F470601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 265 | 627 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300050515|nmdc:mga0a205_634766_c1|nmdc:mga0a205_634766_c1_13_876 |
| Length | 287 |
| Sequence | MPAEANVPADEKGNPAMSIDRDVFFDVLGGEQAAAAMSDEAKADALEHYLIESLNDTAYLDSPGYVEEQATFLQSSTPVNRRGTGAIFGDGHRDPPPLAPMPERPTLVDFFLLRMSMPTVRHLLQSATDAMKTDASEEQILACLLHDLGQAVMKVDHGWWGAQMVEPYVSEKVAWAIRYHQALRFFPDESVGYTYPELYVHIYGQDYVPEPYIRQAYQHARQHRWYMDARMVTVHDLYAFDPHATVSLDPFLDIIGRNFRQPEEGLGFDGSPVAHMWRSLIYPDHRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 195 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 196 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 257 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 258 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 259 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 262 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 263 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.28 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 95.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26128J50194_1000333 | 3300003347 | Bacteria | 2439 |
| 2 | Ga0065715_10132737 | 3300005293 | Bacteria | 1980 |
| 3 | Ga0065707_10005661 | 3300005295 | Bacteria | 3073 |
| 4 | Ga0065707_10215216 | 3300005295 | Unclassified | 1248 |
| 5 | Ga0065707_10255577 | 3300005295 | Bacteria | 1112 |
| 6 | Ga0070676_10032931 | 3300005328 | Bacteria | 2971 |
| 7 | Ga0070676_10115422 | 3300005328 | Unclassified | 1678 |
| 8 | Ga0070683_100065748 | 3300005329 | Bacteria | 3377 |
| 9 | Ga0070690_100217698 | 3300005330 | Bacteria | 1336 |
| 10 | Ga0070670_100019652 | 3300005331 | Bacteria | 5798 |
| 11 | Ga0070670_100602666 | 3300005331 | Bacteria | 983 |
| 12 | Ga0068869_100005890 | 3300005334 | Bacteria | 7740 |
| 13 | Ga0068869_100032040 | 3300005334 | Bacteria | 3702 |
| 14 | Ga0070680_100001053 | 3300005336 | Bacteria | 19744 |
| 15 | Ga0070680_100006965 | 3300005336 | Bacteria | 8616 |
| 16 | Ga0070680_100292440 | 3300005336 | Bacteria | 1381 |
| 17 | Ga0070682_100001390 | 3300005337 | Bacteria | 13645 |
| 18 | Ga0070660_100004277 | 3300005339 | Bacteria | 9863 |
| 19 | Ga0070689_100035910 | 3300005340 | Bacteria | 3789 |
| 20 | Ga0070691_10009887 | 3300005341 | Bacteria | 4345 |
| 21 | Ga0070691_10012022 | 3300005341 | Bacteria | 3963 |
| 22 | Ga0070691_10016034 | 3300005341 | Bacteria | 3444 |
| 23 | Ga0070661_100000703 | 3300005344 | Bacteria | 24523 |
| 24 | Ga0070692_10000029 | 3300005345 | Bacteria | 27136 |
| 25 | Ga0070692_10312275 | 3300005345 | Bacteria | 963 |
| 26 | Ga0070668_100560034 | 3300005347 | Bacteria | 996 |
| 27 | Ga0070669_100077149 | 3300005353 | Unclassified | 2475 |
| 28 | Ga0070669_100099212 | 3300005353 | Bacteria | 2195 |
| 29 | Ga0070671_100511103 | 3300005355 | Unclassified | 1034 |
| 30 | Ga0070673_100245417 | 3300005364 | Bacteria | 1559 |
| 31 | Ga0070659_100006955 | 3300005366 | Bacteria | 8192 |
| 32 | Ga0070703_10000101 | 3300005406 | Bacteria | 44068 |
| 33 | Ga0070703_10001000 | 3300005406 | Bacteria | 8889 |
| 34 | Ga0070709_10098936 | 3300005434 | Bacteria | 1939 |
| 35 | Ga0070713_100089195 | 3300005436 | Bacteria | 2648 |
| 36 | Ga0070701_10025563 | 3300005438 | Bacteria | 2868 |
| 37 | Ga0070701_10058869 | 3300005438 | Bacteria | 2018 |
| 38 | Ga0070701_10130553 | 3300005438 | Unclassified | 1427 |
| 39 | Ga0070711_100195644 | 3300005439 | Bacteria | 1557 |
| 40 | Ga0070705_100000062 | 3300005440 | Bacteria | 56407 |
| 41 | Ga0070705_100000347 | 3300005440 | Bacteria | 27333 |
| 42 | Ga0070705_100017961 | 3300005440 | Bacteria | 3699 |
| 43 | Ga0070705_100020002 | 3300005440 | Bacteria | 3533 |
| 44 | Ga0070705_100157956 | 3300005440 | Unclassified | 1513 |
| 45 | Ga0070700_100019741 | 3300005441 | Bacteria | 3893 |
| 46 | Ga0070700_100037663 | 3300005441 | Bacteria | 2943 |
| 47 | Ga0070700_100110093 | 3300005441 | Unclassified | 1830 |
| 48 | Ga0070694_100002904 | 3300005444 | Bacteria | 10181 |
| 49 | Ga0070694_100007439 | 3300005444 | Bacteria | 6677 |
| 50 | Ga0070694_100030812 | 3300005444 | Bacteria | 3512 |
| 51 | Ga0070694_100055735 | 3300005444 | Bacteria | 2682 |
| 52 | Ga0070694_100178808 | 3300005444 | Unclassified | 1568 |
| 53 | Ga0070694_100694073 | 3300005444 | Bacteria | 827 |
| 54 | Ga0070708_100004094 | 3300005445 | Bacteria | 11456 |
| 55 | Ga0070708_100038285 | 3300005445 | Bacteria | 4190 |
| 56 | Ga0070708_100184561 | 3300005445 | Bacteria | 1950 |
| 57 | Ga0070708_100190967 | 3300005445 | Bacteria | 1915 |
| 58 | Ga0070708_100374035 | 3300005445 | Unclassified | 1343 |
| 59 | Ga0070708_100433169 | 3300005445 | Bacteria | 1240 |
| 60 | Ga0070708_100453119 | 3300005445 | Bacteria | 1210 |
| 61 | Ga0070663_100008299 | 3300005455 | Bacteria | 6381 |
| 62 | Ga0070663_100543991 | 3300005455 | Bacteria | 970 |
| 63 | Ga0070678_100340143 | 3300005456 | Bacteria | 1287 |
| 64 | Ga0070662_100012635 | 3300005457 | Bacteria | 5603 |
| 65 | Ga0070681_10046542 | 3300005458 | Bacteria | 4337 |
| 66 | Ga0068867_100000705 | 3300005459 | Bacteria | 22254 |
| 67 | Ga0068867_100089046 | 3300005459 | Bacteria | 2340 |
| 68 | Ga0068867_100376348 | 3300005459 | Bacteria | 1192 |
| 69 | Ga0070706_100000947 | 3300005467 | Bacteria | 31676 |
| 70 | Ga0070706_100003119 | 3300005467 | Bacteria | 16410 |
| 71 | Ga0070706_100009125 | 3300005467 | Bacteria | 9237 |
| 72 | Ga0070706_100022643 | 3300005467 | Bacteria | 5786 |
| 73 | Ga0070706_100075397 | 3300005467 | Bacteria | 3121 |
| 74 | Ga0070706_100085711 | 3300005467 | Bacteria | 2919 |
| 75 | Ga0070707_100000653 | 3300005468 | Bacteria | 34576 |
| 76 | Ga0070707_100004905 | 3300005468 | Bacteria | 12540 |
| 77 | Ga0070707_100009854 | 3300005468 | Bacteria | 8892 |
| 78 | Ga0070707_100026589 | 3300005468 | Bacteria | 5496 |
| 79 | Ga0070707_100091021 | 3300005468 | Bacteria | 2953 |
| 80 | Ga0070707_100295675 | 3300005468 | Bacteria | 1573 |
| 81 | Ga0070698_100002225 | 3300005471 | Bacteria | 21473 |
| 82 | Ga0070698_100032216 | 3300005471 | Bacteria | 5430 |
| 83 | Ga0070698_100043266 | 3300005471 | Bacteria | 4618 |
| 84 | Ga0070698_100171917 | 3300005471 | Bacteria | 2107 |
| 85 | Ga0070698_100354270 | 3300005471 | Bacteria | 1399 |
| 86 | Ga0070698_100374862 | 3300005471 | Bacteria | 1355 |
| 87 | Ga0070699_100000102 | 3300005518 | Bacteria | 80731 |
| 88 | Ga0070699_100001487 | 3300005518 | Bacteria | 21471 |
| 89 | Ga0070699_100005189 | 3300005518 | Bacteria | 11456 |
| 90 | Ga0070699_100012466 | 3300005518 | Bacteria | 7336 |
| 91 | Ga0070699_100068829 | 3300005518 | Bacteria | 3075 |
| 92 | Ga0070699_100077173 | 3300005518 | Bacteria | 2900 |
| 93 | Ga0070699_100394615 | 3300005518 | Bacteria | 1250 |
| 94 | Ga0070699_100498566 | 3300005518 | Bacteria | 1106 |
| 95 | Ga0070699_100559116 | 3300005518 | Bacteria | 1042 |
| 96 | Ga0070679_100000403 | 3300005530 | Bacteria | 36876 |
| 97 | Ga0070679_100282801 | 3300005530 | Bacteria | 1611 |
| 98 | Ga0070697_100002396 | 3300005536 | Bacteria | 14432 |
| 99 | Ga0070697_100013678 | 3300005536 | Bacteria | 6368 |
| 100 | Ga0070697_100048309 | 3300005536 | Bacteria | 3450 |
| 101 | Ga0070697_100132629 | 3300005536 | Bacteria | 2090 |
| 102 | Ga0070697_100185627 | 3300005536 | Bacteria | 1763 |
| 103 | Ga0070697_100363921 | 3300005536 | Unclassified | 1250 |
| 104 | Ga0070697_100394342 | 3300005536 | Bacteria | 1200 |
| 105 | Ga0068853_100000808 | 3300005539 | Bacteria | 21801 |
| 106 | Ga0070672_100108634 | 3300005543 | Bacteria | 2259 |
| 107 | Ga0070695_100000668 | 3300005545 | Bacteria | 18292 |
| 108 | Ga0070695_100005074 | 3300005545 | Bacteria | 7755 |
| 109 | Ga0070695_100008983 | 3300005545 | Bacteria | 5939 |
| 110 | Ga0070695_100093448 | 3300005545 | Bacteria | 2013 |
| 111 | Ga0070695_100099461 | 3300005545 | Bacteria | 1956 |
| 112 | Ga0070695_100125574 | 3300005545 | Bacteria | 1761 |
| 113 | Ga0070695_100165317 | 3300005545 | Unclassified | 1557 |
| 114 | Ga0070696_100007451 | 3300005546 | Bacteria | 7320 |
| 115 | Ga0070696_100012891 | 3300005546 | Bacteria | 5611 |
| 116 | Ga0070696_100020025 | 3300005546 | Bacteria | 4536 |
| 117 | Ga0070696_100026754 | 3300005546 | Bacteria | 3926 |
| 118 | Ga0070696_100066579 | 3300005546 | Bacteria | 2526 |
| 119 | Ga0070696_100180847 | 3300005546 | Bacteria | 1564 |
| 120 | Ga0070693_100000573 | 3300005547 | Bacteria | 16335 |
| 121 | Ga0070693_100111513 | 3300005547 | Unclassified | 1683 |
| 122 | Ga0070665_100118010 | 3300005548 | Bacteria | 2656 |
| 123 | Ga0070704_100000240 | 3300005549 | Bacteria | 23438 |
| 124 | Ga0070704_100059179 | 3300005549 | Bacteria | 2732 |
| 125 | Ga0070704_100122536 | 3300005549 | Bacteria | 2000 |
| 126 | Ga0070704_100205974 | 3300005549 | Bacteria | 1591 |
| 127 | Ga0070704_100224831 | 3300005549 | Unclassified | 1528 |
| 128 | Ga0070704_100365073 | 3300005549 | Bacteria | 1223 |
| 129 | Ga0070704_100379879 | 3300005549 | Bacteria | 1200 |
| 130 | Ga0068855_100000462 | 3300005563 | Bacteria | 50016 |
| 131 | Ga0070664_100002902 | 3300005564 | Bacteria | 13870 |
| 132 | Ga0068857_100110323 | 3300005577 | Bacteria | 2472 |
| 133 | Ga0068857_100931225 | 3300005577 | Bacteria | 834 |
| 134 | Ga0068854_100001177 | 3300005578 | Bacteria | 15680 |
| 135 | Ga0068856_100004303 | 3300005614 | Bacteria | 14209 |
| 136 | Ga0068856_100694763 | 3300005614 | Bacteria | 1038 |
| 137 | Ga0070702_100370122 | 3300005615 | Bacteria | 1016 |
| 138 | Ga0068852_100000409 | 3300005616 | Bacteria | 28651 |
| 139 | Ga0068852_100071274 | 3300005616 | Bacteria | 3051 |
| 140 | Ga0068859_100001671 | 3300005617 | Bacteria | 22591 |
| 141 | Ga0068864_100002356 | 3300005618 | Bacteria | 15634 |
| 142 | Ga0068864_100046193 | 3300005618 | Unclassified | 3736 |
| 143 | Ga0068861_100000004 | 3300005719 | Bacteria | 105907 |
| 144 | Ga0068870_10003549 | 3300005840 | Bacteria | 6617 |
| 145 | Ga0068870_10070296 | 3300005840 | Bacteria | 1907 |
| 146 | Ga0068863_100020982 | 3300005841 | Bacteria | 6239 |
| 147 | Ga0068863_100124552 | 3300005841 | Bacteria | 2458 |
| 148 | Ga0068858_100049390 | 3300005842 | Bacteria | 3897 |
| 149 | Ga0068860_100022487 | 3300005843 | Bacteria | 6097 |
| 150 | Ga0068862_100002540 | 3300005844 | Bacteria | 16145 |
| 151 | Ga0068862_100117166 | 3300005844 | Bacteria | 2344 |
| 152 | Ga0068862_100127618 | 3300005844 | Bacteria | 2247 |
| 153 | Ga0068862_100134605 | 3300005844 | Bacteria | 2189 |
| 154 | Ga0068862_100732280 | 3300005844 | Unclassified | 960 |
| 155 | Ga0081455_10000074 | 3300005937 | Bacteria | 107319 |
| 156 | Ga0081455_10000263 | 3300005937 | Bacteria | 69205 |
| 157 | Ga0081455_10217852 | 3300005937 | Bacteria | 1417 |
| 158 | Ga0081540_1000017 | 3300005983 | Bacteria | 164991 |
| 159 | Ga0081540_1033550 | 3300005983 | Bacteria | 2785 |
| 160 | Ga0081540_1051903 | 3300005983 | Unclassified | 2024 |
| 161 | Ga0081540_1114350 | 3300005983 | Bacteria | 1133 |
