 237
112 3300006914 Ga0075436_100118035 Ga0075436_1001180351 237
113 3300031824 Ga0307413_10230357 Ga0307413_102303572 237
114 3300035695 Ga0373927_0185620 Ga0373927_0185620_529_1287 237
115 3300050512 nmdc:mga0n895_263911_c1 nmdc:mga0n895_263911_c1_326_1141 237
116 3300050515 nmdc:mga0a205_634766_c1 nmdc:mga0a205_634766_c1_13_876 237
117 3300005548 Ga0070665_100118010 Ga0070665_1001180101 238
118 3300005614 Ga0068856_100694763 Ga0068856_1006947631 238
119 3300046689 Ga0495613_0001713 Ga0495613_0001713_9107_9880 238
120 3300053156 Ga0500622_0007547 Ga0500622_0007547_2237_3016 238
121 3300042876 Ga0451577_0081542 Ga0451577_0081542_2005_2745 240
122 3300005456 Ga0070678_100340143 Ga0070678_1003401431 241
123 3300026121 Ga0207683_10385365 Ga0207683_103853651 241
124 3300053091 Ga0500647_0004051 Ga0500647_0004051_1852_2649 241
125 3300053111 Ga0500572_001507 Ga0500572_001507_5237_6040 241
126 3300028800 Ga0265338_10009552 Ga0265338_100095523 242
127 3300037418 Ga0395900_0130218 Ga0395900_0130218_1800_2528 242
128 3300037471 Ga0395905_0357030 Ga0395905_0357030_514_1242 242
129 3300049581 Ga0501047_0246489 Ga0501047_0246489_477_1256 242
130 3300049575 Ga0501039_0038758 Ga0501039_0038758_1429_2160 243
131 3300049576 Ga0501040_0135585 Ga0501040_0135585_787_1518 243
132 3300049587 Ga0501071_0169304 Ga0501071_0169304_782_1513 243
133 3300049588 Ga0501072_0001276 Ga0501072_0001276_12872_13603 243
134 3300049591 Ga0501075_0076112 Ga0501075_0076112_622_1353 243
135 3300049592 Ga0501076_0064042 Ga0501076_0064042_1745_2476 243
136 3300049743 Ga0501081_0008913 Ga0501081_0008913_3617_4348 243
137 3300050507 nmdc:mga05p37_93255_c1 nmdc:mga05p37_93255_c1_2160_2891 243
138 3300050509 nmdc:mga0qj67_36838_c1 nmdc:mga0qj67_36838_c1_1693_2424 243
139 3300050510 nmdc:mga06r32_32383_c1 nmdc:mga06r32_32383_c1_2266_2997 243
140 3300054114 Ga0501084_0020379 Ga0501084_0020379_2578_3309 243
141 3300060353 Ga0501082_0142627 Ga0501082_0142627_579_1310 243
142 3300005445 Ga0070708_100004094 Ga0070708_1000040947 244
143 3300005467 Ga0070706_100009125 Ga0070706_1000091257 244
144 3300005468 Ga0070707_100004905 Ga0070707_1000049055 244
145 3300005471 Ga0070698_100032216 Ga0070698_1000322163 244
146 3300005518 Ga0070699_100005189 Ga0070699_1000051897 244
147 3300005530 Ga0070679_100282801 Ga0070679_1002828012 244
148 3300005536 Ga0070697_100002396 Ga0070697_1000023964 244
149 3300005549 Ga0070704_100379879 Ga0070704_1003798791 244
150 3300025910 Ga0207684_10000746 Ga0207684_1000074620 244
151 3300025922 Ga0207646_10002863 Ga0207646_1000286314 244
152 3300039438 Ga0436360_0219999 Ga0436360_0219999_1253_2017 244
153 3300049588 Ga0501072_0093101 Ga0501072_0093101_886_1620 244
154 3300049591 Ga0501075_0109497 Ga0501075_0109497_578_1312 244
155 3300049741 Ga0501079_0192782 Ga0501079_0192782_207_941 244
156 3300061734 Ga0530510_0003571 Ga0530510_0003571_175_909 244
157 3300003347 JGI26128J50194_1000333 JGI26128J50194_10003332 245
158 3300005293 Ga0065715_10132737 Ga0065715_101327372 245
159 3300005295 Ga0065707_10215216 Ga0065707_102152162 245
160 3300005328 Ga0070676_10032931 Ga0070676_100329314 245
161 3300005328 Ga0070676_10115422 Ga0070676_101154222 245
162 3300005329 Ga0070683_100065748 Ga0070683_1000657482 245
163 3300005330 Ga0070690_100217698 Ga0070690_1002176982 245
164 3300005331 Ga0070670_100019652 Ga0070670_1000196523 245
165 3300005331 Ga0070670_100602666 Ga0070670_1006026661 245
166 3300005334 Ga0068869_100005890 Ga0068869_1000058905 245
167 3300005334 Ga0068869_100032040 Ga0068869_1000320402 245
168 3300005336 Ga0070680_100001053 Ga0070680_10000105317 245
169 3300005336 Ga0070680_100006965 Ga0070680_1000069656 245
170 3300005336 Ga0070680_100292440 Ga0070680_1002924401 245
171 3300005337 Ga0070682_100001390 Ga0070682_1000013906 245
172 3300005339 Ga0070660_100004277 Ga0070660_1000042775 245
173 3300005340 Ga0070689_100035910 Ga0070689_1000359103 245
174 3300005341 Ga0070691_10009887 Ga0070691_100098873 245
175 3300005341 Ga0070691_10012022 Ga0070691_100120223 245
176 3300005341 Ga0070691_10016034 Ga0070691_100160344 245
177 3300005344 Ga0070661_100000703 Ga0070661_10000070324 245