| 162 | Ga0081539_10055381 | 3300005985 | Bacteria | 2207 |
| 163 | Ga0070716_100007739 | 3300006173 | Bacteria | 5303 |
| 164 | Ga0070712_100137021 | 3300006175 | Bacteria | 1863 |
| 165 | Ga0097621_100090915 | 3300006237 | Bacteria | 2555 |
| 166 | Ga0068871_100039961 | 3300006358 | Bacteria | 3756 |
| 167 | Ga0075428_100020538 | 3300006844 | Bacteria | 7313 |
| 168 | Ga0075428_100028643 | 3300006844 | Bacteria | 6162 |
| 169 | Ga0075428_100037429 | 3300006844 | Bacteria | 5341 |
| 170 | Ga0075428_100103663 | 3300006844 | Bacteria | 3102 |
| 171 | Ga0075428_100416938 | 3300006844 | Bacteria | 1439 |
| 172 | Ga0075430_100003928 | 3300006846 | Bacteria | 12538 |
| 173 | Ga0075430_100007711 | 3300006846 | Bacteria | 9094 |
| 174 | Ga0075431_100004634 | 3300006847 | Bacteria | 13505 |
| 175 | Ga0075431_100030654 | 3300006847 | Bacteria | 5540 |
| 176 | Ga0075431_100051731 | 3300006847 | Bacteria | 4235 |
| 177 | Ga0075431_100169181 | 3300006847 | Bacteria | 2246 |
| 178 | Ga0075431_100186509 | 3300006847 | Bacteria | 2127 |
| 179 | Ga0075431_100560364 | 3300006847 | Bacteria | 1129 |
| 180 | Ga0075431_100575073 | 3300006847 | Bacteria | 1113 |
| 181 | Ga0075433_10001643 | 3300006852 | Bacteria | 16609 |
| 182 | Ga0075433_10001928 | 3300006852 | Bacteria | 15611 |
| 183 | Ga0075433_10008706 | 3300006852 | Bacteria | 8098 |
| 184 | Ga0075433_10037698 | 3300006852 | Unclassified | 4171 |
| 185 | Ga0075433_10057068 | 3300006852 | Bacteria | 3412 |
| 186 | Ga0075433_10169180 | 3300006852 | Bacteria | 1945 |
| 187 | Ga0075433_10184112 | 3300006852 | Bacteria | 1858 |
| 188 | Ga0075434_100009146 | 3300006871 | Bacteria | 9229 |
| 189 | Ga0075434_100015061 | 3300006871 | Bacteria | 7404 |
| 190 | Ga0075434_100016891 | 3300006871 | Bacteria | 7021 |
| 191 | Ga0075434_100019048 | 3300006871 | Bacteria | 6634 |
| 192 | Ga0075434_100054352 | 3300006871 | Bacteria | 3978 |
| 193 | Ga0075434_100055537 | 3300006871 | Bacteria | 3935 |
| 194 | Ga0075434_100091903 | 3300006871 | Bacteria | 3036 |
| 195 | Ga0075434_100659468 | 3300006871 | Unclassified | 1064 |
| 196 | Ga0075434_100712580 | 3300006871 | Bacteria | 1021 |
| 197 | Ga0075429_100000661 | 3300006880 | Bacteria | 26632 |
| 198 | Ga0075429_100008728 | 3300006880 | Bacteria | 8815 |
| 199 | Ga0075429_100026834 | 3300006880 | Bacteria | 5000 |
| 200 | Ga0075429_100033193 | 3300006880 | Bacteria | 4484 |
| 201 | Ga0075429_100045162 | 3300006880 | Bacteria | 3833 |
| 202 | Ga0075429_100274623 | 3300006880 | Bacteria | 1476 |
| 203 | Ga0068865_100398082 | 3300006881 | Bacteria | 1127 |
| 204 | Ga0075436_100099323 | 3300006914 | Bacteria | 2026 |
| 205 | Ga0075436_100118035 | 3300006914 | Bacteria | 1855 |
| 206 | Ga0097620_100001671 | 3300006931 | Bacteria | 22591 |
| 207 | Ga0075435_100017972 | 3300007076 | Bacteria | 5362 |
| 208 | Ga0075435_100021823 | 3300007076 | Bacteria | 4933 |
| 209 | Ga0075435_100052771 | 3300007076 | Bacteria | 3276 |
| 210 | Ga0075435_100054091 | 3300007076 | Bacteria | 3239 |
| 211 | Ga0075435_100193054 | 3300007076 | Bacteria | 1724 |
| 212 | Ga0075435_100499359 | 3300007076 | Unclassified | 1052 |
| 213 | Ga0099794_10003812 | 3300007265 | Bacteria | 5824 |
| 214 | Ga0099794_10010552 | 3300007265 | Bacteria | 3927 |
| 215 | Ga0099794_10040605 | 3300007265 | Bacteria | 2213 |
| 216 | Ga0111539_10096615 | 3300009094 | Bacteria | 3470 |
| 217 | Ga0111539_10115750 | 3300009094 | Bacteria | 3144 |
| 218 | Ga0111539_10116432 | 3300009094 | Bacteria | 3134 |
| 219 | Ga0111539_10191407 | 3300009094 | Bacteria | 2387 |
| 220 | Ga0114129_10015925 | 3300009147 | Bacteria | 10693 |
| 221 | Ga0114129_10016561 | 3300009147 | Bacteria | 10498 |
| 222 | Ga0114129_10040884 | 3300009147 | Bacteria | 6535 |
| 223 | Ga0114129_10058855 | 3300009147 | Bacteria | 5374 |
| 224 | Ga0114129_10077184 | 3300009147 | Bacteria | 4635 |
| 225 | Ga0114129_10086041 | 3300009147 | Unclassified | 4360 |
| 226 | Ga0114129_10124701 | 3300009147 | Bacteria | 3542 |
| 227 | Ga0114129_10146929 | 3300009147 | Bacteria | 3229 |
| 228 | Ga0114129_10169545 | 3300009147 | Bacteria | 2977 |
| 229 | Ga0114129_10196723 | 3300009147 | Bacteria | 2733 |
| 230 | Ga0114129_10250744 | 3300009147 | Unclassified | 2376 |
| 231 | Ga0114129_10308054 | 3300009147 | Bacteria | 2109 |
| 232 | Ga0105243_10061656 | 3300009148 | Bacteria | 3000 |
| 233 | Ga0105243_10074268 | 3300009148 | Unclassified | 2757 |
| 234 | Ga0105243_10406403 | 3300009148 | Bacteria | 1266 |
| 235 | Ga0105243_10429285 | 3300009148 | Bacteria | 1235 |
| 236 | Ga0105241_10000334 | 3300009174 | Bacteria | 35635 |
| 237 | Ga0105241_10039866 | 3300009174 | Bacteria | 3543 |
| 238 | Ga0105242_10010946 | 3300009176 | Bacteria | 6968 |
| 239 | Ga0105248_10095937 | 3300009177 | Bacteria | 3339 |
| 240 | Ga0105248_10135151 | 3300009177 | Bacteria | 2782 |
| 241 | Ga0105238_10797112 | 3300009551 | Bacteria | 960 |
| 242 | Ga0105249_10063722 | 3300009553 | Unclassified | 3387 |
| 243 | Ga0105249_10127839 | 3300009553 | Bacteria | 2422 |
| 244 | Ga0105249_10128176 | 3300009553 | Bacteria | 2419 |
| 245 | Ga0105249_10603500 | 3300009553 | Unclassified | 1152 |
| 246 | Ga0105249_10739007 | 3300009553 | Unclassified | 1046 |
| 247 | Ga0105239_10053250 | 3300010375 | Bacteria | 4439 |
| 248 | Ga0105246_10077064 | 3300011119 | Bacteria | 2364 |
| 249 | Ga0157373_10000379 | 3300013100 | Bacteria | 35641 |
| 250 | Ga0157371_10129203 | 3300013102 | Bacteria | 1797 |
| 251 | Ga0157378_10129944 | 3300013297 | Bacteria | 2331 |
| 252 | Ga0163162_10126896 | 3300013306 | Unclassified | 2658 |
| 253 | Ga0163162_10511084 | 3300013306 | Bacteria | 1331 |
| 254 | Ga0163162_10711046 | 3300013306 | Bacteria | 1126 |
| 255 | Ga0163162_10727201 | 3300013306 | Bacteria | 1113 |
| 256 | Ga0157372_10000135 | 3300013307 | Bacteria | 81209 |
| 257 | Ga0157375_10086056 | 3300013308 | Bacteria | 3193 |
| 258 | Ga0157375_10780244 | 3300013308 | Bacteria | 1105 |
| 259 | Ga0163163_10458433 | 3300014325 | Bacteria | 1335 |
| 260 | Ga0157379_10095352 | 3300014968 | Bacteria | 2669 |
| 261 | Ga0157379_10136266 | 3300014968 | Bacteria | 2212 |
| 262 | Ga0157379_10178804 | 3300014968 | Unclassified | 1917 |
| 263 | Ga0157376_10320987 | 3300014969 | Bacteria | 1472 |
| 264 | Ga0206356_10892825 | 3300020070 | Bacteria | 1200 |
| 265 | Ga0206352_10926330 | 3300020078 | Bacteria | 1088 |
| 266 | Ga0206350_10906670 | 3300020080 | Bacteria | 1020 |
| 267 | Ga0213875_10075658 | 3300021388 | Bacteria | 1571 |
| 268 | Ga0213875_10081146 | 3300021388 | Bacteria | 1513 |
| 269 | Ga0207653_10000051 | 3300025885 | Bacteria | 88512 |
| 270 | Ga0207653_10000475 | 3300025885 | Bacteria | 16005 |
| 271 | Ga0207653_10013346 | 3300025885 | Bacteria | 2572 |
| 272 | Ga0207653_10022438 | 3300025885 | Unclassified | 2005 |
| 273 | Ga0207647_10034110 | 3300025904 | Bacteria | 3252 |
| 274 | Ga0207685_10019191 | 3300025905 | Bacteria | 2249 |
| 275 | Ga0207685_10210260 | 3300025905 | Bacteria | 919 |
| 276 | Ga0207699_10157986 | 3300025906 | Bacteria | 1507 |
| 277 | Ga0207645_10000075 | 3300025907 | Bacteria | 71333 |
| 278 | Ga0207643_10001707 | 3300025908 | Bacteria | 12325 |
| 279 | Ga0207643_10016247 | 3300025908 | Bacteria | 4060 |
| 280 | Ga0207684_10000593 | 3300025910 | Bacteria | 43455 |
| 281 | Ga0207684_10000746 | 3300025910 | Bacteria | 37987 |
| 282 | Ga0207684_10001638 | 3300025910 | Bacteria | 23790 |
| 283 | Ga0207684_10003090 | 3300025910 | Bacteria | 16441 |
| 284 | Ga0207684_10009055 | 3300025910 | Bacteria | 8819 |
| 285 | Ga0207684_10012194 | 3300025910 | Bacteria | 7479 |
| 286 | Ga0207684_10019452 | 3300025910 | Bacteria | 5809 |
| 287 | Ga0207684_10146764 | 3300025910 | Bacteria | 2029 |
| 288 | Ga0207684_10381520 | 3300025910 | Unclassified | 1212 |
| 289 | Ga0207654_10001071 | 3300025911 | Bacteria | 14889 |
| 290 | Ga0207707_10000135 | 3300025912 | Bacteria | 76964 |
| 291 | Ga0207693_10003315 | 3300025915 | Bacteria | 13773 |
| 292 | Ga0207663_10424003 | 3300025916 | Bacteria | 1022 |
| 293 | Ga0207660_10000688 | 3300025917 | Bacteria | 22592 |
| 294 | Ga0207660_10012425 | 3300025917 | Bacteria | 5571 |
| 295 | Ga0207660_10195556 | 3300025917 | Bacteria | 1577 |
| 296 | Ga0207657_10000037 | 3300025919 | Bacteria | 124230 |
| 297 | Ga0207649_10029372 | 3300025920 | Bacteria | 3246 |
| 298 | Ga0207652_10002292 | 3300025921 | Bacteria | 16228 |
| 299 | Ga0207646_10002863 | 3300025922 | Bacteria | 20033 |
| 300 | Ga0207646_10004177 | 3300025922 | Bacteria | 15825 |
| 301 | Ga0207646_10006979 | 3300025922 | Bacteria | 11575 |
| 302 | Ga0207646_10014266 | 3300025922 | Bacteria | 7556 |
| 303 | Ga0207646_10029483 | 3300025922 | Bacteria | 4986 |
| 304 | Ga0207646_10031519 | 3300025922 | Bacteria | 4799 |
| 305 | Ga0207646_10057995 | 3300025922 | Bacteria | 3459 |
| 306 | Ga0207646_10073172 | 3300025922 | Bacteria | 3061 |
| 307 | Ga0207646_10149492 | 3300025922 | Bacteria | 2106 |
| 308 | Ga0207681_10048883 | 3300025923 | Bacteria | 2857 |
| 309 | Ga0207681_10054501 | 3300025923 | Bacteria | 2719 |
| 310 | Ga0207694_10464337 | 3300025924 | Bacteria | 1058 |
| 311 | Ga0207650_10012455 | 3300025925 | Bacteria | 5873 |
| 312 | Ga0207690_10000562 | 3300025932 | Bacteria | 24235 |
| 313 | Ga0207706_10011250 | 3300025933 | Bacteria | 8160 |
| 314 | Ga0207709_10061209 | 3300025935 | Unclassified | 2351 |
| 315 | Ga0207709_10184358 | 3300025935 | Bacteria | 1477 |
| 316 | Ga0207709_10257457 | 3300025935 | Unclassified | 1278 |
| 317 | Ga0207709_10311090 | 3300025935 | Bacteria | 1175 |
| 318 | Ga0207670_10043530 | 3300025936 | Bacteria | 2966 |
| 319 | Ga0207670_10098468 | 3300025936 | Bacteria | 2084 |
| 320 | Ga0207669_10599598 | 3300025937 | Unclassified | 895 |
| 321 | Ga0207704_10040243 | 3300025938 | Bacteria | 2730 |
| 322 | Ga0207665_10000576 | 3300025939 | Bacteria | 24692 |
| 323 | Ga0207691_10134475 | 3300025940 | Bacteria | 2182 |
| 324 | Ga0207711_10199391 | 3300025941 | Bacteria | 1826 |
| 325 | Ga0207711_10339940 | 3300025941 | Bacteria | 1389 |
| 326 | Ga0207689_10000029 | 3300025942 | Bacteria | 100016 |
| 327 | Ga0207689_10015346 | 3300025942 | Bacteria | 6485 |
| 328 | Ga0207689_10289428 | 3300025942 | Bacteria | 1357 |
| 329 | Ga0207679_10003224 | 3300025945 | Bacteria | 10063 |
| 330 | Ga0207667_10000652 | 3300025949 | Bacteria | 45007 |
| 331 | Ga0207651_10279365 | 3300025960 | Unclassified | 1379 |
| 332 | Ga0207651_10317319 | 3300025960 | Bacteria | 1302 |
| 333 | Ga0207712_10014975 | 3300025961 | Bacteria | 4997 |
| 334 | Ga0207712_10667215 | 3300025961 | Bacteria | 905 |
| 335 | Ga0207640_10008161 | 3300025981 | Bacteria | 5800 |
| 336 | Ga0207640_10160318 | 3300025981 | Bacteria | 1663 |
| 337 | Ga0207639_10063006 | 3300026041 | Bacteria | 2869 |
| 338 | Ga0207678_10017042 | 3300026067 | Bacteria | 6379 |
| 339 | Ga0207678_10452490 | 3300026067 | Unclassified | 1116 |
| 340 | Ga0207708_10031915 | 3300026075 | Bacteria | 4000 |