178 3300005345 Ga0070692_10000029 Ga0070692_100000293 245
179 3300005345 Ga0070692_10312275 Ga0070692_103122751 245
180 3300005347 Ga0070668_100560034 Ga0070668_1005600341 245
181 3300005353 Ga0070669_100099212 Ga0070669_1000992124 245
182 3300005355 Ga0070671_100511103 Ga0070671_1005111032 245
183 3300005364 Ga0070673_100245417 Ga0070673_1002454172 245
184 3300005366 Ga0070659_100006955 Ga0070659_1000069555 245
185 3300005406 Ga0070703_10001000 Ga0070703_100010008 245
186 3300005438 Ga0070701_10025563 Ga0070701_100255632 245
187 3300005438 Ga0070701_10058869 Ga0070701_100588692 245
188 3300005438 Ga0070701_10130553 Ga0070701_101305532 245
189 3300005439 Ga0070711_100195644 Ga0070711_1001956442 245
190 3300005440 Ga0070705_100000347 Ga0070705_10000034722 245
191 3300005440 Ga0070705_100017961 Ga0070705_1000179612 245
192 3300005440 Ga0070705_100157956 Ga0070705_1001579562 245
193 3300005441 Ga0070700_100019741 Ga0070700_1000197414 245
194 3300005441 Ga0070700_100037663 Ga0070700_1000376632 245
195 3300005441 Ga0070700_100110093 Ga0070700_1001100931 245
196 3300005444 Ga0070694_100002904 Ga0070694_1000029047 245
197 3300005444 Ga0070694_100007439 Ga0070694_1000074398 245
198 3300005444 Ga0070694_100030812 Ga0070694_1000308121 245
199 3300005444 Ga0070694_100055735 Ga0070694_1000557351 245
200 3300005444 Ga0070694_100178808 Ga0070694_1001788082 245
201 3300005444 Ga0070694_100694073 Ga0070694_1006940731 245
202 3300005445 Ga0070708_100184561 Ga0070708_1001845611 245
203 3300005445 Ga0070708_100190967 Ga0070708_1001909672 245
204 3300005445 Ga0070708_100374035 Ga0070708_1003740352 245
205 3300005445 Ga0070708_100433169 Ga0070708_1004331691 245
206 3300005445 Ga0070708_100453119 Ga0070708_1004531191 245
207 3300005455 Ga0070663_100008299 Ga0070663_1000082992 245
208 3300005455 Ga0070663_100543991 Ga0070663_1005439911 245
209 3300005457 Ga0070662_100012635 Ga0070662_1000126354 245
210 3300005458 Ga0070681_10046542 Ga0070681_100465422 245
211 3300005459 Ga0068867_100000705 Ga0068867_10000070516 245
212 3300005459 Ga0068867_100089046 Ga0068867_1000890462 245
213 3300005459 Ga0068867_100376348 Ga0068867_1003763482 245
214 3300005467 Ga0070706_100003119 Ga0070706_1000031197 245
215 3300005467 Ga0070706_100022643 Ga0070706_1000226436 245
216 3300005467 Ga0070706_100075397 Ga0070706_1000753973 245
217 3300005468 Ga0070707_100000653 Ga0070707_10000065326 245
218 3300005468 Ga0070707_100009854 Ga0070707_1000098545 245
219 3300005468 Ga0070707_100026589 Ga0070707_1000265893 245
220 3300005468 Ga0070707_100091021 Ga0070707_1000910212 245
221 3300005471 Ga0070698_100002225 Ga0070698_10000222515 245
222 3300005471 Ga0070698_100043266 Ga0070698_1000432663 245
223 3300005471 Ga0070698_100354270 Ga0070698_1003542702 245
224 3300005471 Ga0070698_100374862 Ga0070698_1003748622 245
225 3300005518 Ga0070699_100001487 Ga0070699_10000148713 245
226 3300005518 Ga0070699_100012466 Ga0070699_1000124662 245
227 3300005518 Ga0070699_100068829 Ga0070699_1000688294 245
228 3300005518 Ga0070699_100077173 Ga0070699_1000771733 245
229 3300005518 Ga0070699_100394615 Ga0070699_1003946151 245
230 3300005518 Ga0070699_100498566 Ga0070699_1004985662 245
231 3300005518 Ga0070699_100559116 Ga0070699_1005591161 245
232 3300005530 Ga0070679_100000403 Ga0070679_1000004036 245
233 3300005536 Ga0070697_100013678 Ga0070697_1000136783 245
234 3300005536 Ga0070697_100048309 Ga0070697_1000483094 245
235 3300005536 Ga0070697_100132629 Ga0070697_1001326292 245
236 3300005536 Ga0070697_100185627 Ga0070697_1001856272 245
237 3300005536 Ga0070697_100363921 Ga0070697_1003639211 245
238 3300005539 Ga0068853_100000808 Ga0068853_10000080810 245
239 3300005543 Ga0070672_100108634 Ga0070672_1001086342 245
240 3300005545 Ga0070695_100000668 Ga0070695_1000006685 245
241 3300005545 Ga0070695_100005074 Ga0070695_1000050745 245
242 3300005545 Ga0070695_100008983 Ga0070695_1000089835 245
243 3300005545 Ga0070695_100093448 Ga0070695_1000934482 245
244 3300005545 Ga0070695_100099461 Ga0070695_1000994612 245
245 3300005545 Ga0070695_100125574 Ga0070695_1001255742 245
246 3300005546 Ga0070696_100012891 Ga0070696_1000128915 245