| 341 | Ga0207708_10041994 | 3300026075 | Bacteria | 3487 |
| 342 | Ga0207708_10080563 | 3300026075 | Bacteria | 2502 |
| 343 | Ga0207708_10426395 | 3300026075 | Unclassified | 1101 |
| 344 | Ga0207702_10014520 | 3300026078 | Bacteria | 6538 |
| 345 | Ga0207641_10061004 | 3300026088 | Bacteria | 3216 |
| 346 | Ga0207641_10444180 | 3300026088 | Unclassified | 1252 |
| 347 | Ga0207648_10000552 | 3300026089 | Bacteria | 41984 |
| 348 | Ga0207648_10376304 | 3300026089 | Bacteria | 1283 |
| 349 | Ga0207674_10000306 | 3300026116 | Bacteria | 62216 |
| 350 | Ga0207674_10042965 | 3300026116 | Bacteria | 4663 |
| 351 | Ga0207674_10106088 | 3300026116 | Bacteria | 2787 |
| 352 | Ga0207675_100000032 | 3300026118 | Bacteria | 108677 |
| 353 | Ga0207675_100032074 | 3300026118 | Bacteria | 4893 |
| 354 | Ga0207675_100107562 | 3300026118 | Bacteria | 2630 |
| 355 | Ga0207683_10385365 | 3300026121 | Bacteria | 1289 |
| 356 | Ga0207698_10000321 | 3300026142 | Bacteria | 28668 |
| 357 | Ga0209969_1002067 | 3300027360 | Bacteria | 2767 |
| 358 | Ga0209984_1001656 | 3300027424 | Bacteria | 2428 |
| 359 | Ga0209984_1011237 | 3300027424 | Bacteria | 1158 |
| 360 | Ga0210000_1002112 | 3300027462 | Bacteria | 2818 |
| 361 | Ga0209995_1011423 | 3300027471 | Bacteria | 1444 |
| 362 | Ga0209995_1021065 | 3300027471 | Bacteria | 1080 |
| 363 | Ga0209999_1004084 | 3300027543 | Bacteria | 2622 |
| 364 | Ga0209982_1014340 | 3300027552 | Bacteria | 1197 |
| 365 | Ga0209970_1005428 | 3300027614 | Bacteria | 2104 |
| 366 | Ga0210002_1001653 | 3300027617 | Bacteria | 3176 |
| 367 | Ga0209983_1000146 | 3300027665 | Bacteria | 13016 |
| 368 | Ga0209588_1024370 | 3300027671 | Bacteria | 1910 |
| 369 | Ga0209971_1000008 | 3300027682 | Bacteria | 102612 |
| 370 | Ga0209966_1000187 | 3300027695 | Bacteria | 25599 |
| 371 | Ga0209998_10000016 | 3300027717 | Bacteria | 85166 |
| 372 | Ga0209998_10007971 | 3300027717 | Bacteria | 2198 |
| 373 | Ga0209974_10001677 | 3300027876 | Bacteria | 8020 |
| 374 | Ga0207428_10000013 | 3300027907 | Bacteria | 346742 |
| 375 | Ga0207428_10087469 | 3300027907 | Bacteria | 2424 |
| 376 | Ga0207428_10288822 | 3300027907 | Bacteria | 1216 |
| 377 | Ga0268265_10003670 | 3300028380 | Bacteria | 10947 |
| 378 | Ga0268265_10074257 | 3300028380 | Unclassified | 2659 |
| 379 | Ga0268265_10186104 | 3300028380 | Unclassified | 1789 |
| 380 | Ga0268265_10205963 | 3300028380 | Unclassified | 1710 |
| 381 | Ga0268264_10045908 | 3300028381 | Bacteria | 3628 |
| 382 | Ga0265338_10009552 | 3300028800 | Bacteria | 11541 |
| 383 | Ga0265324_10070486 | 3300029957 | Bacteria | 1191 |
| 384 | Ga0265327_10001037 | 3300031251 | Bacteria | 39182 |
| 385 | Ga0307408_100024744 | 3300031548 | Bacteria | 4104 |
| 386 | Ga0307408_100248057 | 3300031548 | Bacteria | 1467 |
| 387 | Ga0307413_10074005 | 3300031824 | Bacteria | 2156 |
| 388 | Ga0307413_10230357 | 3300031824 | Bacteria | 1360 |
| 389 | Ga0307412_10366696 | 3300031911 | Bacteria | 1162 |
| 390 | Ga0307409_100302282 | 3300031995 | Bacteria | 1489 |
| 391 | Ga0307416_100128963 | 3300032002 | Bacteria | 2272 |
| 392 | Ga0307416_100356753 | 3300032002 | Bacteria | 1482 |
| 393 | Ga0307416_100881606 | 3300032002 | Bacteria | 994 |
| 394 | Ga0307414_10807191 | 3300032004 | Unclassified | 856 |
| 395 | Ga0373950_0026318 | 3300034818 | Unclassified | 1055 |
| 396 | Ga0373958_0018006 | 3300034819 | Bacteria | 1276 |
| 397 | Ga0373959_0055580 | 3300034820 | Unclassified | 865 |
| 398 | Ga0373928_0018085 | 3300035084 | Bacteria | 1457 |
| 399 | Ga0373928_0034492 | 3300035084 | Unclassified | 1136 |
| 400 | Ga0373940_0010152 | 3300035088 | Unclassified | 2207 |
| 401 | Ga0373940_0069545 | 3300035088 | Unclassified | 1022 |
| 402 | Ga0373949_0010111 | 3300035090 | Bacteria | 2065 |
| 403 | Ga0373949_0015057 | 3300035090 | Bacteria | 1725 |
| 404 | Ga0373932_0084718 | 3300035112 | Bacteria | 1007 |
| 405 | Ga0373941_0018071 | 3300035115 | Bacteria | 1943 |
| 406 | Ga0373960_0002818 | 3300035121 | Bacteria | 3937 |
| 407 | Ga0373942_0015299 | 3300035207 | Bacteria | 1868 |
| 408 | Ga0373962_0010180 | 3300035242 | Bacteria | 2340 |
| 409 | Ga0373962_0020678 | 3300035242 | Bacteria | 1730 |
| 410 | Ga0373962_0053405 | 3300035242 | Unclassified | 1169 |
| 411 | Ga0373931_0004831 | 3300035691 | Bacteria | 6190 |
| 412 | Ga0373931_0128835 | 3300035691 | Bacteria | 1454 |
| 413 | Ga0373927_0185620 | 3300035695 | Bacteria | 1364 |
| 414 | Ga0395900_0130218 | 3300037418 | Bacteria | 2579 |
| 415 | Ga0395905_0357030 | 3300037471 | Unclassified | 1354 |
| 416 | Ga0436364_0436153 | 3300037853 | Bacteria | 3844 |
| 417 | Ga0242420_035721 | 3300038996 | Bacteria | 936 |
| 418 | Ga0436365_0488470 | 3300039437 | Bacteria | 27098 |
| 419 | Ga0436365_1654887 | 3300039437 | Unclassified | 3198 |
| 420 | Ga0436360_0219999 | 3300039438 | Bacteria | 3479 |
| 421 | Ga0436360_1256473 | 3300039438 | Bacteria | 1503 |
| 422 | Ga0436363_1083672 | 3300039450 | Bacteria | 801 |
| 423 | Ga0439458_0003469 | 3300042157 | Bacteria | 3682 |
| 424 | Ga0439459_0003082 | 3300042438 | Bacteria | 2616 |
| 425 | Ga0439460_0002029 | 3300042461 | Bacteria | 4852 |
| 426 | Ga0451577_0043881 | 3300042876 | Bacteria | 4003 |
| 427 | Ga0451577_0081542 | 3300042876 | Bacteria | 2886 |
| 428 | Ga0451577_0089884 | 3300042876 | Bacteria | 2740 |
| 429 | Ga0453683_0026309 | 3300044673 | Bacteria | 3694 |
| 430 | Ga0453683_0043142 | 3300044673 | Bacteria | 2831 |
| 431 | Ga0453683_0142708 | 3300044673 | Unclassified | 1512 |
| 432 | Ga0453684_0120577 | 3300044712 | Bacteria | 3167 |
| 433 | Ga0453684_1195965 | 3300044712 | Bacteria | 798 |
| 434 | Ga0451576_0017221 | 3300045051 | Bacteria | 7948 |
| 435 | Ga0451576_0021782 | 3300045051 | Bacteria | 6957 |
| 436 | Ga0451576_0031255 | 3300045051 | Bacteria | 5680 |
| 437 | Ga0451576_0040420 | 3300045051 | Bacteria | 4936 |
| 438 | Ga0451576_0088044 | 3300045051 | Bacteria | 3230 |
| 439 | Ga0451576_0179881 | 3300045051 | Unclassified | 2208 |
| 440 | Ga0451576_0489550 | 3300045051 | Bacteria | 1292 |
| 441 | Ga0495580_0001659 | 3300046472 | Bacteria | 19563 |
| 442 | Ga0495580_0010780 | 3300046472 | Bacteria | 7099 |
| 443 | Ga0495580_0165883 | 3300046472 | Unclassified | 1528 |
| 444 | Ga0495584_0077036 | 3300046491 | Unclassified | 1677 |
| 445 | Ga0495637_0140381 | 3300046520 | Bacteria | 917 |
| 446 | Ga0495669_0089882 | 3300046684 | Bacteria | 1417 |
| 447 | Ga0495613_0001713 | 3300046689 | Bacteria | 16704 |
| 448 | Ga0495636_0168280 | 3300047318 | Bacteria | 990 |
| 449 | Ga0496102_0085407 | 3300048905 | Bacteria | 2914 |
| 450 | Ga0496104_0100178 | 3300048907 | Bacteria | 2773 |
| 451 | Ga0496105_0049557 | 3300048908 | Bacteria | 3468 |
| 452 | Ga0496106_0016979 | 3300048909 | Bacteria | 5386 |
| 453 | Ga0496106_0021548 | 3300048909 | Bacteria | 4786 |
| 454 | Ga0496106_0199775 | 3300048909 | Bacteria | 1591 |
| 455 | Ga0496107_0447070 | 3300048910 | Bacteria | 960 |
| 456 | Ga0496108_0009227 | 3300048911 | Bacteria | 7985 |
| 457 | Ga0496109_0044402 | 3300048912 | Bacteria | 4032 |
| 458 | Ga0496110_0073040 | 3300048913 | Bacteria | 3044 |
| 459 | Ga0496111_0197834 | 3300048914 | Bacteria | 1494 |
| 460 | Ga0496112_0134716 | 3300048915 | Unclassified | 2441 |
| 461 | Ga0496113_0250016 | 3300048916 | Bacteria | 1415 |
| 462 | Ga0496115_0003412 | 3300048918 | Bacteria | 11410 |
| 463 | Ga0496115_0061969 | 3300048918 | Bacteria | 3017 |
| 464 | Ga0501031_0058974 | 3300049568 | Bacteria | 2501 |
| 465 | Ga0501031_0276383 | 3300049568 | Bacteria | 1090 |
| 466 | Ga0501032_0278586 | 3300049569 | Bacteria | 1083 |
| 467 | Ga0501036_0097293 | 3300049572 | Bacteria | 2488 |
| 468 | Ga0501037_0066402 | 3300049573 | Bacteria | 2628 |
| 469 | Ga0501038_0053638 | 3300049574 | Bacteria | 3470 |
| 470 | Ga0501038_0166189 | 3300049574 | Bacteria | 1790 |
| 471 | Ga0501039_0015798 | 3300049575 | Bacteria | 5779 |
| 472 | Ga0501039_0038758 | 3300049575 | Bacteria | 3680 |
| 473 | Ga0501039_0079363 | 3300049575 | Bacteria | 2553 |
| 474 | Ga0501039_0237515 | 3300049575 | Bacteria | 1433 |
| 475 | Ga0501040_0001982 | 3300049576 | Bacteria | 13201 |
| 476 | Ga0501040_0010799 | 3300049576 | Bacteria | 5970 |
| 477 | Ga0501040_0135585 | 3300049576 | Bacteria | 1733 |
| 478 | Ga0501040_0309001 | 3300049576 | Bacteria | 1130 |
| 479 | Ga0501041_0042286 | 3300049577 | Bacteria | 2769 |
| 480 | Ga0501042_0001517 | 3300049578 | Bacteria | 13739 |
| 481 | Ga0501042_0018652 | 3300049578 | Bacteria | 4807 |
| 482 | Ga0501042_0045329 | 3300049578 | Bacteria | 3134 |
| 483 | Ga0501042_0091274 | 3300049578 | Bacteria | 2186 |
| 484 | Ga0501043_0032810 | 3300049579 | Bacteria | 4084 |
| 485 | Ga0501043_0053090 | 3300049579 | Bacteria | 3183 |
| 486 | Ga0501046_0009495 | 3300049580 | Bacteria | 8405 |
| 487 | Ga0501046_0234672 | 3300049580 | Unclassified | 1354 |
| 488 | Ga0501046_0302712 | 3300049580 | Bacteria | 1167 |
| 489 | Ga0501047_0135299 | 3300049581 | Bacteria | 2345 |
| 490 | Ga0501047_0246489 | 3300049581 | Bacteria | 1636 |
| 491 | Ga0501048_0011174 | 3300049582 | Bacteria | 6693 |
| 492 | Ga0501048_0022183 | 3300049582 | Bacteria | 4645 |
| 493 | Ga0501048_0037034 | 3300049582 | Bacteria | 3504 |
| 494 | Ga0501048_0467660 | 3300049582 | Unclassified | 903 |
| 495 | Ga0501067_0103099 | 3300049583 | Unclassified | 1585 |
| 496 | Ga0501068_0112203 | 3300049584 | Unclassified | 1696 |
| 497 | Ga0501069_0317664 | 3300049585 | Bacteria | 915 |
| 498 | Ga0501071_0007379 | 3300049587 | Bacteria | 7213 |
| 499 | Ga0501071_0035050 | 3300049587 | Bacteria | 3574 |
| 500 | Ga0501071_0169304 | 3300049587 | Bacteria | 1635 |
| 501 | Ga0501072_0001276 | 3300049588 | Bacteria | 18807 |
| 502 | Ga0501072_0023626 | 3300049588 | Bacteria | 4775 |
| 503 | Ga0501072_0030081 | 3300049588 | Bacteria | 4245 |
| 504 | Ga0501072_0036089 | 3300049588 | Bacteria | 3875 |
| 505 | Ga0501072_0093101 | 3300049588 | Bacteria | 2394 |
| 506 | Ga0501072_0233585 | 3300049588 | Bacteria | 1465 |
| 507 | Ga0501074_0002117 | 3300049590 | Bacteria | 13714 |
| 508 | Ga0501074_0029284 | 3300049590 | Bacteria | 3989 |
| 509 | Ga0501075_0000955 | 3300049591 | Bacteria | 18410 |
| 510 | Ga0501075_0004974 | 3300049591 | Bacteria | 9065 |
| 511 | Ga0501075_0012336 | 3300049591 | Bacteria | 6072 |
| 512 | Ga0501075_0076112 | 3300049591 | Bacteria | 2538 |
| 513 | Ga0501075_0082154 | 3300049591 | Bacteria | 2440 |
| 514 | Ga0501075_0107129 | 3300049591 | Bacteria | 2124 |
| 515 | Ga0501075_0109497 | 3300049591 | Bacteria | 2100 |
| 516 | Ga0501076_0003931 | 3300049592 | Bacteria | 10484 |
| 517 | Ga0501076_0064042 | 3300049592 | Bacteria | 2930 |
| 518 | Ga0501076_0240422 | 3300049592 | Bacteria | 1481 |
| 519 | Ga0501077_0001617 | 3300049593 | Bacteria | 13561 |
| 520 | Ga0501077_0031565 | 3300049593 | Bacteria | 3372 |
| 521 | Ga0501077_0052455 | 3300049593 | Bacteria | 2590 |
| 522 | Ga0501077_0189257 | 3300049593 | Unclassified | 1307 |
| 523 | Ga0501077_0254007 | 3300049593 | Bacteria | 1118 |
| 524 | Ga0501079_0001548 | 3300049741 | Bacteria | 16293 |
| 525 | Ga0501079_0004258 | 3300049741 | Bacteria | 10615 |
| 526 | Ga0501079_0047343 | 3300049741 | Bacteria | 3317 |
| 527 | Ga0501079_0138844 | 3300049741 | Bacteria | 1893 |
| 528 | Ga0501079_0192782 | 3300049741 | Unclassified | 1591 |
| 529 | Ga0501080_0035335 | 3300049742 | Bacteria | 4664 |
| 530 | Ga0501080_0048431 | 3300049742 | Bacteria | 3956 |
| 531 | Ga0501080_0269885 | 3300049742 | Bacteria | 1549 |
| 532 | Ga0501080_0587591 | 3300049742 | Bacteria | 989 |
| 533 | Ga0501081_0002531 | 3300049743 | Bacteria | 11522 |
| 534 | Ga0501081_0008158 | 3300049743 | Bacteria | 6797 |
| 535 | Ga0501081_0008913 | 3300049743 | Bacteria | 6518 |
| 536 | Ga0501081_0031990 | 3300049743 | Bacteria | 3567 |
| 537 | Ga0501083_0002379 | 3300049744 | Bacteria | 12878 |
| 538 | Ga0501083_0045895 | 3300049744 | Bacteria | 2955 |
| 539 | Ga0501035_0663252 | 3300049822 | Bacteria | 845 |
| 540 | Ga0501045_0000998 | 3300049824 | Bacteria | 18589 |
| 541 | Ga0501045_0004584 | 3300049824 | Bacteria | 9541 |
| 542 | Ga0501045_0155567 | 3300049824 | Bacteria | 1701 |
| 543 | nmdc:mga05p37_12174_c1 | 3300050507 | Bacteria | 10271 |
| 544 | nmdc:mga05p37_207186_c1 | 3300050507 | Bacteria | 2371 |
| 545 | nmdc:mga05p37_221243_c1 | 3300050507 | Bacteria | 2285 |
| 546 | nmdc:mga05p37_232847_c1 | 3300050507 | Bacteria | 2218 |
| 547 | nmdc:mga05p37_255932_c1 | 3300050507 | Bacteria | 2098 |
| 548 | nmdc:mga05p37_300694_c1 | 3300050507 | Bacteria | 1907 |
| 549 | nmdc:mga05p37_33356_c1 | 3300050507 | Bacteria | 6306 |
| 550 | nmdc:mga05p37_52253_c1 | 3300050507 | Bacteria | 5025 |
| 551 | nmdc:mga05p37_55835_c1 | 3300050507 | Unclassified | 4862 |
| 552 | nmdc:mga05p37_61184_c1 | 3300050507 | Bacteria | 4636 |
| 553 | nmdc:mga05p37_73795_c1 | 3300050507 | Bacteria | 4199 |
| 554 | nmdc:mga05p37_93255_c1 | 3300050507 | Bacteria | 3710 |
| 555 | nmdc:mga09592_139170_c1 | 3300050508 | Bacteria | 2091 |
| 556 | nmdc:mga09592_35758_c1 | 3300050508 | Bacteria | 4159 |
| 557 | nmdc:mga09592_49790_c1 | 3300050508 | Bacteria | 3533 |
| 558 | nmdc:mga09592_70650_c1 | 3300050508 | Bacteria | 2963 |
| 559 | nmdc:mga0qj67_257075_c1 | 3300050509 | Bacteria | 1417 |
| 560 | nmdc:mga0qj67_276571_c1 | 3300050509 | Bacteria | 1361 |
| 561 | nmdc:mga0qj67_36838_c1 | 3300050509 | Bacteria | 3829 |
| 562 | nmdc:mga0qj67_452574_c1 | 3300050509 | Bacteria | 1034 |
| 563 | nmdc:mga0qj67_53859_c1 | 3300050509 | Bacteria | 3186 |
| 564 | nmdc:mga06r32_158592_c1 | 3300050510 | Bacteria | 2245 |
| 565 | nmdc:mga06r32_237348_c1 | 3300050510 | Unclassified | 1811 |
| 566 | nmdc:mga06r32_281584_c1 | 3300050510 | Bacteria | 1650 |
| 567 | nmdc:mga06r32_32383_c1 | 3300050510 | Bacteria | 4918 |
| 568 | nmdc:mga06r32_333008_c1 | 3300050510 | Unclassified | 1503 |
| 569 | nmdc:mga06r32_43253_c1 | 3300050510 | Bacteria | 4286 |
| 570 | nmdc:mga06r32_439739_c1 | 3300050510 | Bacteria | 1284 |
| 571 | nmdc:mga06r32_66014_c1 | 3300050510 | Bacteria | 3491 |
| 572 | nmdc:mga08y16_140101_c1 | 3300050511 | Bacteria | 2514 |
| 573 | nmdc:mga08y16_275686_c1 | 3300050511 | Bacteria | 1736 |
| 574 | nmdc:mga08y16_489_c1 | 3300050511 | Bacteria | 36710 |
| 575 | nmdc:mga08y16_513831_c1 | 3300050511 | Bacteria | 1216 |
| 576 | nmdc:mga0n895_14081_c1 | 3300050512 | Bacteria | 7251 |
| 577 | nmdc:mga0n895_153338_c1 | 3300050512 | Bacteria | 2335 |
| 578 | nmdc:mga0n895_16654_c1 | 3300050512 | Bacteria | 6751 |
| 579 | nmdc:mga0n895_22584_c1 | 3300050512 | Bacteria | 5901 |
| 580 | nmdc:mga0n895_263911_c1 | 3300050512 | Bacteria | 1747 |
| 581 | nmdc:mga0n895_29591_c1 | 3300050512 | Bacteria | 5227 |
| 582 | nmdc:mga0n895_38873_c1 | 3300050512 | Bacteria | 4613 |
| 583 | nmdc:mga0n895_42962_c1 | 3300050512 | Bacteria | 4402 |
| 584 | nmdc:mga0n895_666953_c1 | 3300050512 | Bacteria | 1038 |
| 585 | nmdc:mga0rr50_148962_c1 | 3300050513 | Bacteria | 1889 |
| 586 | nmdc:mga0rr50_19985_c1 | 3300050513 | Bacteria | 4536 |
| 587 | nmdc:mga0rr50_2969_c1 | 3300050513 | Bacteria | 9704 |
| 588 | nmdc:mga0rr50_312593_c1 | 3300050513 | Bacteria | 1316 |
| 589 | nmdc:mga0rr50_3935_c1 | 3300050513 | Bacteria | 8639 |
| 590 | nmdc:mga0rr50_50745_c1 | 3300050513 | Bacteria | 3075 |
| 591 | nmdc:mga0rr50_624931_c1 | 3300050513 | Bacteria | 919 |
| 592 | nmdc:mga0rr50_94333_c1 | 3300050513 | Unclassified | 2337 |
| 593 | nmdc:mga08x19_12943_c1 | 3300050514 | Bacteria | 5037 |
| 594 | nmdc:mga08x19_573149_c1 | 3300050514 | Bacteria | 799 |
| 595 | nmdc:mga0a205_160295_c1 | 3300050515 | Bacteria | 2147 |
| 596 | nmdc:mga0a205_16766_c1 | 3300050515 | Bacteria | 6860 |
| 597 | nmdc:mga0a205_259229_c1 | 3300050515 | Unclassified | 1617 |
| 598 | nmdc:mga0a205_2643_c1 | 3300050515 | Bacteria | 15831 |
| 599 | nmdc:mga0a205_26945_c1 | 3300050515 | Bacteria | 5487 |
| 600 | nmdc:mga0a205_405_c1 | 3300050515 | Bacteria | 33012 |
| 601 | nmdc:mga0a205_633476_c1 | 3300050515 | Bacteria | 921 |
| 602 | nmdc:mga0a205_634766_c1 | 3300050515 | Bacteria | 920 |
| 603 | nmdc:mga0a205_78789_c1 | 3300050515 | Bacteria | 3183 |
| 604 | Ga0500647_0004051 | 3300053091 | Bacteria | 5830 |
| 605 | Ga0500572_001507 | 3300053111 | Bacteria | 6273 |
| 606 | Ga0500592_032009 | 3300053116 | Bacteria | 848 |
| 607 | Ga0500658_0161545 | 3300053134 | Bacteria | 1014 |
| 608 | Ga0500568_0037758 | 3300053139 | Bacteria | 1958 |
| 609 | Ga0500622_0007547 | 3300053156 | Bacteria | 6164 |
| 610 | Ga0500627_0001632 | 3300053158 | Bacteria | 6335 |
| 611 | Ga0500627_0257224 | 3300053158 | Bacteria | 771 |
| 612 | Ga0501084_0013356 | 3300054114 | Bacteria | 6795 |
| 613 | Ga0501084_0014517 | 3300054114 | Bacteria | 6530 |
| 614 | Ga0501084_0020379 | 3300054114 | Bacteria | 5530 |
| 615 | Ga0501084_0027753 | 3300054114 | Bacteria | 4730 |
| 616 | Ga0501084_0063021 | 3300054114 | Bacteria | 3103 |
| 617 | Ga0501084_0454340 | 3300054114 | Bacteria | 1083 |
| 618 | Ga0501082_0001040 | 3300060353 | Bacteria | 24529 |
| 619 | Ga0501082_0001716 | 3300060353 | Bacteria | 19332 |
| 620 | Ga0501082_0013358 | 3300060353 | Bacteria | 7062 |
| 621 | Ga0501082_0022856 | 3300060353 | Bacteria | 5387 |
| 622 | Ga0501082_0043382 | 3300060353 | Bacteria | 3878 |
| 623 | Ga0501082_0142627 | 3300060353 | Bacteria | 2079 |
| 624 | Ga0501082_0600677 | 3300060353 | Bacteria | 963 |
| 625 | Ga0530510_0003571 | 3300061734 | Bacteria | 10710 |
| 626 | Ga0530510_0005130 | 3300061734 | Bacteria | 9036 |
| 627 | Ga0530510_0066115 | 3300061734 | Bacteria | 2620 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053158 | Ga0500627_0257224 | Ga0500627_0257224_11_682 | 216 |
| 2 | 3300013306 | Ga0163162_10727201 | Ga0163162_107272011 | 222 |
| 3 | 3300005295 | Ga0065707_10255577 | Ga0065707_102555771 | 223 |
| 4 | 3300053116 | Ga0500592_032009 | Ga0500592_032009_26_733 | 225 |
| 5 | 3300053134 | Ga0500658_0161545 | Ga0500658_0161545_162_869 | 225 |
| 6 | 3300053158 | Ga0500627_0001632 | Ga0500627_0001632_4510_5217 | 225 |
| 7 | 3300005467 | Ga0070706_100085711 | Ga0070706_1000857112 | 227 |
| 8 | 3300035090 | Ga0373949_0010111 | Ga0373949_0010111_24_713 | 228 |
| 9 | 3300009551 | Ga0105238_10797112 | Ga0105238_107971121 | 230 |
| 10 | 3300025924 | Ga0207694_10464337 | Ga0207694_104643371 | 230 |
| 11 | 3300005295 | Ga0065707_10005661 | Ga0065707_100056613 | 232 |
| 12 | 3300005406 | Ga0070703_10000101 | Ga0070703_1000010132 | 232 |
| 13 | 3300005440 | Ga0070705_100000062 | Ga0070705_1000000626 | 232 |
| 14 | 3300005467 | Ga0070706_100000947 | Ga0070706_1000009478 | 232 |
| 15 | 3300005518 | Ga0070699_100000102 | Ga0070699_10000010271 | 232 |
| 16 | 3300005545 | Ga0070695_100165317 | Ga0070695_1001653172 | 232 |
| 17 | 3300005546 | Ga0070696_100007451 | Ga0070696_1000074515 | 232 |
| 18 | 3300005546 | Ga0070696_100020025 | Ga0070696_1000200254 | 232 |
| 19 | 3300005546 | Ga0070696_100180847 | Ga0070696_1001808472 | 232 |
| 20 | 3300005547 | Ga0070693_100111513 | Ga0070693_1001115132 | 232 |
| 21 | 3300005549 | Ga0070704_100224831 | Ga0070704_1002248311 | 232 |
| 22 | 3300006844 | Ga0075428_100028643 | Ga0075428_1000286433 | 232 |
| 23 | 3300006844 | Ga0075428_100037429 | Ga0075428_1000374293 | 232 |
| 24 | 3300006844 | Ga0075428_100416938 | Ga0075428_1004169382 | 232 |
| 25 | 3300006871 | Ga0075434_100055537 | Ga0075434_1000555373 | 232 |
| 26 | 3300009094 | Ga0111539_10096615 | Ga0111539_100966153 | 232 |
| 27 | 3300009147 | Ga0114129_10086041 | Ga0114129_100860411 | 232 |
| 28 | 3300009147 | Ga0114129_10196723 | Ga0114129_101967232 | 232 |
| 29 | 3300025885 | Ga0207653_10000051 | Ga0207653_1000005153 | 232 |
| 30 | 3300025910 | Ga0207684_10000593 | Ga0207684_100005938 | 232 |
| 31 | 3300037853 | Ga0436364_0436153 | Ga0436364_0436153_302_1009 | 232 |
| 32 | 3300039450 | Ga0436363_1083672 | Ga0436363_1083672_81_788 | 232 |
| 33 | 3300050509 | nmdc:mga0qj67_452574_c1 | nmdc:mga0qj67_452574_c1_12_752 | 232 |
| 34 | 3300050512 | nmdc:mga0n895_666953_c1 | nmdc:mga0n895_666953_c1_133_927 | 232 |
| 35 | 3300050513 | nmdc:mga0rr50_624931_c1 | nmdc:mga0rr50_624931_c1_18_716 | 232 |
| 36 | 3300050515 | nmdc:mga0a205_633476_c1 | nmdc:mga0a205_633476_c1_69_863 | 232 |
| 37 | 3300048909 | Ga0496106_0199775 | Ga0496106_0199775_268_1041 | 233 |
| 38 | 3300048910 | Ga0496107_0447070 | Ga0496107_0447070_87_860 | 233 |
| 39 | 3300048918 | Ga0496115_0061969 | Ga0496115_0061969_1977_2750 | 233 |
| 40 | 3300005616 | Ga0068852_100000409 | Ga0068852_10000040915 | 234 |
| 41 | 3300006847 | Ga0075431_100051731 | Ga0075431_1000517316 | 234 |
| 42 | 3300026142 | Ga0207698_10000321 | Ga0207698_1000032113 | 234 |
| 43 | 3300029957 | Ga0265324_10070486 | Ga0265324_100704862 | 234 |
| 44 | 3300031251 | Ga0265327_10001037 | Ga0265327_1000103742 | 234 |
| 45 | 3300050508 | nmdc:mga09592_35758_c1 | nmdc:mga09592_35758_c1_2965_3732 | 234 |
| 46 | 3300050510 | nmdc:mga06r32_43253_c1 | nmdc:mga06r32_43253_c1_3428_4195 | 234 |
| 47 | 3300039438 | Ga0436360_1256473 | Ga0436360_1256473_86_850 | 235 |
| 48 | 3300046520 | Ga0495637_0140381 | Ga0495637_0140381_99_830 | 235 |
| 49 | 3300053139 | Ga0500568_0037758 | Ga0500568_0037758_921_1652 | 235 |
| 50 | 3300005353 | Ga0070669_100077149 | Ga0070669_1000771493 | 236 |
| 51 | 3300005434 | Ga0070709_10098936 | Ga0070709_100989363 | 236 |
| 52 | 3300005436 | Ga0070713_100089195 | Ga0070713_1000891953 | 236 |
| 53 | 3300005440 | Ga0070705_100020002 | Ga0070705_1000200025 | 236 |
| 54 | 3300005445 | Ga0070708_100038285 | Ga0070708_1000382853 | 236 |
| 55 | 3300005468 | Ga0070707_100295675 | Ga0070707_1002956752 | 236 |
| 56 | 3300005471 | Ga0070698_100171917 | Ga0070698_1001719172 | 236 |
| 57 | 3300005536 | Ga0070697_100394342 | Ga0070697_1003943421 | 236 |
| 58 | 3300005549 | Ga0070704_100059179 | Ga0070704_1000591792 | 236 |
| 59 | 3300005719 | Ga0068861_100000004 | Ga0068861_10000000412 | 236 |