247 3300005546 Ga0070696_100026754 Ga0070696_1000267546 245
248 3300005546 Ga0070696_100066579 Ga0070696_1000665792 245
249 3300005547 Ga0070693_100000573 Ga0070693_10000057314 245
250 3300005549 Ga0070704_100000240 Ga0070704_10000024020 245
251 3300005549 Ga0070704_100122536 Ga0070704_1001225362 245
252 3300005549 Ga0070704_100205974 Ga0070704_1002059742 245
253 3300005549 Ga0070704_100365073 Ga0070704_1003650732 245
254 3300005563 Ga0068855_100000462 Ga0068855_10000046224 245
255 3300005564 Ga0070664_100002902 Ga0070664_10000290213 245
256 3300005577 Ga0068857_100110323 Ga0068857_1001103233 245
257 3300005577 Ga0068857_100931225 Ga0068857_1009312251 245
258 3300005578 Ga0068854_100001177 Ga0068854_10000117710 245
259 3300005614 Ga0068856_100004303 Ga0068856_1000043034 245
260 3300005615 Ga0070702_100370122 Ga0070702_1003701221 245
261 3300005616 Ga0068852_100071274 Ga0068852_1000712743 245
262 3300005617 Ga0068859_100001671 Ga0068859_1000016712 245
263 3300005618 Ga0068864_100002356 Ga0068864_1000023566 245
264 3300005618 Ga0068864_100046193 Ga0068864_1000461932 245
265 3300005840 Ga0068870_10003549 Ga0068870_100035493 245
266 3300005840 Ga0068870_10070296 Ga0068870_100702962 245
267 3300005841 Ga0068863_100020982 Ga0068863_1000209824 245
268 3300005841 Ga0068863_100124552 Ga0068863_1001245523 245
269 3300005842 Ga0068858_100049390 Ga0068858_1000493903 245
270 3300005843 Ga0068860_100022487 Ga0068860_1000224876 245
271 3300005844 Ga0068862_100002540 Ga0068862_10000254012 245
272 3300005844 Ga0068862_100117166 Ga0068862_1001171663 245
273 3300005844 Ga0068862_100134605 Ga0068862_1001346051 245
274 3300005844 Ga0068862_100732280 Ga0068862_1007322802 245
275 3300005937 Ga0081455_10000074 Ga0081455_1000007477 245
276 3300005937 Ga0081455_10000263 Ga0081455_1000026351 245
277 3300005937 Ga0081455_10217852 Ga0081455_102178521 245
278 3300005983 Ga0081540_1000017 Ga0081540_1000017150 245
279 3300005983 Ga0081540_1033550 Ga0081540_10335503 245
280 3300005983 Ga0081540_1051903 Ga0081540_10519031 245
281 3300005985 Ga0081539_10055381 Ga0081539_100553811 245
282 3300006173 Ga0070716_100007739 Ga0070716_1000077394 245
283 3300006175 Ga0070712_100137021 Ga0070712_1001370211 245
284 3300006237 Ga0097621_100090915 Ga0097621_1000909152 245
285 3300006358 Ga0068871_100039961 Ga0068871_1000399613 245
286 3300006844 Ga0075428_100020538 Ga0075428_10002053810 245
287 3300006844 Ga0075428_100103663 Ga0075428_1001036635 245
288 3300006846 Ga0075430_100007711 Ga0075430_1000077113 245
289 3300006847 Ga0075431_100004634 Ga0075431_1000046347 245
290 3300006847 Ga0075431_100169181 Ga0075431_1001691812 245
291 3300006847 Ga0075431_100186509 Ga0075431_1001865092 245
292 3300006847 Ga0075431_100560364 Ga0075431_1005603641 245
293 3300006847 Ga0075431_100575073 Ga0075431_1005750732 245
294 3300006852 Ga0075433_10001928 Ga0075433_100019287 245
295 3300006852 Ga0075433_10008706 Ga0075433_100087064 245
296 3300006852 Ga0075433_10057068 Ga0075433_100570682 245
297 3300006871 Ga0075434_100015061 Ga0075434_1000150614 245
298 3300006871 Ga0075434_100016891 Ga0075434_1000168917 245
299 3300006871 Ga0075434_100019048 Ga0075434_1000190482 245
300 3300006871 Ga0075434_100054352 Ga0075434_1000543521 245
301 3300006871 Ga0075434_100659468 Ga0075434_1006594681 245
302 3300006880 Ga0075429_100008728 Ga0075429_1000087283 245
303 3300006880 Ga0075429_100026834 Ga0075429_1000268344 245
304 3300006880 Ga0075429_100033193 Ga0075429_1000331934 245
305 3300006880 Ga0075429_100045162 Ga0075429_1000451624 245
306 3300006880 Ga0075429_100274623 Ga0075429_1002746232 245
307 3300006914 Ga0075436_100099323 Ga0075436_1000993233 245
308 3300006931 Ga0097620_100001671 Ga0097620_1000016712 245
309 3300007076 Ga0075435_100017972 Ga0075435_1000179723 245
310 3300007076 Ga0075435_100054091 Ga0075435_1000540912 245
311 3300007076 Ga0075435_100193054 Ga0075435_1001930542 245
312 3300007076 Ga0075435_100499359 Ga0075435_1004993592 245
313 3300007265 Ga0099794_10003812 Ga0099794_100038122 245
314 3300007265 Ga0099794_10010552 Ga0099794_100105524 245
315 3300007265 Ga0099794_10040605 Ga0099794_100406053 245