| 60 | 3300005844 | Ga0068862_100127618 | Ga0068862_1001276182 | 236 |
| 61 | 3300005983 | Ga0081540_1114350 | Ga0081540_11143502 | 236 |
| 62 | 3300006846 | Ga0075430_100003928 | Ga0075430_1000039288 | 236 |
| 63 | 3300006847 | Ga0075431_100030654 | Ga0075431_1000306545 | 236 |
| 64 | 3300006852 | Ga0075433_10001643 | Ga0075433_1000164317 | 236 |
| 65 | 3300006852 | Ga0075433_10037698 | Ga0075433_100376985 | 236 |
| 66 | 3300006852 | Ga0075433_10184112 | Ga0075433_101841122 | 236 |
| 67 | 3300006871 | Ga0075434_100009146 | Ga0075434_1000091467 | 236 |
| 68 | 3300006871 | Ga0075434_100091903 | Ga0075434_1000919033 | 236 |
| 69 | 3300006880 | Ga0075429_100000661 | Ga0075429_10000066115 | 236 |
| 70 | 3300006881 | Ga0068865_100398082 | Ga0068865_1003980821 | 236 |
| 71 | 3300007076 | Ga0075435_100021823 | Ga0075435_1000218234 | 236 |
| 72 | 3300007076 | Ga0075435_100052771 | Ga0075435_1000527713 | 236 |
| 73 | 3300009147 | Ga0114129_10146929 | Ga0114129_101469293 | 236 |
| 74 | 3300009553 | Ga0105249_10603500 | Ga0105249_106035002 | 236 |
| 75 | 3300013297 | Ga0157378_10129944 | Ga0157378_101299443 | 236 |
| 76 | 3300014968 | Ga0157379_10136266 | Ga0157379_101362663 | 236 |
| 77 | 3300014969 | Ga0157376_10320987 | Ga0157376_103209872 | 236 |
| 78 | 3300025910 | Ga0207684_10009055 | Ga0207684_100090553 | 236 |
| 79 | 3300025922 | Ga0207646_10029483 | Ga0207646_100294832 | 236 |
| 80 | 3300025938 | Ga0207704_10040243 | Ga0207704_100402434 | 236 |
| 81 | 3300026118 | Ga0207675_100000032 | Ga0207675_10000003272 | 236 |
| 82 | 3300027907 | Ga0207428_10000013 | Ga0207428_10000013130 | 236 |
| 83 | 3300028380 | Ga0268265_10074257 | Ga0268265_100742572 | 236 |
| 84 | 3300035088 | Ga0373940_0069545 | Ga0373940_0069545_119_913 | 236 |
| 85 | 3300035112 | Ga0373932_0084718 | Ga0373932_0084718_29_772 | 236 |
| 86 | 3300035242 | Ga0373962_0010180 | Ga0373962_0010180_1492_2286 | 236 |
| 87 | 3300035691 | Ga0373931_0128835 | Ga0373931_0128835_477_1271 | 236 |
| 88 | 3300038996 | Ga0242420_035721 | Ga0242420_035721_75_818 | 236 |
| 89 | 3300044712 | Ga0453684_1195965 | Ga0453684_1195965_17_760 | 236 |
| 90 | 3300046472 | Ga0495580_0001659 | Ga0495580_0001659_15126_15869 | 236 |
| 91 | 3300046684 | Ga0495669_0089882 | Ga0495669_0089882_74_817 | 236 |
| 92 | 3300050507 | nmdc:mga05p37_221243_c1 | nmdc:mga05p37_221243_c1_1033_1776 | 236 |
| 93 | 3300050507 | nmdc:mga05p37_232847_c1 | nmdc:mga05p37_232847_c1_56_799 | 236 |
| 94 | 3300050507 | nmdc:mga05p37_61184_c1 | nmdc:mga05p37_61184_c1_1982_2776 | 236 |
| 95 | 3300050508 | nmdc:mga09592_49790_c1 | nmdc:mga09592_49790_c1_70_864 | 236 |
| 96 | 3300050509 | nmdc:mga0qj67_53859_c1 | nmdc:mga0qj67_53859_c1_1982_2776 | 236 |
| 97 | 3300050510 | nmdc:mga06r32_158592_c1 | nmdc:mga06r32_158592_c1_1041_1835 | 236 |
| 98 | 3300050510 | nmdc:mga06r32_66014_c1 | nmdc:mga06r32_66014_c1_2460_3203 | 236 |
| 99 | 3300050511 | nmdc:mga08y16_489_c1 | nmdc:mga08y16_489_c1_3047_3790 | 236 |
| 100 | 3300050512 | nmdc:mga0n895_153338_c1 | nmdc:mga0n895_153338_c1_549_1292 | 236 |
| 101 | 3300050512 | nmdc:mga0n895_16654_c1 | nmdc:mga0n895_16654_c1_5176_5919 | 236 |
| 102 | 3300050512 | nmdc:mga0n895_38873_c1 | nmdc:mga0n895_38873_c1_1935_2678 | 236 |
| 103 | 3300050513 | nmdc:mga0rr50_148962_c1 | nmdc:mga0rr50_148962_c1_894_1637 | 236 |
| 104 | 3300050513 | nmdc:mga0rr50_19985_c1 | nmdc:mga0rr50_19985_c1_2758_3501 | 236 |
| 105 | 3300050513 | nmdc:mga0rr50_50745_c1 | nmdc:mga0rr50_50745_c1_2149_2901 | 236 |
| 106 | 3300050514 | nmdc:mga08x19_573149_c1 | nmdc:mga08x19_573149_c1_20_763 | 236 |
| 107 | 3300050515 | nmdc:mga0a205_16766_c1 | nmdc:mga0a205_16766_c1_4292_5035 | 236 |
| 108 | 3300050515 | nmdc:mga0a205_405_c1 | nmdc:mga0a205_405_c1_28304_29047 | 236 |
| 109 | 3300050515 | nmdc:mga0a205_78789_c1 | nmdc:mga0a205_78789_c1_719_1462 | 236 |
| 110 | 3300006852 | Ga0075433_10169180 | Ga0075433_101691801 | 237 |
| 111 | 3300006871 | Ga0075434_100712580 | Ga0075434_1007125801 | 237 |
| 112 | 3300006914 | Ga0075436_100118035 | Ga0075436_1001180351 | 237 |
| 113 | 3300031824 | Ga0307413_10230357 | Ga0307413_102303572 | 237 |
| 114 | 3300035695 | Ga0373927_0185620 | Ga0373927_0185620_529_1287 | 237 |
| 115 | 3300050512 | nmdc:mga0n895_263911_c1 | nmdc:mga0n895_263911_c1_326_1141 | 237 |
| 116 | 3300050515 | nmdc:mga0a205_634766_c1 | nmdc:mga0a205_634766_c1_13_876 | 237 |
| 117 | 3300005548 | Ga0070665_100118010 | Ga0070665_1001180101 | 238 |
| 118 | 3300005614 | Ga0068856_100694763 | Ga0068856_1006947631 | 238 |
| 119 | 3300046689 | Ga0495613_0001713 | Ga0495613_0001713_9107_9880 | 238 |
| 120 | 3300053156 | Ga0500622_0007547 | Ga0500622_0007547_2237_3016 | 238 |
| 121 | 3300042876 | Ga0451577_0081542 | Ga0451577_0081542_2005_2745 | 240 |
| 122 | 3300005456 | Ga0070678_100340143 | Ga0070678_1003401431 | 241 |
| 123 | 3300026121 | Ga0207683_10385365 | Ga0207683_103853651 | 241 |
| 124 | 3300053091 | Ga0500647_0004051 | Ga0500647_0004051_1852_2649 | 241 |
| 125 | 3300053111 | Ga0500572_001507 | Ga0500572_001507_5237_6040 | 241 |
| 126 | 3300028800 | Ga0265338_10009552 | Ga0265338_100095523 | 242 |
| 127 | 3300037418 | Ga0395900_0130218 | Ga0395900_0130218_1800_2528 | 242 |
| 128 | 3300037471 | Ga0395905_0357030 | Ga0395905_0357030_514_1242 | 242 |
| 129 | 3300049581 | Ga0501047_0246489 | Ga0501047_0246489_477_1256 | 242 |
| 130 | 3300049575 | Ga0501039_0038758 | Ga0501039_0038758_1429_2160 | 243 |
| 131 | 3300049576 | Ga0501040_0135585 | Ga0501040_0135585_787_1518 | 243 |
| 132 | 3300049587 | Ga0501071_0169304 | Ga0501071_0169304_782_1513 | 243 |
| 133 | 3300049588 | Ga0501072_0001276 | Ga0501072_0001276_12872_13603 | 243 |
| 134 | 3300049591 | Ga0501075_0076112 | Ga0501075_0076112_622_1353 | 243 |
| 135 | 3300049592 | Ga0501076_0064042 | Ga0501076_0064042_1745_2476 | 243 |
| 136 | 3300049743 | Ga0501081_0008913 | Ga0501081_0008913_3617_4348 | 243 |
| 137 | 3300050507 | nmdc:mga05p37_93255_c1 | nmdc:mga05p37_93255_c1_2160_2891 | 243 |
| 138 | 3300050509 | nmdc:mga0qj67_36838_c1 | nmdc:mga0qj67_36838_c1_1693_2424 | 243 |
| 139 | 3300050510 | nmdc:mga06r32_32383_c1 | nmdc:mga06r32_32383_c1_2266_2997 | 243 |
| 140 | 3300054114 | Ga0501084_0020379 | Ga0501084_0020379_2578_3309 | 243 |
| 141 | 3300060353 | Ga0501082_0142627 | Ga0501082_0142627_579_1310 | 243 |
| 142 | 3300005445 | Ga0070708_100004094 | Ga0070708_1000040947 | 244 |
| 143 | 3300005467 | Ga0070706_100009125 | Ga0070706_1000091257 | 244 |
| 144 | 3300005468 | Ga0070707_100004905 | Ga0070707_1000049055 | 244 |
| 145 | 3300005471 | Ga0070698_100032216 | Ga0070698_1000322163 | 244 |
| 146 | 3300005518 | Ga0070699_100005189 | Ga0070699_1000051897 | 244 |
| 147 | 3300005530 | Ga0070679_100282801 | Ga0070679_1002828012 | 244 |
| 148 | 3300005536 | Ga0070697_100002396 | Ga0070697_1000023964 | 244 |
| 149 | 3300005549 | Ga0070704_100379879 | Ga0070704_1003798791 | 244 |
| 150 | 3300025910 | Ga0207684_10000746 | Ga0207684_1000074620 | 244 |
| 151 | 3300025922 | Ga0207646_10002863 | Ga0207646_1000286314 | 244 |
| 152 | 3300039438 | Ga0436360_0219999 | Ga0436360_0219999_1253_2017 | 244 |
| 153 | 3300049588 | Ga0501072_0093101 | Ga0501072_0093101_886_1620 | 244 |
| 154 | 3300049591 | Ga0501075_0109497 | Ga0501075_0109497_578_1312 | 244 |
| 155 | 3300049741 | Ga0501079_0192782 | Ga0501079_0192782_207_941 | 244 |
| 156 | 3300061734 | Ga0530510_0003571 | Ga0530510_0003571_175_909 | 244 |
| 157 | 3300003347 | JGI26128J50194_1000333 | JGI26128J50194_10003332 | 245 |
| 158 | 3300005293 | Ga0065715_10132737 | Ga0065715_101327372 | 245 |
| 159 | 3300005295 | Ga0065707_10215216 | Ga0065707_102152162 | 245 |
| 160 | 3300005328 | Ga0070676_10032931 | Ga0070676_100329314 | 245 |
| 161 | 3300005328 | Ga0070676_10115422 | Ga0070676_101154222 | 245 |
| 162 | 3300005329 | Ga0070683_100065748 | Ga0070683_1000657482 | 245 |
| 163 | 3300005330 | Ga0070690_100217698 | Ga0070690_1002176982 | 245 |
| 164 | 3300005331 | Ga0070670_100019652 | Ga0070670_1000196523 | 245 |
| 165 | 3300005331 | Ga0070670_100602666 | Ga0070670_1006026661 | 245 |
| 166 | 3300005334 | Ga0068869_100005890 | Ga0068869_1000058905 | 245 |
| 167 | 3300005334 | Ga0068869_100032040 | Ga0068869_1000320402 | 245 |
| 168 | 3300005336 | Ga0070680_100001053 | Ga0070680_10000105317 | 245 |
| 169 | 3300005336 | Ga0070680_100006965 | Ga0070680_1000069656 | 245 |
| 170 | 3300005336 | Ga0070680_100292440 | Ga0070680_1002924401 | 245 |
| 171 | 3300005337 | Ga0070682_100001390 | Ga0070682_1000013906 | 245 |
| 172 | 3300005339 | Ga0070660_100004277 | Ga0070660_1000042775 | 245 |
| 173 | 3300005340 | Ga0070689_100035910 | Ga0070689_1000359103 | 245 |
| 174 | 3300005341 | Ga0070691_10009887 | Ga0070691_100098873 | 245 |
| 175 | 3300005341 | Ga0070691_10012022 | Ga0070691_100120223 | 245 |
| 176 | 3300005341 | Ga0070691_10016034 | Ga0070691_100160344 | 245 |
| 177 | 3300005344 | Ga0070661_100000703 | Ga0070661_10000070324 | 245 |
| 178 | 3300005345 | Ga0070692_10000029 | Ga0070692_100000293 | 245 |
| 179 | 3300005345 | Ga0070692_10312275 | Ga0070692_103122751 | 245 |
| 180 | 3300005347 | Ga0070668_100560034 | Ga0070668_1005600341 | 245 |
| 181 | 3300005353 | Ga0070669_100099212 | Ga0070669_1000992124 | 245 |
| 182 | 3300005355 | Ga0070671_100511103 | Ga0070671_1005111032 | 245 |
| 183 | 3300005364 | Ga0070673_100245417 | Ga0070673_1002454172 | 245 |
| 184 | 3300005366 | Ga0070659_100006955 | Ga0070659_1000069555 | 245 |
| 185 | 3300005406 | Ga0070703_10001000 | Ga0070703_100010008 | 245 |
| 186 | 3300005438 | Ga0070701_10025563 | Ga0070701_100255632 | 245 |
| 187 | 3300005438 | Ga0070701_10058869 | Ga0070701_100588692 | 245 |
| 188 | 3300005438 | Ga0070701_10130553 | Ga0070701_101305532 | 245 |
| 189 | 3300005439 | Ga0070711_100195644 | Ga0070711_1001956442 | 245 |
| 190 | 3300005440 | Ga0070705_100000347 | Ga0070705_10000034722 | 245 |
| 191 | 3300005440 | Ga0070705_100017961 | Ga0070705_1000179612 | 245 |
| 192 | 3300005440 | Ga0070705_100157956 | Ga0070705_1001579562 | 245 |
| 193 | 3300005441 | Ga0070700_100019741 | Ga0070700_1000197414 | 245 |
| 194 | 3300005441 | Ga0070700_100037663 | Ga0070700_1000376632 | 245 |
| 195 | 3300005441 | Ga0070700_100110093 | Ga0070700_1001100931 | 245 |
| 196 | 3300005444 | Ga0070694_100002904 | Ga0070694_1000029047 | 245 |
| 197 | 3300005444 | Ga0070694_100007439 | Ga0070694_1000074398 | 245 |
| 198 | 3300005444 | Ga0070694_100030812 | Ga0070694_1000308121 | 245 |
| 199 | 3300005444 | Ga0070694_100055735 | Ga0070694_1000557351 | 245 |
| 200 | 3300005444 | Ga0070694_100178808 | Ga0070694_1001788082 | 245 |
| 201 | 3300005444 | Ga0070694_100694073 | Ga0070694_1006940731 | 245 |
| 202 | 3300005445 | Ga0070708_100184561 | Ga0070708_1001845611 | 245 |
| 203 | 3300005445 | Ga0070708_100190967 | Ga0070708_1001909672 | 245 |
| 204 | 3300005445 | Ga0070708_100374035 | Ga0070708_1003740352 | 245 |
| 205 | 3300005445 | Ga0070708_100433169 | Ga0070708_1004331691 | 245 |
| 206 | 3300005445 | Ga0070708_100453119 | Ga0070708_1004531191 | 245 |
| 207 | 3300005455 | Ga0070663_100008299 | Ga0070663_1000082992 | 245 |
| 208 | 3300005455 | Ga0070663_100543991 | Ga0070663_1005439911 | 245 |
| 209 | 3300005457 | Ga0070662_100012635 | Ga0070662_1000126354 | 245 |
| 210 | 3300005458 | Ga0070681_10046542 | Ga0070681_100465422 | 245 |
| 211 | 3300005459 | Ga0068867_100000705 | Ga0068867_10000070516 | 245 |
| 212 | 3300005459 | Ga0068867_100089046 | Ga0068867_1000890462 | 245 |
| 213 | 3300005459 | Ga0068867_100376348 | Ga0068867_1003763482 | 245 |
| 214 | 3300005467 | Ga0070706_100003119 | Ga0070706_1000031197 | 245 |
| 215 | 3300005467 | Ga0070706_100022643 | Ga0070706_1000226436 | 245 |
| 216 | 3300005467 | Ga0070706_100075397 | Ga0070706_1000753973 | 245 |
| 217 | 3300005468 | Ga0070707_100000653 | Ga0070707_10000065326 | 245 |
| 218 | 3300005468 | Ga0070707_100009854 | Ga0070707_1000098545 | 245 |
| 219 | 3300005468 | Ga0070707_100026589 | Ga0070707_1000265893 | 245 |
| 220 | 3300005468 | Ga0070707_100091021 | Ga0070707_1000910212 | 245 |
| 221 | 3300005471 | Ga0070698_100002225 | Ga0070698_10000222515 | 245 |
| 222 | 3300005471 | Ga0070698_100043266 | Ga0070698_1000432663 | 245 |
| 223 | 3300005471 | Ga0070698_100354270 | Ga0070698_1003542702 | 245 |
| 224 | 3300005471 | Ga0070698_100374862 | Ga0070698_1003748622 | 245 |
| 225 | 3300005518 | Ga0070699_100001487 | Ga0070699_10000148713 | 245 |
| 226 | 3300005518 | Ga0070699_100012466 | Ga0070699_1000124662 | 245 |
| 227 | 3300005518 | Ga0070699_100068829 | Ga0070699_1000688294 | 245 |
| 228 | 3300005518 | Ga0070699_100077173 | Ga0070699_1000771733 | 245 |
| 229 | 3300005518 | Ga0070699_100394615 | Ga0070699_1003946151 | 245 |
| 230 | 3300005518 | Ga0070699_100498566 | Ga0070699_1004985662 | 245 |
| 231 | 3300005518 | Ga0070699_100559116 | Ga0070699_1005591161 | 245 |
| 232 | 3300005530 | Ga0070679_100000403 | Ga0070679_1000004036 | 245 |
| 233 | 3300005536 | Ga0070697_100013678 | Ga0070697_1000136783 | 245 |
| 234 | 3300005536 | Ga0070697_100048309 | Ga0070697_1000483094 | 245 |
| 235 | 3300005536 | Ga0070697_100132629 | Ga0070697_1001326292 | 245 |
| 236 | 3300005536 | Ga0070697_100185627 | Ga0070697_1001856272 | 245 |
| 237 | 3300005536 | Ga0070697_100363921 | Ga0070697_1003639211 | 245 |
| 238 | 3300005539 | Ga0068853_100000808 | Ga0068853_10000080810 | 245 |
| 239 | 3300005543 | Ga0070672_100108634 | Ga0070672_1001086342 | 245 |
| 240 | 3300005545 | Ga0070695_100000668 | Ga0070695_1000006685 | 245 |
| 241 | 3300005545 | Ga0070695_100005074 | Ga0070695_1000050745 | 245 |
| 242 | 3300005545 | Ga0070695_100008983 | Ga0070695_1000089835 | 245 |
| 243 | 3300005545 | Ga0070695_100093448 | Ga0070695_1000934482 | 245 |
| 244 | 3300005545 | Ga0070695_100099461 | Ga0070695_1000994612 | 245 |
| 245 | 3300005545 | Ga0070695_100125574 | Ga0070695_1001255742 | 245 |
| 246 | 3300005546 | Ga0070696_100012891 | Ga0070696_1000128915 | 245 |
| 247 | 3300005546 | Ga0070696_100026754 | Ga0070696_1000267546 | 245 |
| 248 | 3300005546 | Ga0070696_100066579 | Ga0070696_1000665792 | 245 |
| 249 | 3300005547 | Ga0070693_100000573 | Ga0070693_10000057314 | 245 |
| 250 | 3300005549 | Ga0070704_100000240 | Ga0070704_10000024020 | 245 |
| 251 | 3300005549 | Ga0070704_100122536 | Ga0070704_1001225362 | 245 |
| 252 | 3300005549 | Ga0070704_100205974 | Ga0070704_1002059742 | 245 |
| 253 | 3300005549 | Ga0070704_100365073 | Ga0070704_1003650732 | 245 |
| 254 | 3300005563 | Ga0068855_100000462 | Ga0068855_10000046224 | 245 |
| 255 | 3300005564 | Ga0070664_100002902 | Ga0070664_10000290213 | 245 |
| 256 | 3300005577 | Ga0068857_100110323 | Ga0068857_1001103233 | 245 |
| 257 | 3300005577 | Ga0068857_100931225 | Ga0068857_1009312251 | 245 |
| 258 | 3300005578 | Ga0068854_100001177 | Ga0068854_10000117710 | 245 |
| 259 | 3300005614 | Ga0068856_100004303 | Ga0068856_1000043034 | 245 |
| 260 | 3300005615 | Ga0070702_100370122 | Ga0070702_1003701221 | 245 |
| 261 | 3300005616 | Ga0068852_100071274 | Ga0068852_1000712743 | 245 |
| 262 | 3300005617 | Ga0068859_100001671 | Ga0068859_1000016712 | 245 |
| 263 | 3300005618 | Ga0068864_100002356 | Ga0068864_1000023566 | 245 |
| 264 | 3300005618 | Ga0068864_100046193 | Ga0068864_1000461932 | 245 |
| 265 | 3300005840 | Ga0068870_10003549 | Ga0068870_100035493 | 245 |
| 266 | 3300005840 | Ga0068870_10070296 | Ga0068870_100702962 | 245 |
| 267 | 3300005841 | Ga0068863_100020982 | Ga0068863_1000209824 | 245 |
| 268 | 3300005841 | Ga0068863_100124552 | Ga0068863_1001245523 | 245 |
| 269 | 3300005842 | Ga0068858_100049390 | Ga0068858_1000493903 | 245 |
| 270 | 3300005843 | Ga0068860_100022487 | Ga0068860_1000224876 | 245 |
| 271 | 3300005844 | Ga0068862_100002540 | Ga0068862_10000254012 | 245 |
| 272 | 3300005844 | Ga0068862_100117166 | Ga0068862_1001171663 | 245 |
| 273 | 3300005844 | Ga0068862_100134605 | Ga0068862_1001346051 | 245 |
| 274 | 3300005844 | Ga0068862_100732280 | Ga0068862_1007322802 | 245 |
| 275 | 3300005937 | Ga0081455_10000074 | Ga0081455_1000007477 | 245 |
| 276 | 3300005937 | Ga0081455_10000263 | Ga0081455_1000026351 | 245 |
| 277 | 3300005937 | Ga0081455_10217852 | Ga0081455_102178521 | 245 |
| 278 | 3300005983 | Ga0081540_1000017 | Ga0081540_1000017150 | 245 |
| 279 | 3300005983 | Ga0081540_1033550 | Ga0081540_10335503 | 245 |
| 280 | 3300005983 | Ga0081540_1051903 | Ga0081540_10519031 | 245 |
| 281 | 3300005985 | Ga0081539_10055381 | Ga0081539_100553811 | 245 |
| 282 | 3300006173 | Ga0070716_100007739 | Ga0070716_1000077394 | 245 |
| 283 | 3300006175 | Ga0070712_100137021 | Ga0070712_1001370211 | 245 |
| 284 | 3300006237 | Ga0097621_100090915 | Ga0097621_1000909152 | 245 |
| 285 | 3300006358 | Ga0068871_100039961 | Ga0068871_1000399613 | 245 |
| 286 | 3300006844 | Ga0075428_100020538 | Ga0075428_10002053810 | 245 |
| 287 | 3300006844 | Ga0075428_100103663 | Ga0075428_1001036635 | 245 |
| 288 | 3300006846 | Ga0075430_100007711 | Ga0075430_1000077113 | 245 |
| 289 | 3300006847 | Ga0075431_100004634 | Ga0075431_1000046347 | 245 |
| 290 | 3300006847 | Ga0075431_100169181 | Ga0075431_1001691812 | 245 |
| 291 | 3300006847 | Ga0075431_100186509 | Ga0075431_1001865092 | 245 |
| 292 | 3300006847 | Ga0075431_100560364 | Ga0075431_1005603641 | 245 |
| 293 | 3300006847 | Ga0075431_100575073 | Ga0075431_1005750732 | 245 |
| 294 | 3300006852 | Ga0075433_10001928 | Ga0075433_100019287 | 245 |
| 295 | 3300006852 | Ga0075433_10008706 | Ga0075433_100087064 | 245 |
| 296 | 3300006852 | Ga0075433_10057068 | Ga0075433_100570682 | 245 |
| 297 | 3300006871 | Ga0075434_100015061 | Ga0075434_1000150614 | 245 |
| 298 | 3300006871 | Ga0075434_100016891 | Ga0075434_1000168917 | 245 |
| 299 | 3300006871 | Ga0075434_100019048 | Ga0075434_1000190482 | 245 |
| 300 | 3300006871 | Ga0075434_100054352 | Ga0075434_1000543521 | 245 |
| 301 | 3300006871 | Ga0075434_100659468 | Ga0075434_1006594681 | 245 |
| 302 | 3300006880 | Ga0075429_100008728 | Ga0075429_1000087283 | 245 |
| 303 | 3300006880 | Ga0075429_100026834 | Ga0075429_1000268344 | 245 |
| 304 | 3300006880 | Ga0075429_100033193 | Ga0075429_1000331934 | 245 |
| 305 | 3300006880 | Ga0075429_100045162 | Ga0075429_1000451624 | 245 |
| 306 | 3300006880 | Ga0075429_100274623 | Ga0075429_1002746232 | 245 |
| 307 | 3300006914 | Ga0075436_100099323 | Ga0075436_1000993233 | 245 |
| 308 | 3300006931 | Ga0097620_100001671 | Ga0097620_1000016712 | 245 |
| 309 | 3300007076 | Ga0075435_100017972 | Ga0075435_1000179723 | 245 |
| 310 | 3300007076 | Ga0075435_100054091 | Ga0075435_1000540912 | 245 |
| 311 | 3300007076 | Ga0075435_100193054 | Ga0075435_1001930542 | 245 |
| 312 | 3300007076 | Ga0075435_100499359 | Ga0075435_1004993592 | 245 |
| 313 | 3300007265 | Ga0099794_10003812 | Ga0099794_100038122 | 245 |
| 314 | 3300007265 | Ga0099794_10010552 | Ga0099794_100105524 | 245 |
| 315 | 3300007265 | Ga0099794_10040605 | Ga0099794_100406053 | 245 |
| 316 | 3300009094 | Ga0111539_10115750 | Ga0111539_101157503 | 245 |
| 317 | 3300009094 | Ga0111539_10116432 | Ga0111539_101164322 | 245 |
| 318 | 3300009094 | Ga0111539_10191407 | Ga0111539_101914072 | 245 |
| 319 | 3300009147 | Ga0114129_10015925 | Ga0114129_100159258 | 245 |
| 320 | 3300009147 | Ga0114129_10016561 | Ga0114129_1001656110 | 245 |
| 321 | 3300009147 | Ga0114129_10040884 | Ga0114129_100408845 | 245 |
| 322 | 3300009147 | Ga0114129_10058855 | Ga0114129_100588554 | 245 |
| 323 | 3300009147 | Ga0114129_10077184 | Ga0114129_100771843 | 245 |
| 324 | 3300009147 | Ga0114129_10124701 | Ga0114129_101247015 | 245 |
| 325 | 3300009147 | Ga0114129_10169545 | Ga0114129_101695453 | 245 |
| 326 | 3300009147 | Ga0114129_10250744 | Ga0114129_102507442 | 245 |
| 327 | 3300009147 | Ga0114129_10308054 | Ga0114129_103080543 | 245 |
| 328 | 3300009148 | Ga0105243_10061656 | Ga0105243_100616563 | 245 |
| 329 | 3300009148 | Ga0105243_10074268 | Ga0105243_100742682 | 245 |
| 330 | 3300009148 | Ga0105243_10406403 | Ga0105243_104064032 | 245 |
| 331 | 3300009148 | Ga0105243_10429285 | Ga0105243_104292852 | 245 |
| 332 | 3300009174 | Ga0105241_10000334 | Ga0105241_100003349 | 245 |
| 333 | 3300009174 | Ga0105241_10039866 | Ga0105241_100398663 | 245 |
| 334 | 3300009176 | Ga0105242_10010946 | Ga0105242_100109467 | 245 |
| 335 | 3300009177 | Ga0105248_10095937 | Ga0105248_100959373 | 245 |
| 336 | 3300009177 | Ga0105248_10135151 | Ga0105248_101351513 | 245 |
| 337 | 3300009553 | Ga0105249_10063722 | Ga0105249_100637222 | 245 |
| 338 | 3300009553 | Ga0105249_10127839 | Ga0105249_101278392 | 245 |
| 339 | 3300009553 | Ga0105249_10128176 | Ga0105249_101281762 | 245 |
| 340 | 3300009553 | Ga0105249_10739007 | Ga0105249_107390071 | 245 |
| 341 | 3300010375 | Ga0105239_10053250 | Ga0105239_100532502 | 245 |
| 342 | 3300011119 | Ga0105246_10077064 | Ga0105246_100770643 | 245 |
| 343 | 3300013100 | Ga0157373_10000379 | Ga0157373_1000037924 | 245 |
| 344 | 3300013102 | Ga0157371_10129203 | Ga0157371_101292032 | 245 |
| 345 | 3300013306 | Ga0163162_10126896 | Ga0163162_101268962 | 245 |
| 346 | 3300013306 | Ga0163162_10511084 | Ga0163162_105110842 | 245 |
| 347 | 3300013306 | Ga0163162_10711046 | Ga0163162_107110462 | 245 |
| 348 | 3300013307 | Ga0157372_10000135 | Ga0157372_1000013529 | 245 |
| 349 | 3300013308 | Ga0157375_10086056 | Ga0157375_100860562 | 245 |
| 350 | 3300013308 | Ga0157375_10780244 | Ga0157375_107802442 | 245 |
| 351 | 3300014325 | Ga0163163_10458433 | Ga0163163_104584331 | 245 |
| 352 | 3300014968 | Ga0157379_10095352 | Ga0157379_100953524 | 245 |
| 353 | 3300014968 | Ga0157379_10178804 | Ga0157379_101788042 | 245 |
| 354 | 3300020070 | Ga0206356_10892825 | Ga0206356_108928251 | 245 |
| 355 | 3300020078 | Ga0206352_10926330 | Ga0206352_109263301 | 245 |
| 356 | 3300020080 | Ga0206350_10906670 | Ga0206350_109066701 | 245 |
| 357 | 3300021388 | Ga0213875_10075658 | Ga0213875_100756581 | 245 |