316 3300009094 Ga0111539_10115750 Ga0111539_101157503 245
317 3300009094 Ga0111539_10116432 Ga0111539_101164322 245
318 3300009094 Ga0111539_10191407 Ga0111539_101914072 245
319 3300009147 Ga0114129_10015925 Ga0114129_100159258 245
320 3300009147 Ga0114129_10016561 Ga0114129_1001656110 245
321 3300009147 Ga0114129_10040884 Ga0114129_100408845 245
322 3300009147 Ga0114129_10058855 Ga0114129_100588554 245
323 3300009147 Ga0114129_10077184 Ga0114129_100771843 245
324 3300009147 Ga0114129_10124701 Ga0114129_101247015 245
325 3300009147 Ga0114129_10169545 Ga0114129_101695453 245
326 3300009147 Ga0114129_10250744 Ga0114129_102507442 245
327 3300009147 Ga0114129_10308054 Ga0114129_103080543 245
328 3300009148 Ga0105243_10061656 Ga0105243_100616563 245
329 3300009148 Ga0105243_10074268 Ga0105243_100742682 245
330 3300009148 Ga0105243_10406403 Ga0105243_104064032 245
331 3300009148 Ga0105243_10429285 Ga0105243_104292852 245
332 3300009174 Ga0105241_10000334 Ga0105241_100003349 245
333 3300009174 Ga0105241_10039866 Ga0105241_100398663 245
334 3300009176 Ga0105242_10010946 Ga0105242_100109467 245
335 3300009177 Ga0105248_10095937 Ga0105248_100959373 245
336 3300009177 Ga0105248_10135151 Ga0105248_101351513 245
337 3300009553 Ga0105249_10063722 Ga0105249_100637222 245
338 3300009553 Ga0105249_10127839 Ga0105249_101278392 245
339 3300009553 Ga0105249_10128176 Ga0105249_101281762 245
340 3300009553 Ga0105249_10739007 Ga0105249_107390071 245
341 3300010375 Ga0105239_10053250 Ga0105239_100532502 245
342 3300011119 Ga0105246_10077064 Ga0105246_100770643 245
343 3300013100 Ga0157373_10000379 Ga0157373_1000037924 245
344 3300013102 Ga0157371_10129203 Ga0157371_101292032 245
345 3300013306 Ga0163162_10126896 Ga0163162_101268962 245
346 3300013306 Ga0163162_10511084 Ga0163162_105110842 245
347 3300013306 Ga0163162_10711046 Ga0163162_107110462 245
348 3300013307 Ga0157372_10000135 Ga0157372_1000013529 245
349 3300013308 Ga0157375_10086056 Ga0157375_100860562 245
350 3300013308 Ga0157375_10780244 Ga0157375_107802442 245
351 3300014325 Ga0163163_10458433 Ga0163163_104584331 245
352 3300014968 Ga0157379_10095352 Ga0157379_100953524 245
353 3300014968 Ga0157379_10178804 Ga0157379_101788042 245
354 3300020070 Ga0206356_10892825 Ga0206356_108928251 245
355 3300020078 Ga0206352_10926330 Ga0206352_109263301 245
356 3300020080 Ga0206350_10906670 Ga0206350_109066701 245
357 3300021388 Ga0213875_10075658 Ga0213875_100756581 245
358 3300021388 Ga0213875_10081146 Ga0213875_100811462 245
359 3300025885 Ga0207653_10000475 Ga0207653_1000047514 245
360 3300025885 Ga0207653_10013346 Ga0207653_100133463 245
361 3300025885 Ga0207653_10022438 Ga0207653_100224382 245
362 3300025904 Ga0207647_10034110 Ga0207647_100341103 245
363 3300025905 Ga0207685_10019191 Ga0207685_100191911 245
364 3300025905 Ga0207685_10210260 Ga0207685_102102602 245
365 3300025906 Ga0207699_10157986 Ga0207699_101579861 245
366 3300025907 Ga0207645_10000075 Ga0207645_1000007511 245
367 3300025908 Ga0207643_10001707 Ga0207643_100017076 245
368 3300025908 Ga0207643_10016247 Ga0207643_100162473 245
369 3300025910 Ga0207684_10001638 Ga0207684_1000163820 245
370 3300025910 Ga0207684_10003090 Ga0207684_1000309010 245
371 3300025910 Ga0207684_10012194 Ga0207684_100121943 245
372 3300025910 Ga0207684_10019452 Ga0207684_100194524 245
373 3300025910 Ga0207684_10146764 Ga0207684_101467642 245
374 3300025910 Ga0207684_10381520 Ga0207684_103815201 245
375 3300025911 Ga0207654_10001071 Ga0207654_100010711 245
376 3300025912 Ga0207707_10000135 Ga0207707_1000013525 245
377 3300025915 Ga0207693_10003315 Ga0207693_100033159 245
378 3300025916 Ga0207663_10424003 Ga0207663_104240032 245
379 3300025917 Ga0207660_10000688 Ga0207660_100006886 245
380 3300025917 Ga0207660_10012425 Ga0207660_100124253 245
381 3300025917 Ga0207660_10195556 Ga0207660_101955562 245
382 3300025919 Ga0207657_10000037 Ga0207657_1000003781 245
383 3300025920 Ga0207649_10029372 Ga0207649_100293722 245
384 3300025921 Ga0207652_10002292 Ga0207652_1000229214 245
385 3300025922 Ga0207646_10004177 Ga0207646_100041774 245
386 3300025922 Ga0207646_10006979 Ga0207646_100069796 245
387 3300025922 Ga0207646_10014266 Ga0207646_100142665 245
388 3300025922 Ga0207646_10031519 Ga0207646_100315192 245
389 3300025922 Ga0207646_10057995 Ga0207646_100579954 245
390 3300025922 Ga0207646_10073172 Ga0207646_100731723 245
391 3300025922 Ga0207646_10149492 Ga0207646_101494924 245
392 3300025923 Ga0207681_10048883 Ga0207681_100488832 245
393 3300025923 Ga0207681_10054501 Ga0207681_100545013 245
394 3300025925 Ga0207650_10012455 Ga0207650_100124555 245
395 3300025932 Ga0207690_10000562 Ga0207690_100005623 245
396 3300025933 Ga0207706_10011250 Ga0207706_100112504 245
397 3300025935 Ga0207709_10061209 Ga0207709_100612092 245
398 3300025935 Ga0207709_10184358 Ga0207709_101843582 245
399 3300025935 Ga0207709_10257457 Ga0207709_102574572 245
400 3300025935 Ga0207709_10311090 Ga0207709_103110902 245
401 3300025936 Ga0207670_10043530 Ga0207670_100435303 245
402 3300025936 Ga0207670_10098468 Ga0207670_100984681 245
403 3300025937 Ga0207669_10599598 Ga0207669_105995981 245
404 3300025939 Ga0207665_10000576 Ga0207665_1000057613 245
405 3300025940 Ga0207691_10134475 Ga0207691_101344752 245
406 3300025941 Ga0207711_10199391 Ga0207711_101993912 245
407 3300025941 Ga0207711_10339940 Ga0207711_103399402 245
408 3300025942 Ga0207689_10000029 Ga0207689_1000002955 245
409 3300025942 Ga0207689_10015346 Ga0207689_100153464 245
410 3300025942 Ga0207689_10289428 Ga0207689_102894281 245
411 3300025945 Ga0207679_10003224 Ga0207679_100032246 245
412 3300025949 Ga0207667_10000652 Ga0207667_1000065223 245
413 3300025960 Ga0207651_10279365 Ga0207651_102793652 245
414 3300025960 Ga0207651_10317319 Ga0207651_103173192 245
415 3300025961 Ga0207712_10014975 Ga0207712_100149752 245
416 3300025961 Ga0207712_10667215 Ga0207712_106672151 245
417 3300025981 Ga0207640_10008161 Ga0207640_100081615 245
418 3300025981 Ga0207640_10160318 Ga0207640_101603181 245
419 3300026041 Ga0207639_10063006 Ga0207639_100630062 245
420 3300026067 Ga0207678_10017042 Ga0207678_100170426 245
421 3300026067 Ga0207678_10452490 Ga0207678_104524901 245
422 3300026075 Ga0207708_10031915 Ga0207708_100319154 245
423 3300026075 Ga0207708_10041994 Ga0207708_100419941 245
424 3300026075 Ga0207708_10080563 Ga0207708_100805633 245
425 3300026075 Ga0207708_10426395 Ga0207708_104263952 245
426 3300026078 Ga0207702_10014520 Ga0207702_100145201 245
427 3300026088 Ga0207641_10061004 Ga0207641_100610043 245
428 3300026088 Ga0207641_10444180 Ga0207641_104441802 245
429 3300026089 Ga0207648_10000552 Ga0207648_1000055218 245
430 3300026089 Ga0207648_10376304 Ga0207648_103763041 245
431 3300026116 Ga0207674_10000306 Ga0207674_1000030640 245
432 3300026116 Ga0207674_10042965 Ga0207674_100429653 245
433 3300026116 Ga0207674_10106088 Ga0207674_101060881 245
434 3300026118 Ga0207675_100032074 Ga0207675_1000320744 245
435 3300026118 Ga0207675_100107562 Ga0207675_1001075623 245
436 3300027360 Ga0209969_1002067 Ga0209969_10020672 245
437 3300027424 Ga0209984_1001656 Ga0209984_10016562 245
438 3300027424 Ga0209984_1011237 Ga0209984_10112371 245
439 3300027462 Ga0210000_1002112 Ga0210000_10021122 245
440 3300027471 Ga0209995_1011423 Ga0209995_10114232 245
441 3300027471 Ga0209995_1021065 Ga0209995_10210651 245
442 3300027543 Ga0209999_1004084 Ga0209999_10040844 245
443 3300027552 Ga0209982_1014340 Ga0209982_10143402 245
444 3300027614 Ga0209970_1005428 Ga0209970_10054282 245
445 3300027617 Ga0210002_1001653 Ga0210002_10016533 245
446 3300027665 Ga0209983_1000146 Ga0209983_10001462 245
447 3300027671 Ga0209588_1024370 Ga0209588_10243702 245
448 3300027682 Ga0209971_1000008 Ga0209971_100000888 245
449 3300027695 Ga0209966_1000187 Ga0209966_100018713 245
450 3300027717 Ga0209998_10000016 Ga0209998_1000001614 245
451 3300027717 Ga0209998_10007971 Ga0209998_100079712 245
452 3300027876 Ga0209974_10001677 Ga0209974_100016775 245
453 3300027907 Ga0207428_10087469 Ga0207428_100874692 245
454 3300027907 Ga0207428_10288822 Ga0207428_102888221 245
455 3300028380 Ga0268265_10003670 Ga0268265_100036703 245
456 3300028380 Ga0268265_10186104 Ga0268265_101861043 245
457 3300028380 Ga0268265_10205963 Ga0268265_102059632 245
458 3300028381 Ga0268264_10045908 Ga0268264_100459083 245
459 3300031548 Ga0307408_100024744 Ga0307408_1000247446 245
460 3300031548 Ga0307408_100248057 Ga0307408_1002480571 245
461 3300031824 Ga0307413_10074005 Ga0307413_100740052 245
462 3300031911 Ga0307412_10366696 Ga0307412_103666962 245
463 3300031995 Ga0307409_100302282 Ga0307409_1003022822 245
464 3300032002 Ga0307416_100128963 Ga0307416_1001289632 245
465 3300032002 Ga0307416_100356753 Ga0307416_1003567532 245
466 3300032002 Ga0307416_100881606 Ga0307416_1008816062 245
467 3300032004 Ga0307414_10807191 Ga0307414_108071911 245
468 3300034818 Ga0373950_0026318 Ga0373950_0026318_10_747 245
469 3300034819 Ga0373958_0018006 Ga0373958_0018006_458_1198 245
470 3300034820 Ga0373959_0055580 Ga0373959_0055580_105_842 245
471 3300035084 Ga0373928_0018085 Ga0373928_0018085_108_848 245
472 3300035084 Ga0373928_0034492 Ga0373928_0034492_147_884 245
473 3300035088 Ga0373940_0010152 Ga0373940_0010152_1078_1818 245
474 3300035090 Ga0373949_0015057 Ga0373949_0015057_946_1683 245
475 3300035115 Ga0373941_0018071 Ga0373941_0018071_579_1319 245
476 3300035121 Ga0373960_0002818 Ga0373960_0002818_1798_2535 245
477 3300035207 Ga0373942_0015299 Ga0373942_0015299_279_1019 245
478 3300035242 Ga0373962_0020678 Ga0373962_0020678_188_925 245
479 3300035242 Ga0373962_0053405 Ga0373962_0053405_308_1048 245
480 3300035691 Ga0373931_0004831 Ga0373931_0004831_2414_3154 245
481 3300039437 Ga0436365_0488470 Ga0436365_0488470_15099_15878 245
482 3300039437 Ga0436365_1654887 Ga0436365_1654887_589_1350 245
483 3300042157 Ga0439458_0003469 Ga0439458_0003469_1184_1921 245
484 3300042438 Ga0439459_0003082 Ga0439459_0003082_58_795 245
485 3300042461 Ga0439460_0002029 Ga0439460_0002029_4009_4746 245
486 3300042876 Ga0451577_0043881 Ga0451577_0043881_1042_1779 245
487 3300042876 Ga0451577_0089884 Ga0451577_0089884_72_809 245
488 3300044673 Ga0453683_0026309 Ga0453683_0026309_839_1576 245
489 3300044673 Ga0453683_0043142 Ga0453683_0043142_198_935 245
490 3300044673 Ga0453683_0142708 Ga0453683_0142708_566_1303 245
491 3300044712 Ga0453684_0120577 Ga0453684_0120577_2401_3138 245
492 3300045051 Ga0451576_0017221 Ga0451576_0017221_7049_7786 245
493 3300045051 Ga0451576_0021782 Ga0451576_0021782_1913_2650 245
494 3300045051 Ga0451576_0031255 Ga0451576_0031255_1729_2466 245
495 3300045051 Ga0451576_0040420 Ga0451576_0040420_2420_3157 245
496 3300045051 Ga0451576_0088044 Ga0451576_0088044_1134_1871 245
497 3300045051 Ga0451576_0179881 Ga0451576_0179881_633_1373 245
498 3300045051 Ga0451576_0489550 Ga0451576_0489550_512_1258 245
499 3300046472 Ga0495580_0010780 Ga0495580_0010780_2174_2911 245
500 3300046472 Ga0495580_0165883 Ga0495580_0165883_61_798 245
501 3300046491 Ga0495584_0077036 Ga0495584_0077036_588_1325 245
502 3300047318 Ga0495636_0168280 Ga0495636_0168280_160_903 245
503 3300048905 Ga0496102_0085407 Ga0496102_0085407_1244_1984 245
504 3300048907 Ga0496104_0100178 Ga0496104_0100178_603_1343 245
505 3300048908 Ga0496105_0049557 Ga0496105_0049557_1561_2301 245
506 3300048909 Ga0496106_0016979 Ga0496106_0016979_2693_3433 245
507 3300048909 Ga0496106_0021548 Ga0496106_0021548_547_1284 245
508 3300048911 Ga0496108_0009227 Ga0496108_0009227_6712_7452 245
509 3300048912 Ga0496109_0044402 Ga0496109_0044402_862_1602 245
510 3300048913 Ga0496110_0073040 Ga0496110_0073040_2110_2850 245
511 3300048914 Ga0496111_0197834 Ga0496111_0197834_200_940 245
512 3300048915 Ga0496112_0134716 Ga0496112_0134716_503_1240 245
513 3300048916 Ga0496113_0250016 Ga0496113_0250016_110_850 245
514 3300048918 Ga0496115_0003412 Ga0496115_0003412_846_1586 245
515 3300049568 Ga0501031_0058974 Ga0501031_0058974_1278_2015 245
516 3300049568 Ga0501031_0276383 Ga0501031_0276383_18_755 245
517 3300049569 Ga0501032_0278586 Ga0501032_0278586_259_996 245
518 3300049572 Ga0501036_0097293 Ga0501036_0097293_1732_2469 245
519 3300049573 Ga0501037_0066402 Ga0501037_0066402_1149_1898 245
520 3300049574 Ga0501038_0053638 Ga0501038_0053638_265_1002 245
521 3300049574 Ga0501038_0166189 Ga0501038_0166189_177_917 245
522 3300049575 Ga0501039_0015798 Ga0501039_0015798_525_1262 245
523 3300049575 Ga0501039_0079363 Ga0501039_0079363_246_995 245
524 3300049575 Ga0501039_0237515 Ga0501039_0237515_468_1268 245
525 3300049576 Ga0501040_0001982 Ga0501040_0001982_7315_8052 245
526 3300049576 Ga0501040_0010799 Ga0501040_0010799_2144_2881 245
527 3300049576 Ga0501040_0309001 Ga0501040_0309001_157_897 245
528 3300049577 Ga0501041_0042286 Ga0501041_0042286_2007_2747 245
529 3300049578 Ga0501042_0001517 Ga0501042_0001517_11352_12089 245
530 3300049578 Ga0501042_0018652 Ga0501042_0018652_651_1451 245
531 3300049578 Ga0501042_0045329 Ga0501042_0045329_1612_2349 245
532 3300049578 Ga0501042_0091274 Ga0501042_0091274_777_1514 245
533 3300049579 Ga0501043_0032810 Ga0501043_0032810_149_898 245
534 3300049579 Ga0501043_0053090 Ga0501043_0053090_984_1721 245
535 3300049580 Ga0501046_0009495 Ga0501046_0009495_5118_5855 245
536 3300049580 Ga0501046_0234672 Ga0501046_0234672_226_963 245
537 3300049580 Ga0501046_0302712 Ga0501046_0302712_201_1001 245
538 3300049581 Ga0501047_0135299 Ga0501047_0135299_125_862 245
539 3300049582 Ga0501048_0011174 Ga0501048_0011174_4617_5354 245
540 3300049582 Ga0501048_0022183 Ga0501048_0022183_2178_2915 245
541 3300049582 Ga0501048_0037034 Ga0501048_0037034_223_960 245
542 3300049582 Ga0501048_0467660 Ga0501048_0467660_39_776 245
543 3300049583 Ga0501067_0103099 Ga0501067_0103099_592_1329 245
544 3300049584 Ga0501068_0112203 Ga0501068_0112203_55_792 245
545 3300049585 Ga0501069_0317664 Ga0501069_0317664_167_904 245
546 3300049587 Ga0501071_0007379 Ga0501071_0007379_143_880 245
547 3300049587 Ga0501071_0035050 Ga0501071_0035050_441_1178 245
548 3300049588 Ga0501072_0023626 Ga0501072_0023626_2465_3202 245
549 3300049588 Ga0501072_0030081 Ga0501072_0030081_1389_2126 245
550 3300049588 Ga0501072_0036089 Ga0501072_0036089_2585_3322 245
551 3300049588 Ga0501072_0233585 Ga0501072_0233585_463_1200 245
552 3300049590 Ga0501074_0002117 Ga0501074_0002117_8917_9654 245
553 3300049590 Ga0501074_0029284 Ga0501074_0029284_294_1031 245
554 3300049591 Ga0501075_0000955 Ga0501075_0000955_9204_9941 245
555 3300049591 Ga0501075_0004974 Ga0501075_0004974_6051_6788 245
556 3300049591 Ga0501075_0012336 Ga0501075_0012336_4304_5104 245
557 3300049591 Ga0501075_0082154 Ga0501075_0082154_1421_2158 245
558 3300049591 Ga0501075_0107129 Ga0501075_0107129_29_769 245
559 3300049592 Ga0501076_0003931 Ga0501076_0003931_238_975 245
560 3300049592 Ga0501076_0240422 Ga0501076_0240422_722_1462 245
561 3300049593 Ga0501077_0001617 Ga0501077_0001617_1356_2093 245
562 3300049593 Ga0501077_0031565 Ga0501077_0031565_253_993 245
563 3300049593 Ga0501077_0052455 Ga0501077_0052455_150_887 245
564 3300049593 Ga0501077_0189257 Ga0501077_0189257_552_1289 245
565 3300049593 Ga0501077_0254007 Ga0501077_0254007_335_1072 245
566 3300049741 Ga0501079_0001548 Ga0501079_0001548_13795_14532 245
567 3300049741 Ga0501079_0004258 Ga0501079_0004258_9255_9992 245
568 3300049741 Ga0501079_0047343 Ga0501079_0047343_2504_3241 245
569 3300049741 Ga0501079_0138844 Ga0501079_0138844_130_870 245
570 3300049742 Ga0501080_0035335 Ga0501080_0035335_30_770 245
571 3300049742 Ga0501080_0048431 Ga0501080_0048431_2139_2876 245
572 3300049742 Ga0501080_0269885 Ga0501080_0269885_763_1500 245
573 3300049742 Ga0501080_0587591 Ga0501080_0587591_21_770 245
574 3300049743 Ga0501081_0002531 Ga0501081_0002531_2201_2938 245
575 3300049743 Ga0501081_0008158 Ga0501081_0008158_5188_5925 245
576 3300049743 Ga0501081_0031990 Ga0501081_0031990_905_1705 245
577 3300049744 Ga0501083_0002379 Ga0501083_0002379_2614_3351 245
578 3300049744 Ga0501083_0045895 Ga0501083_0045895_588_1388 245
579 3300049822 Ga0501035_0663252 Ga0501035_0663252_74_811 245
580 3300049824 Ga0501045_0000998 Ga0501045_0000998_11093_11830 245
581 3300049824 Ga0501045_0004584 Ga0501045_0004584_2855_3592 245
582 3300049824 Ga0501045_0155567 Ga0501045_0155567_659_1399 245
583 3300050507 nmdc:mga05p37_12174_c1 nmdc:mga05p37_12174_c1_5860_6597 245
584 3300050507 nmdc:mga05p37_207186_c1 nmdc:mga05p37_207186_c1_1139_1876 245
585 3300050507 nmdc:mga05p37_255932_c1 nmdc:mga05p37_255932_c1_61_834 245
586 3300050507 nmdc:mga05p37_300694_c1 nmdc:mga05p37_300694_c1_1089_1832 245
587 3300050507 nmdc:mga05p37_33356_c1 nmdc:mga05p37_33356_c1_1961_2698 245
588 3300050507 nmdc:mga05p37_52253_c1 nmdc:mga05p37_52253_c1_1561_2298 245
589 3300050507 nmdc:mga05p37_55835_c1 nmdc:mga05p37_55835_c1_2935_3678 245
590 3300050507 nmdc:mga05p37_73795_c1 nmdc:mga05p37_73795_c1_746_1483 245
591 3300050508 nmdc:mga09592_139170_c1 nmdc:mga09592_139170_c1_86_835 245
592 3300050508 nmdc:mga09592_70650_c1 nmdc:mga09592_70650_c1_1321_2064 245
593 3300050509 nmdc:mga0qj67_257075_c1 nmdc:mga0qj67_257075_c1_20_769 245
594 3300050509 nmdc:mga0qj67_276571_c1 nmdc:mga0qj67_276571_c1_144_881 245
595 3300050510 nmdc:mga06r32_237348_c1 nmdc:mga06r32_237348_c1_36_785 245
596 3300050510 nmdc:mga06r32_281584_c1 nmdc:mga06r32_281584_c1_357_1094 245
597 3300050510 nmdc:mga06r32_333008_c1 nmdc:mga06r32_333008_c1_348_1088 245
598 3300050510 nmdc:mga06r32_439739_c1 nmdc:mga06r32_439739_c1_299_1039 245
599 3300050511 nmdc:mga08y16_140101_c1 nmdc:mga08y16_140101_c1_237_977 245
600 3300050511 nmdc:mga08y16_275686_c1 nmdc:mga08y16_275686_c1_466_1206 245
601 3300050511 nmdc:mga08y16_513831_c1 nmdc:mga08y16_513831_c1_91_834 245
602 3300050512 nmdc:mga0n895_14081_c1 nmdc:mga0n895_14081_c1_3438_4178 245
603 3300050512 nmdc:mga0n895_22584_c1 nmdc:mga0n895_22584_c1_1371_2108 245
604 3300050512 nmdc:mga0n895_29591_c1 nmdc:mga0n895_29591_c1_4136_4873 245
605 3300050512 nmdc:mga0n895_42962_c1 nmdc:mga0n895_42962_c1_1736_2476 245
606 3300050513 nmdc:mga0rr50_2969_c1 nmdc:mga0rr50_2969_c1_5174_5911 245
607 3300050513 nmdc:mga0rr50_312593_c1 nmdc:mga0rr50_312593_c1_202_942 245
608 3300050513 nmdc:mga0rr50_3935_c1 nmdc:mga0rr50_3935_c1_1875_2615 245
609 3300050513 nmdc:mga0rr50_94333_c1 nmdc:mga0rr50_94333_c1_1048_1791 245
610 3300050514 nmdc:mga08x19_12943_c1 nmdc:mga08x19_12943_c1_1126_1863 245
611 3300050515 nmdc:mga0a205_160295_c1 nmdc:mga0a205_160295_c1_548_1285 245
612 3300050515 nmdc:mga0a205_259229_c1 nmdc:mga0a205_259229_c1_729_1472 245
613 3300050515 nmdc:mga0a205_2643_c1 nmdc:mga0a205_2643_c1_8474_9211 245
614 3300050515 nmdc:mga0a205_26945_c1 nmdc:mga0a205_26945_c1_433_1173 245
615 3300054114 Ga0501084_0013356 Ga0501084_0013356_4533_5333 245
616 3300054114 Ga0501084_0014517 Ga0501084_0014517_3576_4313 245
617 3300054114 Ga0501084_0027753 Ga0501084_0027753_1227_1964 245
618 3300054114 Ga0501084_0063021 Ga0501084_0063021_1457_2194 245
619 3300054114 Ga0501084_0454340 Ga0501084_0454340_38_778 245
620 3300060353 Ga0501082_0001040 Ga0501082_0001040_12934_13671 245
621 3300060353 Ga0501082_0001716 Ga0501082_0001716_9344_10081 245
622 3300060353 Ga0501082_0013358 Ga0501082_0013358_552_1301 245
623 3300060353 Ga0501082_0022856 Ga0501082_0022856_1985_2722 245
624 3300060353 Ga0501082_0043382 Ga0501082_0043382_3020_3757 245
625 3300060353 Ga0501082_0600677 Ga0501082_0600677_200_937 245
626 3300061734 Ga0530510_0005130 Ga0530510_0005130_7191_7928 245
627 3300061734 Ga0530510_0066115 Ga0530510_0066115_1218_1955 245

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.7271 78 215
4mln-assembly2.cif.gz_B crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.7244 78 215
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.709 78 215
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.7089 78 215
4mlm-assembly3.cif.gz_A crystal structure of phnz from uncultured bacterium hf130_aepn_1 0.7077 78 215
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7244 78 215 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5628 78 215 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5321 78 219 1.10.3210.10
3h37A03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3883 74 196 1.20.58.1960
af_K8ERU3_1293_1547_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3542 77 214 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2V6SUV3-F1-model_v4 HD domain-containing protein 0.9784 20 244
AF-A0A2V6SUV3-F1-model_v4 HD domain-containing protein 0.9699 20 244
AF-A0A534TMV5-F1-model_v4 HD domain-containing protein 0.9628 65 244
AF-A0A537RAN6-F1-model_v4 HD domain-containing protein 0.9619 94 244
AF-A0A383ECL3-F1-model_v4 Uncharacterized protein 0.9554 57 244

Feature Viewer

pLDDT pTM Quality
87.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map