| 358 | 3300021388 | Ga0213875_10081146 | Ga0213875_100811462 | 245 |
| 359 | 3300025885 | Ga0207653_10000475 | Ga0207653_1000047514 | 245 |
| 360 | 3300025885 | Ga0207653_10013346 | Ga0207653_100133463 | 245 |
| 361 | 3300025885 | Ga0207653_10022438 | Ga0207653_100224382 | 245 |
| 362 | 3300025904 | Ga0207647_10034110 | Ga0207647_100341103 | 245 |
| 363 | 3300025905 | Ga0207685_10019191 | Ga0207685_100191911 | 245 |
| 364 | 3300025905 | Ga0207685_10210260 | Ga0207685_102102602 | 245 |
| 365 | 3300025906 | Ga0207699_10157986 | Ga0207699_101579861 | 245 |
| 366 | 3300025907 | Ga0207645_10000075 | Ga0207645_1000007511 | 245 |
| 367 | 3300025908 | Ga0207643_10001707 | Ga0207643_100017076 | 245 |
| 368 | 3300025908 | Ga0207643_10016247 | Ga0207643_100162473 | 245 |
| 369 | 3300025910 | Ga0207684_10001638 | Ga0207684_1000163820 | 245 |
| 370 | 3300025910 | Ga0207684_10003090 | Ga0207684_1000309010 | 245 |
| 371 | 3300025910 | Ga0207684_10012194 | Ga0207684_100121943 | 245 |
| 372 | 3300025910 | Ga0207684_10019452 | Ga0207684_100194524 | 245 |
| 373 | 3300025910 | Ga0207684_10146764 | Ga0207684_101467642 | 245 |
| 374 | 3300025910 | Ga0207684_10381520 | Ga0207684_103815201 | 245 |
| 375 | 3300025911 | Ga0207654_10001071 | Ga0207654_100010711 | 245 |
| 376 | 3300025912 | Ga0207707_10000135 | Ga0207707_1000013525 | 245 |
| 377 | 3300025915 | Ga0207693_10003315 | Ga0207693_100033159 | 245 |
| 378 | 3300025916 | Ga0207663_10424003 | Ga0207663_104240032 | 245 |
| 379 | 3300025917 | Ga0207660_10000688 | Ga0207660_100006886 | 245 |
| 380 | 3300025917 | Ga0207660_10012425 | Ga0207660_100124253 | 245 |
| 381 | 3300025917 | Ga0207660_10195556 | Ga0207660_101955562 | 245 |
| 382 | 3300025919 | Ga0207657_10000037 | Ga0207657_1000003781 | 245 |
| 383 | 3300025920 | Ga0207649_10029372 | Ga0207649_100293722 | 245 |
| 384 | 3300025921 | Ga0207652_10002292 | Ga0207652_1000229214 | 245 |
| 385 | 3300025922 | Ga0207646_10004177 | Ga0207646_100041774 | 245 |
| 386 | 3300025922 | Ga0207646_10006979 | Ga0207646_100069796 | 245 |
| 387 | 3300025922 | Ga0207646_10014266 | Ga0207646_100142665 | 245 |
| 388 | 3300025922 | Ga0207646_10031519 | Ga0207646_100315192 | 245 |
| 389 | 3300025922 | Ga0207646_10057995 | Ga0207646_100579954 | 245 |
| 390 | 3300025922 | Ga0207646_10073172 | Ga0207646_100731723 | 245 |
| 391 | 3300025922 | Ga0207646_10149492 | Ga0207646_101494924 | 245 |
| 392 | 3300025923 | Ga0207681_10048883 | Ga0207681_100488832 | 245 |
| 393 | 3300025923 | Ga0207681_10054501 | Ga0207681_100545013 | 245 |
| 394 | 3300025925 | Ga0207650_10012455 | Ga0207650_100124555 | 245 |
| 395 | 3300025932 | Ga0207690_10000562 | Ga0207690_100005623 | 245 |
| 396 | 3300025933 | Ga0207706_10011250 | Ga0207706_100112504 | 245 |
| 397 | 3300025935 | Ga0207709_10061209 | Ga0207709_100612092 | 245 |
| 398 | 3300025935 | Ga0207709_10184358 | Ga0207709_101843582 | 245 |
| 399 | 3300025935 | Ga0207709_10257457 | Ga0207709_102574572 | 245 |
| 400 | 3300025935 | Ga0207709_10311090 | Ga0207709_103110902 | 245 |
| 401 | 3300025936 | Ga0207670_10043530 | Ga0207670_100435303 | 245 |
| 402 | 3300025936 | Ga0207670_10098468 | Ga0207670_100984681 | 245 |
| 403 | 3300025937 | Ga0207669_10599598 | Ga0207669_105995981 | 245 |
| 404 | 3300025939 | Ga0207665_10000576 | Ga0207665_1000057613 | 245 |
| 405 | 3300025940 | Ga0207691_10134475 | Ga0207691_101344752 | 245 |
| 406 | 3300025941 | Ga0207711_10199391 | Ga0207711_101993912 | 245 |
| 407 | 3300025941 | Ga0207711_10339940 | Ga0207711_103399402 | 245 |
| 408 | 3300025942 | Ga0207689_10000029 | Ga0207689_1000002955 | 245 |
| 409 | 3300025942 | Ga0207689_10015346 | Ga0207689_100153464 | 245 |
| 410 | 3300025942 | Ga0207689_10289428 | Ga0207689_102894281 | 245 |
| 411 | 3300025945 | Ga0207679_10003224 | Ga0207679_100032246 | 245 |
| 412 | 3300025949 | Ga0207667_10000652 | Ga0207667_1000065223 | 245 |
| 413 | 3300025960 | Ga0207651_10279365 | Ga0207651_102793652 | 245 |
| 414 | 3300025960 | Ga0207651_10317319 | Ga0207651_103173192 | 245 |
| 415 | 3300025961 | Ga0207712_10014975 | Ga0207712_100149752 | 245 |
| 416 | 3300025961 | Ga0207712_10667215 | Ga0207712_106672151 | 245 |
| 417 | 3300025981 | Ga0207640_10008161 | Ga0207640_100081615 | 245 |
| 418 | 3300025981 | Ga0207640_10160318 | Ga0207640_101603181 | 245 |
| 419 | 3300026041 | Ga0207639_10063006 | Ga0207639_100630062 | 245 |
| 420 | 3300026067 | Ga0207678_10017042 | Ga0207678_100170426 | 245 |
| 421 | 3300026067 | Ga0207678_10452490 | Ga0207678_104524901 | 245 |
| 422 | 3300026075 | Ga0207708_10031915 | Ga0207708_100319154 | 245 |
| 423 | 3300026075 | Ga0207708_10041994 | Ga0207708_100419941 | 245 |
| 424 | 3300026075 | Ga0207708_10080563 | Ga0207708_100805633 | 245 |
| 425 | 3300026075 | Ga0207708_10426395 | Ga0207708_104263952 | 245 |
| 426 | 3300026078 | Ga0207702_10014520 | Ga0207702_100145201 | 245 |
| 427 | 3300026088 | Ga0207641_10061004 | Ga0207641_100610043 | 245 |
| 428 | 3300026088 | Ga0207641_10444180 | Ga0207641_104441802 | 245 |
| 429 | 3300026089 | Ga0207648_10000552 | Ga0207648_1000055218 | 245 |
| 430 | 3300026089 | Ga0207648_10376304 | Ga0207648_103763041 | 245 |
| 431 | 3300026116 | Ga0207674_10000306 | Ga0207674_1000030640 | 245 |
| 432 | 3300026116 | Ga0207674_10042965 | Ga0207674_100429653 | 245 |
| 433 | 3300026116 | Ga0207674_10106088 | Ga0207674_101060881 | 245 |
| 434 | 3300026118 | Ga0207675_100032074 | Ga0207675_1000320744 | 245 |
| 435 | 3300026118 | Ga0207675_100107562 | Ga0207675_1001075623 | 245 |
| 436 | 3300027360 | Ga0209969_1002067 | Ga0209969_10020672 | 245 |
| 437 | 3300027424 | Ga0209984_1001656 | Ga0209984_10016562 | 245 |
| 438 | 3300027424 | Ga0209984_1011237 | Ga0209984_10112371 | 245 |
| 439 | 3300027462 | Ga0210000_1002112 | Ga0210000_10021122 | 245 |
| 440 | 3300027471 | Ga0209995_1011423 | Ga0209995_10114232 | 245 |
| 441 | 3300027471 | Ga0209995_1021065 | Ga0209995_10210651 | 245 |
| 442 | 3300027543 | Ga0209999_1004084 | Ga0209999_10040844 | 245 |
| 443 | 3300027552 | Ga0209982_1014340 | Ga0209982_10143402 | 245 |
| 444 | 3300027614 | Ga0209970_1005428 | Ga0209970_10054282 | 245 |
| 445 | 3300027617 | Ga0210002_1001653 | Ga0210002_10016533 | 245 |
| 446 | 3300027665 | Ga0209983_1000146 | Ga0209983_10001462 | 245 |
| 447 | 3300027671 | Ga0209588_1024370 | Ga0209588_10243702 | 245 |
| 448 | 3300027682 | Ga0209971_1000008 | Ga0209971_100000888 | 245 |
| 449 | 3300027695 | Ga0209966_1000187 | Ga0209966_100018713 | 245 |
| 450 | 3300027717 | Ga0209998_10000016 | Ga0209998_1000001614 | 245 |
| 451 | 3300027717 | Ga0209998_10007971 | Ga0209998_100079712 | 245 |
| 452 | 3300027876 | Ga0209974_10001677 | Ga0209974_100016775 | 245 |
| 453 | 3300027907 | Ga0207428_10087469 | Ga0207428_100874692 | 245 |
| 454 | 3300027907 | Ga0207428_10288822 | Ga0207428_102888221 | 245 |
| 455 | 3300028380 | Ga0268265_10003670 | Ga0268265_100036703 | 245 |
| 456 | 3300028380 | Ga0268265_10186104 | Ga0268265_101861043 | 245 |
| 457 | 3300028380 | Ga0268265_10205963 | Ga0268265_102059632 | 245 |
| 458 | 3300028381 | Ga0268264_10045908 | Ga0268264_100459083 | 245 |
| 459 | 3300031548 | Ga0307408_100024744 | Ga0307408_1000247446 | 245 |
| 460 | 3300031548 | Ga0307408_100248057 | Ga0307408_1002480571 | 245 |
| 461 | 3300031824 | Ga0307413_10074005 | Ga0307413_100740052 | 245 |
| 462 | 3300031911 | Ga0307412_10366696 | Ga0307412_103666962 | 245 |
| 463 | 3300031995 | Ga0307409_100302282 | Ga0307409_1003022822 | 245 |
| 464 | 3300032002 | Ga0307416_100128963 | Ga0307416_1001289632 | 245 |
| 465 | 3300032002 | Ga0307416_100356753 | Ga0307416_1003567532 | 245 |
| 466 | 3300032002 | Ga0307416_100881606 | Ga0307416_1008816062 | 245 |
| 467 | 3300032004 | Ga0307414_10807191 | Ga0307414_108071911 | 245 |
| 468 | 3300034818 | Ga0373950_0026318 | Ga0373950_0026318_10_747 | 245 |
| 469 | 3300034819 | Ga0373958_0018006 | Ga0373958_0018006_458_1198 | 245 |
| 470 | 3300034820 | Ga0373959_0055580 | Ga0373959_0055580_105_842 | 245 |
| 471 | 3300035084 | Ga0373928_0018085 | Ga0373928_0018085_108_848 | 245 |
| 472 | 3300035084 | Ga0373928_0034492 | Ga0373928_0034492_147_884 | 245 |
| 473 | 3300035088 | Ga0373940_0010152 | Ga0373940_0010152_1078_1818 | 245 |
| 474 | 3300035090 | Ga0373949_0015057 | Ga0373949_0015057_946_1683 | 245 |
| 475 | 3300035115 | Ga0373941_0018071 | Ga0373941_0018071_579_1319 | 245 |
| 476 | 3300035121 | Ga0373960_0002818 | Ga0373960_0002818_1798_2535 | 245 |
| 477 | 3300035207 | Ga0373942_0015299 | Ga0373942_0015299_279_1019 | 245 |
| 478 | 3300035242 | Ga0373962_0020678 | Ga0373962_0020678_188_925 | 245 |
| 479 | 3300035242 | Ga0373962_0053405 | Ga0373962_0053405_308_1048 | 245 |
| 480 | 3300035691 | Ga0373931_0004831 | Ga0373931_0004831_2414_3154 | 245 |
| 481 | 3300039437 | Ga0436365_0488470 | Ga0436365_0488470_15099_15878 | 245 |
| 482 | 3300039437 | Ga0436365_1654887 | Ga0436365_1654887_589_1350 | 245 |
| 483 | 3300042157 | Ga0439458_0003469 | Ga0439458_0003469_1184_1921 | 245 |
| 484 | 3300042438 | Ga0439459_0003082 | Ga0439459_0003082_58_795 | 245 |
| 485 | 3300042461 | Ga0439460_0002029 | Ga0439460_0002029_4009_4746 | 245 |
| 486 | 3300042876 | Ga0451577_0043881 | Ga0451577_0043881_1042_1779 | 245 |
| 487 | 3300042876 | Ga0451577_0089884 | Ga0451577_0089884_72_809 | 245 |
| 488 | 3300044673 | Ga0453683_0026309 | Ga0453683_0026309_839_1576 | 245 |
| 489 | 3300044673 | Ga0453683_0043142 | Ga0453683_0043142_198_935 | 245 |
| 490 | 3300044673 | Ga0453683_0142708 | Ga0453683_0142708_566_1303 | 245 |
| 491 | 3300044712 | Ga0453684_0120577 | Ga0453684_0120577_2401_3138 | 245 |
| 492 | 3300045051 | Ga0451576_0017221 | Ga0451576_0017221_7049_7786 | 245 |
| 493 | 3300045051 | Ga0451576_0021782 | Ga0451576_0021782_1913_2650 | 245 |
| 494 | 3300045051 | Ga0451576_0031255 | Ga0451576_0031255_1729_2466 | 245 |
| 495 | 3300045051 | Ga0451576_0040420 | Ga0451576_0040420_2420_3157 | 245 |
| 496 | 3300045051 | Ga0451576_0088044 | Ga0451576_0088044_1134_1871 | 245 |
| 497 | 3300045051 | Ga0451576_0179881 | Ga0451576_0179881_633_1373 | 245 |
| 498 | 3300045051 | Ga0451576_0489550 | Ga0451576_0489550_512_1258 | 245 |
| 499 | 3300046472 | Ga0495580_0010780 | Ga0495580_0010780_2174_2911 | 245 |
| 500 | 3300046472 | Ga0495580_0165883 | Ga0495580_0165883_61_798 | 245 |
| 501 | 3300046491 | Ga0495584_0077036 | Ga0495584_0077036_588_1325 | 245 |
| 502 | 3300047318 | Ga0495636_0168280 | Ga0495636_0168280_160_903 | 245 |
| 503 | 3300048905 | Ga0496102_0085407 | Ga0496102_0085407_1244_1984 | 245 |
| 504 | 3300048907 | Ga0496104_0100178 | Ga0496104_0100178_603_1343 | 245 |
| 505 | 3300048908 | Ga0496105_0049557 | Ga0496105_0049557_1561_2301 | 245 |
| 506 | 3300048909 | Ga0496106_0016979 | Ga0496106_0016979_2693_3433 | 245 |
| 507 | 3300048909 | Ga0496106_0021548 | Ga0496106_0021548_547_1284 | 245 |
| 508 | 3300048911 | Ga0496108_0009227 | Ga0496108_0009227_6712_7452 | 245 |
| 509 | 3300048912 | Ga0496109_0044402 | Ga0496109_0044402_862_1602 | 245 |
| 510 | 3300048913 | Ga0496110_0073040 | Ga0496110_0073040_2110_2850 | 245 |
| 511 | 3300048914 | Ga0496111_0197834 | Ga0496111_0197834_200_940 | 245 |
| 512 | 3300048915 | Ga0496112_0134716 | Ga0496112_0134716_503_1240 | 245 |
| 513 | 3300048916 | Ga0496113_0250016 | Ga0496113_0250016_110_850 | 245 |
| 514 | 3300048918 | Ga0496115_0003412 | Ga0496115_0003412_846_1586 | 245 |
| 515 | 3300049568 | Ga0501031_0058974 | Ga0501031_0058974_1278_2015 | 245 |
| 516 | 3300049568 | Ga0501031_0276383 | Ga0501031_0276383_18_755 | 245 |
| 517 | 3300049569 | Ga0501032_0278586 | Ga0501032_0278586_259_996 | 245 |
| 518 | 3300049572 | Ga0501036_0097293 | Ga0501036_0097293_1732_2469 | 245 |
| 519 | 3300049573 | Ga0501037_0066402 | Ga0501037_0066402_1149_1898 | 245 |
| 520 | 3300049574 | Ga0501038_0053638 | Ga0501038_0053638_265_1002 | 245 |
| 521 | 3300049574 | Ga0501038_0166189 | Ga0501038_0166189_177_917 | 245 |
| 522 | 3300049575 | Ga0501039_0015798 | Ga0501039_0015798_525_1262 | 245 |
| 523 | 3300049575 | Ga0501039_0079363 | Ga0501039_0079363_246_995 | 245 |
| 524 | 3300049575 | Ga0501039_0237515 | Ga0501039_0237515_468_1268 | 245 |
| 525 | 3300049576 | Ga0501040_0001982 | Ga0501040_0001982_7315_8052 | 245 |
| 526 | 3300049576 | Ga0501040_0010799 | Ga0501040_0010799_2144_2881 | 245 |
| 527 | 3300049576 | Ga0501040_0309001 | Ga0501040_0309001_157_897 | 245 |
| 528 | 3300049577 | Ga0501041_0042286 | Ga0501041_0042286_2007_2747 | 245 |
| 529 | 3300049578 | Ga0501042_0001517 | Ga0501042_0001517_11352_12089 | 245 |
| 530 | 3300049578 | Ga0501042_0018652 | Ga0501042_0018652_651_1451 | 245 |
| 531 | 3300049578 | Ga0501042_0045329 | Ga0501042_0045329_1612_2349 | 245 |
| 532 | 3300049578 | Ga0501042_0091274 | Ga0501042_0091274_777_1514 | 245 |
| 533 | 3300049579 | Ga0501043_0032810 | Ga0501043_0032810_149_898 | 245 |
| 534 | 3300049579 | Ga0501043_0053090 | Ga0501043_0053090_984_1721 | 245 |
| 535 | 3300049580 | Ga0501046_0009495 | Ga0501046_0009495_5118_5855 | 245 |
| 536 | 3300049580 | Ga0501046_0234672 | Ga0501046_0234672_226_963 | 245 |
| 537 | 3300049580 | Ga0501046_0302712 | Ga0501046_0302712_201_1001 | 245 |
| 538 | 3300049581 | Ga0501047_0135299 | Ga0501047_0135299_125_862 | 245 |
| 539 | 3300049582 | Ga0501048_0011174 | Ga0501048_0011174_4617_5354 | 245 |
| 540 | 3300049582 | Ga0501048_0022183 | Ga0501048_0022183_2178_2915 | 245 |
| 541 | 3300049582 | Ga0501048_0037034 | Ga0501048_0037034_223_960 | 245 |
| 542 | 3300049582 | Ga0501048_0467660 | Ga0501048_0467660_39_776 | 245 |
| 543 | 3300049583 | Ga0501067_0103099 | Ga0501067_0103099_592_1329 | 245 |
| 544 | 3300049584 | Ga0501068_0112203 | Ga0501068_0112203_55_792 | 245 |
| 545 | 3300049585 | Ga0501069_0317664 | Ga0501069_0317664_167_904 | 245 |
| 546 | 3300049587 | Ga0501071_0007379 | Ga0501071_0007379_143_880 | 245 |
| 547 | 3300049587 | Ga0501071_0035050 | Ga0501071_0035050_441_1178 | 245 |
| 548 | 3300049588 | Ga0501072_0023626 | Ga0501072_0023626_2465_3202 | 245 |
| 549 | 3300049588 | Ga0501072_0030081 | Ga0501072_0030081_1389_2126 | 245 |
| 550 | 3300049588 | Ga0501072_0036089 | Ga0501072_0036089_2585_3322 | 245 |
| 551 | 3300049588 | Ga0501072_0233585 | Ga0501072_0233585_463_1200 | 245 |
| 552 | 3300049590 | Ga0501074_0002117 | Ga0501074_0002117_8917_9654 | 245 |
| 553 | 3300049590 | Ga0501074_0029284 | Ga0501074_0029284_294_1031 | 245 |
| 554 | 3300049591 | Ga0501075_0000955 | Ga0501075_0000955_9204_9941 | 245 |
| 555 | 3300049591 | Ga0501075_0004974 | Ga0501075_0004974_6051_6788 | 245 |
| 556 | 3300049591 | Ga0501075_0012336 | Ga0501075_0012336_4304_5104 | 245 |
| 557 | 3300049591 | Ga0501075_0082154 | Ga0501075_0082154_1421_2158 | 245 |
| 558 | 3300049591 | Ga0501075_0107129 | Ga0501075_0107129_29_769 | 245 |
| 559 | 3300049592 | Ga0501076_0003931 | Ga0501076_0003931_238_975 | 245 |
| 560 | 3300049592 | Ga0501076_0240422 | Ga0501076_0240422_722_1462 | 245 |
| 561 | 3300049593 | Ga0501077_0001617 | Ga0501077_0001617_1356_2093 | 245 |
| 562 | 3300049593 | Ga0501077_0031565 | Ga0501077_0031565_253_993 | 245 |
| 563 | 3300049593 | Ga0501077_0052455 | Ga0501077_0052455_150_887 | 245 |
| 564 | 3300049593 | Ga0501077_0189257 | Ga0501077_0189257_552_1289 | 245 |
| 565 | 3300049593 | Ga0501077_0254007 | Ga0501077_0254007_335_1072 | 245 |
| 566 | 3300049741 | Ga0501079_0001548 | Ga0501079_0001548_13795_14532 | 245 |
| 567 | 3300049741 | Ga0501079_0004258 | Ga0501079_0004258_9255_9992 | 245 |
| 568 | 3300049741 | Ga0501079_0047343 | Ga0501079_0047343_2504_3241 | 245 |
| 569 | 3300049741 | Ga0501079_0138844 | Ga0501079_0138844_130_870 | 245 |
| 570 | 3300049742 | Ga0501080_0035335 | Ga0501080_0035335_30_770 | 245 |
| 571 | 3300049742 | Ga0501080_0048431 | Ga0501080_0048431_2139_2876 | 245 |
| 572 | 3300049742 | Ga0501080_0269885 | Ga0501080_0269885_763_1500 | 245 |
| 573 | 3300049742 | Ga0501080_0587591 | Ga0501080_0587591_21_770 | 245 |
| 574 | 3300049743 | Ga0501081_0002531 | Ga0501081_0002531_2201_2938 | 245 |
| 575 | 3300049743 | Ga0501081_0008158 | Ga0501081_0008158_5188_5925 | 245 |
| 576 | 3300049743 | Ga0501081_0031990 | Ga0501081_0031990_905_1705 | 245 |
| 577 | 3300049744 | Ga0501083_0002379 | Ga0501083_0002379_2614_3351 | 245 |
| 578 | 3300049744 | Ga0501083_0045895 | Ga0501083_0045895_588_1388 | 245 |
| 579 | 3300049822 | Ga0501035_0663252 | Ga0501035_0663252_74_811 | 245 |
| 580 | 3300049824 | Ga0501045_0000998 | Ga0501045_0000998_11093_11830 | 245 |
| 581 | 3300049824 | Ga0501045_0004584 | Ga0501045_0004584_2855_3592 | 245 |
| 582 | 3300049824 | Ga0501045_0155567 | Ga0501045_0155567_659_1399 | 245 |
| 583 | 3300050507 | nmdc:mga05p37_12174_c1 | nmdc:mga05p37_12174_c1_5860_6597 | 245 |
| 584 | 3300050507 | nmdc:mga05p37_207186_c1 | nmdc:mga05p37_207186_c1_1139_1876 | 245 |
| 585 | 3300050507 | nmdc:mga05p37_255932_c1 | nmdc:mga05p37_255932_c1_61_834 | 245 |
| 586 | 3300050507 | nmdc:mga05p37_300694_c1 | nmdc:mga05p37_300694_c1_1089_1832 | 245 |
| 587 | 3300050507 | nmdc:mga05p37_33356_c1 | nmdc:mga05p37_33356_c1_1961_2698 | 245 |
| 588 | 3300050507 | nmdc:mga05p37_52253_c1 | nmdc:mga05p37_52253_c1_1561_2298 | 245 |
| 589 | 3300050507 | nmdc:mga05p37_55835_c1 | nmdc:mga05p37_55835_c1_2935_3678 | 245 |
| 590 | 3300050507 | nmdc:mga05p37_73795_c1 | nmdc:mga05p37_73795_c1_746_1483 | 245 |
| 591 | 3300050508 | nmdc:mga09592_139170_c1 | nmdc:mga09592_139170_c1_86_835 | 245 |
| 592 | 3300050508 | nmdc:mga09592_70650_c1 | nmdc:mga09592_70650_c1_1321_2064 | 245 |
| 593 | 3300050509 | nmdc:mga0qj67_257075_c1 | nmdc:mga0qj67_257075_c1_20_769 | 245 |
| 594 | 3300050509 | nmdc:mga0qj67_276571_c1 | nmdc:mga0qj67_276571_c1_144_881 | 245 |
| 595 | 3300050510 | nmdc:mga06r32_237348_c1 | nmdc:mga06r32_237348_c1_36_785 | 245 |
| 596 | 3300050510 | nmdc:mga06r32_281584_c1 | nmdc:mga06r32_281584_c1_357_1094 | 245 |
| 597 | 3300050510 | nmdc:mga06r32_333008_c1 | nmdc:mga06r32_333008_c1_348_1088 | 245 |
| 598 | 3300050510 | nmdc:mga06r32_439739_c1 | nmdc:mga06r32_439739_c1_299_1039 | 245 |
| 599 | 3300050511 | nmdc:mga08y16_140101_c1 | nmdc:mga08y16_140101_c1_237_977 | 245 |
| 600 | 3300050511 | nmdc:mga08y16_275686_c1 | nmdc:mga08y16_275686_c1_466_1206 | 245 |
| 601 | 3300050511 | nmdc:mga08y16_513831_c1 | nmdc:mga08y16_513831_c1_91_834 | 245 |
| 602 | 3300050512 | nmdc:mga0n895_14081_c1 | nmdc:mga0n895_14081_c1_3438_4178 | 245 |
| 603 | 3300050512 | nmdc:mga0n895_22584_c1 | nmdc:mga0n895_22584_c1_1371_2108 | 245 |
| 604 | 3300050512 | nmdc:mga0n895_29591_c1 | nmdc:mga0n895_29591_c1_4136_4873 | 245 |
| 605 | 3300050512 | nmdc:mga0n895_42962_c1 | nmdc:mga0n895_42962_c1_1736_2476 | 245 |
| 606 | 3300050513 | nmdc:mga0rr50_2969_c1 | nmdc:mga0rr50_2969_c1_5174_5911 | 245 |
| 607 | 3300050513 | nmdc:mga0rr50_312593_c1 | nmdc:mga0rr50_312593_c1_202_942 | 245 |
| 608 | 3300050513 | nmdc:mga0rr50_3935_c1 | nmdc:mga0rr50_3935_c1_1875_2615 | 245 |
| 609 | 3300050513 | nmdc:mga0rr50_94333_c1 | nmdc:mga0rr50_94333_c1_1048_1791 | 245 |
| 610 | 3300050514 | nmdc:mga08x19_12943_c1 | nmdc:mga08x19_12943_c1_1126_1863 | 245 |
| 611 | 3300050515 | nmdc:mga0a205_160295_c1 | nmdc:mga0a205_160295_c1_548_1285 | 245 |
| 612 | 3300050515 | nmdc:mga0a205_259229_c1 | nmdc:mga0a205_259229_c1_729_1472 | 245 |
| 613 | 3300050515 | nmdc:mga0a205_2643_c1 | nmdc:mga0a205_2643_c1_8474_9211 | 245 |
| 614 | 3300050515 | nmdc:mga0a205_26945_c1 | nmdc:mga0a205_26945_c1_433_1173 | 245 |
| 615 | 3300054114 | Ga0501084_0013356 | Ga0501084_0013356_4533_5333 | 245 |
| 616 | 3300054114 | Ga0501084_0014517 | Ga0501084_0014517_3576_4313 | 245 |
| 617 | 3300054114 | Ga0501084_0027753 | Ga0501084_0027753_1227_1964 | 245 |
| 618 | 3300054114 | Ga0501084_0063021 | Ga0501084_0063021_1457_2194 | 245 |
| 619 | 3300054114 | Ga0501084_0454340 | Ga0501084_0454340_38_778 | 245 |
| 620 | 3300060353 | Ga0501082_0001040 | Ga0501082_0001040_12934_13671 | 245 |
| 621 | 3300060353 | Ga0501082_0001716 | Ga0501082_0001716_9344_10081 | 245 |
| 622 | 3300060353 | Ga0501082_0013358 | Ga0501082_0013358_552_1301 | 245 |
| 623 | 3300060353 | Ga0501082_0022856 | Ga0501082_0022856_1985_2722 | 245 |
| 624 | 3300060353 | Ga0501082_0043382 | Ga0501082_0043382_3020_3757 | 245 |
| 625 | 3300060353 | Ga0501082_0600677 | Ga0501082_0600677_200_937 | 245 |
| 626 | 3300061734 | Ga0530510_0005130 | Ga0530510_0005130_7191_7928 | 245 |
| 627 | 3300061734 | Ga0530510_0066115 | Ga0530510_0066115_1218_1955 | 245 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n71-assembly4.cif.gz_E | x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz | 0.7271 | 78 | 215 |
| 4mln-assembly2.cif.gz_B | crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid | 0.7244 | 78 | 215 |
| 4n6w-assembly1.cif.gz_A | x-ray crystal structure of citrate-bound phnz | 0.709 | 78 | 215 |
| 4mln-assembly1.cif.gz_A | crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid | 0.7089 | 78 | 215 |
| 4mlm-assembly3.cif.gz_A | crystal structure of phnz from uncultured bacterium hf130_aepn_1 | 0.7077 | 78 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7244 | 78 | 215 | 1.10.3210.10 |
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5628 | 78 | 215 | 1.10.3210.10 |
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5321 | 78 | 219 | 1.10.3210.10 |
| 3h37A03 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3883 | 74 | 196 | 1.20.58.1960 |
| af_K8ERU3_1293_1547_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3542 | 77 | 214 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6SUV3-F1-model_v4 | HD domain-containing protein | 0.9784 | 20 | 244 |
|
| AF-A0A2V6SUV3-F1-model_v4 | HD domain-containing protein | 0.9699 | 20 | 244 |
|
| AF-A0A534TMV5-F1-model_v4 | HD domain-containing protein | 0.9628 | 65 | 244 |
|
| AF-A0A537RAN6-F1-model_v4 | HD domain-containing protein | 0.9619 | 94 | 244 |
|
| AF-A0A383ECL3-F1-model_v4 | Uncharacterized protein | 0.9554 | 57 | 244 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar