F470557

General Info

Members Datasets Scaffolds Average Seq Length
627 256 1254 149

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10319046|Ga0114129_103190462
Length 178
Sequence MSCGFSLPPFGVPIAETRLSIRSGMTRTYELIYVLKPDASEGEVNDMHKQVAEVVERLGGKIDKTDNQMPWGRRKLAYEIGHHKEGFYVLETITGSGELMKEIDRRLRVTEGLLRHLIVRVDESTIRAERARAKRTEESRRRRVARGLPPDRQPGEGPQGENDDDSGDMMFDGADLEA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
159 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
165 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
166 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
167 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
168 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
174 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
227 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
228 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 2.87
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 20.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10319046 3300009147 Bacteria 2066
2 Ga0065714_10076672 3300005288 Unclassified 2766
3 Ga0065712_10003454 3300005290 Bacteria 5229
4 Ga0065712_10068756 3300005290 Bacteria 9137
5 Ga0065712_10072809 3300005290 Bacteria 4591
6 Ga0065715_10095716 3300005293 Bacteria 4020
7 Ga0065707_10139993 3300005295 Bacteria 1786
8 Ga0065707_10317449 3300005295 Bacteria 973
9 Ga0065707_10594841 3300005295 Bacteria 693
10 Ga0070683_100000094 3300005329 Bacteria 58242
11 Ga0070690_100112431 3300005330 Unclassified 1819
12 Ga0070670_100004478 3300005331 Bacteria 11706
13 Ga0070670_100008888 3300005331 Bacteria 8576
14 Ga0070670_100031102 3300005331 Unclassified 4597
15 Ga0070670_100849852 3300005331 Bacteria 826
16 Ga0070677_10039382 3300005333 Bacteria 1854
17 Ga0070677_10051830 3300005333 Bacteria 1663
18 Ga0070677_10405384 3300005333 Bacteria 720
19 Ga0070666_10027592 3300005335 Bacteria 3720
20 Ga0070666_10164040 3300005335 Unclassified 1553
21 Ga0070680_100232691 3300005336 Bacteria 1556
22 Ga0070680_100319542 3300005336 Bacteria 1318
23 Ga0070680_100686670 3300005336 Bacteria 881
24 Ga0068868_100567818 3300005338 Bacteria 1002
25 Ga0068868_101415927 3300005338 Bacteria 649
26 Ga0070660_100687092 3300005339 Unclassified 858
27 Ga0070689_100013543 3300005340 Bacteria 5904
28 Ga0070689_100553303 3300005340 Bacteria 992
29 Ga0070689_100937153 3300005340 Bacteria 768
30 Ga0070687_100112807 3300005343 Bacteria 1541
31 Ga0070687_100881332 3300005343 Bacteria 640
32 Ga0070661_100001504 3300005344 Bacteria 16216
33 Ga0070661_100221642 3300005344 Bacteria 1451
34 Ga0070661_101275114 3300005344 Bacteria 616
35 Ga0070692_10742338 3300005345 Bacteria 665
36 Ga0070668_100119754 3300005347 Unclassified 2103
37 Ga0070668_101015788 3300005347 Unclassified 746
38 Ga0070669_100001822 3300005353 Bacteria 15344
39 Ga0070669_100066685 3300005353 Unclassified 2653
40 Ga0070669_100122210 3300005353 Unclassified 1988
41 Ga0070669_100587884 3300005353 Unclassified 932
42 Ga0070669_101121560 3300005353 Bacteria 678
43 Ga0070675_100036403 3300005354 Bacteria 4005
44 Ga0070675_100112373 3300005354 Bacteria 2307
45 Ga0070675_100391707 3300005354 Unclassified 1238
46 Ga0070675_100395682 3300005354 Bacteria 1232
47 Ga0070675_100441104 3300005354 Bacteria 1166
48 Ga0070675_100614817 3300005354 Bacteria 986
49 Ga0070674_100524705 3300005356 Bacteria 990
50 Ga0070673_100001452 3300005364 Bacteria 13877
51 Ga0070673_100056097 3300005364 Bacteria 3106
52 Ga0070673_100630278 3300005364 Bacteria 980
53 Ga0070688_100012005 3300005365 Bacteria 4839
54 Ga0070688_100237812 3300005365 Bacteria 1291
55 Ga0070688_101505569 3300005365 Unclassified 548
56 Ga0070659_100381744 3300005366 Bacteria 1187
57 Ga0070667_100217984 3300005367 Unclassified 1698
58 Ga0070667_101368692 3300005367 Bacteria 664
59 Ga0070701_10049894 3300005438 Bacteria 2165
60 Ga0070701_10114757 3300005438 Bacteria 1510
61 Ga0070701_10207855 3300005438 Bacteria 1161
62 Ga0070711_101301305 3300005439 Bacteria 631
63 Ga0070700_100207781 3300005441 Bacteria 1379
64 Ga0070700_100359190 3300005441 Unclassified 1082
65 Ga0070700_100462626 3300005441 Bacteria 968
66 Ga0070700_100471741 3300005441 Bacteria 959
67 Ga0070700_100748888 3300005441 Bacteria 782
68 Ga0070694_100066348 3300005444 Bacteria 2476
69 Ga0070663_100031649 3300005455 Bacteria 3638
70 Ga0070663_100966692 3300005455 Bacteria 739
71 Ga0070678_100424413 3300005456 Bacteria 1160
72 Ga0070678_100490339 3300005456 Bacteria 1083
73 Ga0070662_100101790 3300005457 Bacteria 2175
74 Ga0070681_10306759 3300005458 Unclassified 1497
75 Ga0070681_10829821 3300005458 Unclassified 842
76 Ga0068867_100110944 3300005459 Bacteria 2107
77 Ga0068867_100962733 3300005459 Bacteria 772
78 Ga0070685_10674855 3300005466 Bacteria 751
79 Ga0070698_100061088 3300005471 Bacteria 3802
80 Ga0070699_101872595 3300005518 Bacteria 549
81 Ga0070684_100000166 3300005535 Bacteria 45212
82 Ga0070697_100855841 3300005536 Bacteria 806
83 Ga0068853_100555673 3300005539 Bacteria 1088
84 Ga0068853_101823449 3300005539 Bacteria 590
85 Ga0070672_100093466 3300005543 Bacteria 2429
86 Ga0070672_100381314 3300005543 Unclassified 1206
87 Ga0070686_100013945 3300005544 Bacteria 4616
88 Ga0070686_100046476 3300005544 Unclassified 2740
89 Ga0070686_100244630 3300005544 Bacteria 1308
90 Ga0070695_100539418 3300005545 Bacteria 908
91 Ga0070696_100464853 3300005546 Bacteria 1001
92 Ga0070693_100069719 3300005547 Bacteria 2067
93 Ga0070693_100165471 3300005547 Bacteria 1412
94 Ga0070665_100578360 3300005548 Bacteria 1136
95 Ga0070704_100180565 3300005549 Bacteria 1687
96 Ga0070704_101149022 3300005549 Unclassified 707
97 Ga0070664_100000479 3300005564 Bacteria 30222
98 Ga0070664_100236971 3300005564 Bacteria 1637
99 Ga0068857_100214085 3300005577 Bacteria 1759
100 Ga0068859_100029319 3300005617 Bacteria 5522
101 Ga0068859_100227740 3300005617 Bacteria 1952
102 Ga0068859_100495032 3300005617 Unclassified 1318
103 Ga0068859_100836877 3300005617 Unclassified 1007
104 Ga0068859_100861279 3300005617 Bacteria 992
105 Ga0068859_101978496 3300005617 Unclassified 644
106 Ga0068864_100016718 3300005618 Bacteria 6113
107 Ga0068864_100051188 3300005618 Unclassified 3557
108 Ga0068864_100498793 3300005618 Unclassified 1171
109 Ga0068861_100131526 3300005719 Bacteria 2031
110 Ga0068861_100464600 3300005719 Unclassified 1137
111 Ga0068861_101816525 3300005719 Bacteria 605
112 Ga0068870_10052773 3300005840 Bacteria 2157
113 Ga0068870_10135828 3300005840 Bacteria 1434
114 Ga0068870_10506236 3300005840 Bacteria 806
115 Ga0068863_101054231 3300005841 Unclassified 817
116 Ga0068863_101161866 3300005841 Unclassified 777
117 Ga0068858_100142793 3300005842 Unclassified 2248
118 Ga0068860_100075114 3300005843 Bacteria 3215
119 Ga0068860_100592012 3300005843 Bacteria 1114
120 Ga0068862_100003872 3300005844 Bacteria 12736
121 Ga0068862_100160769 3300005844 Bacteria 2005
122 Ga0068862_100591120 3300005844 Unclassified 1064
123 Ga0068862_100796479 3300005844 Bacteria 922
124 Ga0068862_101047260 3300005844 Bacteria 809
125 Ga0068862_101195630 3300005844 Unclassified 758
126 Ga0081539_10107959 3300005985 Bacteria 1407
127 Ga0075368_10062463 3300006042 Bacteria 1493
128 Ga0075368_10087176 3300006042 Bacteria 1274
129 Ga0075363_100185746 3300006048 Bacteria 1184
130 Ga0075364_10498334 3300006051 Bacteria 833
131 Ga0075362_10000807 3300006177 Bacteria 9348
132 Ga0075367_10021992 3300006178 Bacteria 3570
133 Ga0075367_10174876 3300006178 Bacteria 1338
134 Ga0075367_10223355 3300006178 Bacteria 1179
135 Ga0075366_10094996 3300006195 Bacteria 1787
136 Ga0068871_100916860 3300006358 Bacteria 813
137 Ga0075428_100005429 3300006844 Bacteria 14163
138 Ga0075428_100016351 3300006844 Bacteria 8199
139 Ga0075428_100807833 3300006844 Bacteria 997
140 Ga0075428_100920923 3300006844 Bacteria 927
141 Ga0075428_102299134 3300006844 Bacteria 555
142 Ga0075430_100008089 3300006846 Bacteria 8889
143 Ga0075430_100014194 3300006846 Bacteria 6790
144 Ga0075430_100028865 3300006846 Bacteria 4710
145 Ga0075430_100550398 3300006846 Bacteria 952
146 Ga0075430_100567582 3300006846 Unclassified 936
147 Ga0075431_100002210 3300006847 Bacteria 18638
148 Ga0075431_100003437 3300006847 Bacteria 15361
149 Ga0075431_100061459 3300006847 Bacteria 3876
150 Ga0075431_100143145 3300006847 Bacteria 2464
151 Ga0075431_100577399 3300006847 Bacteria 1110
152 Ga0075431_100590205 3300006847 Bacteria 1096
153 Ga0075431_101361150 3300006847 Bacteria 670
154 Ga0075433_10070067 3300006852 Bacteria 3081
155 Ga0075433_10267827 3300006852 Unclassified 1514
156 Ga0075433_10548851 3300006852 Bacteria 1016
157 Ga0075434_100014324 3300006871 Bacteria 7578
158 Ga0075434_100052504 3300006871 Bacteria 4050
159 Ga0075434_100360045 3300006871 Bacteria 1476
160 Ga0075434_101341517 3300006871 Bacteria 726
161 Ga0075429_100055901 3300006880 Bacteria 3435
162 Ga0075429_100136898 3300006880 Bacteria 2143
163 Ga0075429_100204162 3300006880 Bacteria 1732
164 Ga0075429_100234745 3300006880 Bacteria 1606
165 Ga0075429_100296123 3300006880 Bacteria 1417
166 Ga0075429_100323792 3300006880 Bacteria 1349
167 Ga0075429_100538817 3300006880 Bacteria 1023
168 Ga0075429_100659369 3300006880 Bacteria 917
169 Ga0097620_100029320 3300006931 Bacteria 5522
170 Ga0097620_100227760 3300006931 Bacteria 1952
171 Ga0097620_100495031 3300006931 Unclassified 1318
172 Ga0097620_100836873 3300006931 Unclassified 1007
173 Ga0097620_100861398 3300006931 Bacteria 992
174 Ga0097620_101978471 3300006931 Unclassified 644
175 Ga0075435_100118183 3300007076 Unclassified 2210
176 Ga0075435_100496711 3300007076 Bacteria 1055
177 Ga0075435_100650969 3300007076 Bacteria 915
178 Ga0111539_10001221 3300009094 Bacteria 34220
179 Ga0111539_10002763 3300009094 Bacteria 23280
180 Ga0111539_10007496 3300009094 Bacteria 13967
181 Ga0111539_10202525 3300009094 Bacteria 2314
182 Ga0111539_10209691 3300009094 Bacteria 2270
183 Ga0111539_10440993 3300009094 Bacteria 1516
184 Ga0111539_10452015 3300009094 Bacteria 1496
185 Ga0105245_10209996 3300009098 Bacteria 1873
186 Ga0114129_10001925 3300009147 Bacteria 28355
187 Ga0114129_10020336 3300009147 Bacteria 9444
188 Ga0114129_10039657 3300009147 Bacteria 6640
189 Ga0114129_10058610 3300009147 Bacteria 5386
190 Ga0114129_10132183 3300009147 Bacteria 3426
191 Ga0114129_10606915 3300009147 Bacteria 1417
192 Ga0114129_10928813 3300009147 Bacteria 1101
193 Ga0114129_11415120 3300009147 Bacteria 857
194 Ga0114129_12685367 3300009147 Bacteria 593
195 Ga0105243_10149366 3300009148 Unclassified 2003
196 Ga0105243_10552488 3300009148 Bacteria 1100
197 Ga0105243_10970258 3300009148 Bacteria 850
198 Ga0105243_11092610 3300009148 Bacteria 805
199 Ga0105243_12197940 3300009148 Unclassified 588
200 Ga0105248_10026969 3300009177 Bacteria 6389
201 Ga0105248_10138037 3300009177 Bacteria 2750
202 Ga0105237_10728344 3300009545 Unclassified 998
203 Ga0105249_10005969 3300009553 Bacteria 10554
204 Ga0105249_10258425 3300009553 Bacteria 1729
205 Ga0105249_10282402 3300009553 Bacteria 1658
206 Ga0105249_12415499 3300009553 Bacteria 598
207 Ga0105249_13136142 3300009553 Bacteria 531
208 Ga0105239_10852277 3300010375 Bacteria 1045
209 Ga0105246_10417715 3300011119 Bacteria 1118
210 Ga0105246_10435151 3300011119 Bacteria 1098
211 Ga0105246_10884805 3300011119 Unclassified 800
212 Ga0105246_11600570 3300011119 Bacteria 616
213 Ga0157378_10980462 3300013297 Bacteria 879
214 Ga0163162_10590344 3300013306 Bacteria 1237
215 Ga0157372_11963887 3300013307 Bacteria 672
216 Ga0157375_10445981 3300013308 Bacteria 1460
217 Ga0157375_11233740 3300013308 Bacteria 878
218 Ga0157375_11686537 3300013308 Bacteria 750
219 Ga0163163_10023433 3300014325 Bacteria 5860
220 Ga0163163_10451186 3300014325 Bacteria 1346
221 Ga0157380_10021536 3300014326 Bacteria 4836
222 Ga0157380_10030172 3300014326 Bacteria 4151
223 Ga0157380_10035132 3300014326 Bacteria 3870
224 Ga0157380_10120349 3300014326 Unclassified 2223
225 Ga0157380_10377452 3300014326 Bacteria 1337
226 Ga0157380_10514449 3300014326 Bacteria 1166
227 Ga0157380_10915155 3300014326 Bacteria 904
228 Ga0157380_12882337 3300014326 Bacteria 547
229 Ga0157377_10068750 3300014745 Unclassified 2042
230 Ga0157377_10322163 3300014745 Unclassified 1027
231 Ga0157377_11268190 3300014745 Unclassified 574
232 Ga0157376_10510336 3300014969 Bacteria 1183
233 Ga0157376_11810919 3300014969 Bacteria 647
234 Ga0163161_10322872 3300017792 Bacteria 1221
235 Ga0206352_10288250 3300020078 Bacteria 749
236 Ga0207666_1023119 3300025271 Bacteria 924
237 Ga0207697_10011895 3300025315 Bacteria 3667
238 Ga0207682_10032808 3300025893 Bacteria 2088
239 Ga0207682_10471105 3300025893 Unclassified 595
240 Ga0207680_10083249 3300025903 Unclassified 2016
241 Ga0207680_10413520 3300025903 Bacteria 954
242 Ga0207643_10025731 3300025908 Bacteria 3255
243 Ga0207643_10036423 3300025908 Bacteria 2759
244 Ga0207643_10168925 3300025908 Bacteria 1319
245 Ga0207707_10319318 3300025912 Bacteria 1341
246 Ga0207660_10126412 3300025917 Bacteria 1942
247 Ga0207660_10185050 3300025917 Bacteria 1620
248 Ga0207660_10267720 3300025917 Archaea 1353
249 Ga0207662_10086532 3300025918 Bacteria 1921
250 Ga0207662_10331020 3300025918 Unclassified 1019
251 Ga0207649_10010919 3300025920 Bacteria 4994
252 Ga0207649_10099179 3300025920 Bacteria 1924
253 Ga0207649_11078307 3300025920 Bacteria 633
254 Ga0207681_10004627 3300025923 Bacteria 8460
255 Ga0207681_10062026 3300025923 Unclassified 2572
256 Ga0207681_10145322 3300025923 Unclassified 1771
257 Ga0207681_10594733 3300025923 Unclassified 914
258 Ga0207650_10014293 3300025925 Bacteria 5515
259 Ga0207650_10292077 3300025925 Bacteria 1329
260 Ga0207650_10328838 3300025925 Bacteria 1253
261 Ga0207650_10459461 3300025925 Unclassified 1060
262 Ga0207659_10006771 3300025926 Bacteria 7042
263 Ga0207659_10035597 3300025926 Bacteria 3442
264 Ga0207659_10057016 3300025926 Unclassified 2799
265 Ga0207659_10372245 3300025926 Bacteria 1190
266 Ga0207644_10762059 3300025931 Bacteria 809
267 Ga0207690_10069385 3300025932 Bacteria 2425
268 Ga0207706_10211730 3300025933 Unclassified 1699
269 Ga0207706_11272472 3300025933 Unclassified 609
270 Ga0207709_10665376 3300025935 Bacteria 830
271 Ga0207670_10169628 3300025936 Bacteria 1635
272 Ga0207670_11513942 3300025936 Bacteria 570
273 Ga0207704_10513657 3300025938 Unclassified 968
274 Ga0207691_10065061 3300025940 Bacteria 3302
275 Ga0207691_10076125 3300025940 Bacteria 3024
276 Ga0207691_10150655 3300025940 Bacteria 2045
277 Ga0207691_10593140 3300025940 Bacteria 938
278 Ga0207711_10044920 3300025941 Bacteria 3773
279 Ga0207711_10326178 3300025941 Bacteria 1419
280 Ga0207711_10976720 3300025941 Unclassified 786
281 Ga0207661_10090080 3300025944 Bacteria 2553
282 Ga0207679_10002245 3300025945 Bacteria 11932
283 Ga0207679_10051895 3300025945 Bacteria 3005
284 Ga0207679_10226441 3300025945 Bacteria 1576
285 Ga0207679_10766629 3300025945 Bacteria 878
286 Ga0207679_11372028 3300025945 Bacteria 649
287 Ga0207651_10042760 3300025960 Unclassified 3018
288 Ga0207651_11030766 3300025960 Bacteria 736
289 Ga0207712_10038469 3300025961 Bacteria 3272
290 Ga0207712_10223660 3300025961 Bacteria 1506
291 Ga0207712_10328890 3300025961 Bacteria 1264
292 Ga0207668_10815992 3300025972 Bacteria 826
293 Ga0207668_10820605 3300025972 Unclassified 824
294 Ga0207658_10662500 3300025986 Bacteria 941
295 Ga0207658_11104533 3300025986 Unclassified 724
296 Ga0207703_10109772 3300026035 Unclassified 2352
297 Ga0207639_11138195 3300026041 Bacteria 732
298 Ga0207678_10040510 3300026067 Bacteria 4040
299 Ga0207678_10605629 3300026067 Bacteria 960
300 Ga0207678_10849482 3300026067 Bacteria 807
301 Ga0207708_10241565 3300026075 Bacteria 1453
302 Ga0207708_10323838 3300026075 Bacteria 1258
303 Ga0207708_10525360 3300026075 Bacteria 995
304 Ga0207708_10675148 3300026075 Unclassified 881
305 Ga0207641_10566450 3300026088 Bacteria 1109
306 Ga0207641_10796165 3300026088 Bacteria 935
307 Ga0207641_12589981 3300026088 Unclassified 505
308 Ga0207648_10112008 3300026089 Bacteria 2396
309 Ga0207648_10123446 3300026089 Bacteria 2277
310 Ga0207648_10609073 3300026089 Unclassified 1007
311 Ga0207648_10859992 3300026089 Bacteria 846
312 Ga0207676_10175862 3300026095 Bacteria 1869
313 Ga0207676_10250448 3300026095 Unclassified 1594
314 Ga0207676_10806759 3300026095 Bacteria 916
315 Ga0207674_10279677 3300026116 Bacteria 1617
316 Ga0207674_10789733 3300026116 Unclassified 916
317 Ga0207674_11505233 3300026116 Bacteria 642
318 Ga0207675_100047032 3300026118 Bacteria 4030
319 Ga0207675_100810719 3300026118 Bacteria 950
320 Ga0207675_101913856 3300026118 Unclassified 611
321 Ga0207683_10116393 3300026121 Bacteria 2396
322 Ga0207683_10279576 3300026121 Unclassified 1525
323 Ga0207683_10551978 3300026121 Bacteria 1065
324 Ga0207698_11321603 3300026142 Bacteria 736
325 Ga0209983_1103026 3300027665 Bacteria 647
326 Ga0209813_10092021 3300027866 Bacteria 1019
327 Ga0207428_10000515 3300027907 Bacteria 46261
328 Ga0207428_10004630 3300027907 Bacteria 13038
329 Ga0207428_10005890 3300027907 Bacteria 11357
330 Ga0207428_10018539 3300027907 Bacteria 5942
331 Ga0207428_10183358 3300027907 Bacteria 1581
332 Ga0207428_10479186 3300027907 Unclassified 905
333 Ga0268265_10112537 3300028380 Bacteria 2225
334 Ga0268265_10167768 3300028380 Bacteria 1873
335 Ga0268265_10894654 3300028380 Bacteria 871
336 Ga0268265_10941703 3300028380 Unclassified 850
337 Ga0268265_11321373 3300028380 Bacteria 721
338 Ga0268265_11666398 3300028380 Unclassified 643
339 Ga0268264_10963560 3300028381 Bacteria 859
340 Ga0316182_1189504 3300030745 Bacteria 823
341 Ga0307408_100257486 3300031548 Unclassified 1442
342 Ga0307408_100993425 3300031548 Unclassified 773
343 Ga0307408_101735160 3300031548 Bacteria 595
344 Ga0307405_10078180 3300031731 Unclassified 2152
345 Ga0307413_10045019 3300031824 Bacteria 2612
346 Ga0307413_10356070 3300031824 Bacteria 1131
347 Ga0307410_10014419 3300031852 Bacteria 4650
348 Ga0307410_10028237 3300031852 Bacteria 3556
349 Ga0307410_10701036 3300031852 Bacteria 853
350 Ga0307406_10111624 3300031901 Bacteria 1884
351 Ga0307406_10376319 3300031901 Unclassified 1118
352 Ga0307407_10047779 3300031903 Bacteria 2432
353 Ga0307407_10297077 3300031903 Bacteria 1125
354 Ga0307412_10415285 3300031911 Unclassified 1099
355 Ga0307409_100049813 3300031995 Bacteria 3196
356 Ga0307409_100086388 3300031995 Bacteria 2553
357 Ga0307409_100125645 3300031995 Bacteria 2181
358 Ga0307409_100271195 3300031995 Bacteria 1563
359 Ga0307409_100771776 3300031995 Bacteria 967
360 Ga0307409_101215918 3300031995 Unclassified 777
361 Ga0307409_101486771 3300031995 Unclassified 705
362 Ga0307416_100039078 3300032002 Bacteria 3669
363 Ga0307416_100078896 3300032002 Bacteria 2773
364 Ga0307416_100112244 3300032002 Bacteria 2405
365 Ga0307416_100547463 3300032002 Bacteria 1230
366 Ga0307416_101025004 3300032002 Bacteria 929
367 Ga0307416_101118099 3300032002 Bacteria 893
368 Ga0307416_103357182 3300032002 Unclassified 536
369 Ga0307414_10020289 3300032004 Bacteria 4140
370 Ga0307411_10108351 3300032005 Bacteria 1982
371 Ga0307411_10232245 3300032005 Bacteria 1438
372 Ga0307411_10749526 3300032005 Bacteria 855
373 Ga0307411_11308838 3300032005 Unclassified 660
374 Ga0307415_100027564 3300032126 Bacteria 3601
375 Ga0373932_0152927 3300035112 Bacteria 793
376 Ga0373941_0089657 3300035115 Bacteria 1053
377 Ga0439436_0114180 3300041404 Unclassified 754
378 Ga0439439_0097025 3300041406 Bacteria 809
379 Ga0451793_0400625 3300041452 Unclassified 725
380 Ga0451800_0253441 3300041459 Bacteria 846
381 Ga0451802_1238844 3300041460 Unclassified 656
382 Ga0451807_2259494 3300041486 Bacteria 774
383 Ga0451851_0852380 3300041507 Bacteria 674
384 Ga0451853_1556311 3300041512 Bacteria 1044
385 Ga0439431_0082086 3300041997 Unclassified 870
386 Ga0439431_0137618 3300041997 Unclassified 688
387 Ga0439441_013191 3300042001 Bacteria 1431
388 Ga0439443_047914 3300042003 Unclassified 742
389 Ga0439445_0035426 3300042004 Bacteria 1311
390 Ga0439449_0323650 3300042007 Bacteria 583
391 Ga0439450_072441 3300042008 Bacteria 847
392 Ga0439462_0027089 3300042015 Bacteria 1512
393 Ga0439462_0037506 3300042015 Bacteria 1291
394 Ga0439462_0054389 3300042015 Bacteria 1079
395 Ga0450917_012676 3300042120 Unclassified 688
396 Ga0450920_049653 3300042122 Unclassified 841
397 Ga0450920_133384 3300042122 Bacteria 524
398 Ga0450896_032480 3300042133 Bacteria 794
399 Ga0450898_020604 3300042134 Bacteria 1157
400 Ga0450907_047640 3300042146 Bacteria 736
401 Ga0439446_0011335 3300042156 Bacteria 2419
402 Ga0439446_0045117 3300042156 Bacteria 1306
403 Ga0439446_0050601 3300042156 Bacteria 1240
404 Ga0439434_0023326 3300042435 Bacteria 1862
405 Ga0439434_0040837 3300042435 Bacteria 1425
406 Ga0439435_0015406 3300042436 Bacteria 1903
407 Ga0439460_0015508 3300042461 Bacteria 2019
408 Ga0439460_0015632 3300042461 Bacteria 2012
409 Ga0450916_004461 3300042530 Bacteria 1580
410 Ga0450918_017799 3300042531 Bacteria 1238
411 Ga0451577_0030854 3300042876 Bacteria 4840
412 Ga0439440_0179006 3300042993 Bacteria 620
413 Ga0453684_0076262 3300044712 Bacteria 4210
414 Ga0495641_0363052 3300046461 Bacteria 655
415 Ga0495594_0006412 3300046499 Bacteria 6051
416 Ga0495630_0365918 3300046517 Bacteria 1104
417 Ga0495631_0331554 3300046518 Bacteria 648
418 Ga0495643_0004858 3300046522 Bacteria 9258
419 Ga0495663_0148394 3300046525 Unclassified 799
420 Ga0495640_0275940 3300046533 Bacteria 1048
421 Ga0495598_0294041 3300046537 Bacteria 613
422 Ga0495621_0003200 3300046539 Bacteria 4493
423 Ga0495621_0120794 3300046539 Bacteria 1012
424 Ga0495656_0053832 3300046615 Unclassified 1730
425 Ga0495659_0143685 3300046664 Bacteria 954
426 Ga0495599_0685939 3300046678 Bacteria 591
427 Ga0495658_0063586 3300046683 Bacteria 2124
428 Ga0495658_0121754 3300046683 Bacteria 1579
429 Ga0495658_0328815 3300046683 Bacteria 970
430 Ga0495669_0370322 3300046684 Unclassified 693
431 Ga0496101_0822320 3300048904 Bacteria 732
432 Ga0496102_0311733 3300048905 Bacteria 1483
433 Ga0496104_0003182 3300048907 Bacteria 14111
434 Ga0496105_0043898 3300048908 Bacteria 3687
435 Ga0496106_0988144 3300048909 Bacteria 662
436 Ga0496108_0046024 3300048911 Bacteria 3644
437 Ga0496109_0000869 3300048912 Bacteria 25170
438 Ga0496109_0650698 3300048912 Bacteria 991
439 Ga0496110_0009331 3300048913 Bacteria 7939
440 Ga0496110_0985823 3300048913 Unclassified 750
441 Ga0496111_0007522 3300048914 Bacteria 7148
442 Ga0496112_0000918 3300048915 Bacteria 21281
443 Ga0496113_0014536 3300048916 Bacteria 5374
444 Ga0496114_0631563 3300048917 Unclassified 943
445 Ga0501296_043737 3300049519 Bacteria 639
446 Ga0501031_0045213 3300049568 Bacteria 2873
447 Ga0501031_0419350 3300049568 Bacteria 865
448 Ga0501031_0962595 3300049568 Unclassified 546
449 Ga0501033_0180785 3300049570 Bacteria 1512
450 Ga0501033_0273618 3300049570 Unclassified 1193
451 Ga0501033_0673930 3300049570 Bacteria 705
452 Ga0501036_0108720 3300049572 Bacteria 2344
453 Ga0501036_0285378 3300049572 Unclassified 1381
454 Ga0501036_0287459 3300049572 Bacteria 1376
455 Ga0501036_0541507 3300049572 Bacteria 968
456 Ga0501038_0077419 3300049574 Bacteria 2808
457 Ga0501038_1036445 3300049574 Bacteria 601
458 Ga0501039_0018193 3300049575 Bacteria 5394
459 Ga0501039_0043886 3300049575 Bacteria 3454
460 Ga0501039_0616218 3300049575 Viruses 850
461 Ga0501040_0006238 3300049576 Bacteria 7740
462 Ga0501040_0082085 3300049576 Bacteria 2234
463 Ga0501040_0295052 3300049576 Unclassified 1159
464 Ga0501040_0615794 3300049576 Bacteria 784
465 Ga0501040_0620241 3300049576 Unclassified 781
466 Ga0501041_0059897 3300049577 Bacteria 2330
467 Ga0501041_0156035 3300049577 Unclassified 1426
468 Ga0501041_0296755 3300049577 Viruses 1018
469 Ga0501041_0318900 3300049577 Bacteria 980
470 Ga0501041_0556970 3300049577 Bacteria 731
471 Ga0501042_0023695 3300049578 Bacteria 4298
472 Ga0501042_0076184 3300049578 Bacteria 2401
473 Ga0501042_0096327 3300049578 Unclassified 2126
474 Ga0501042_0225790 3300049578 Bacteria 1351
475 Ga0501042_0343744 3300049578 Bacteria 1079
476 Ga0501042_0438623 3300049578 Bacteria 947
477 Ga0501042_0490406 3300049578 Viruses 892
478 Ga0501046_0111766 3300049580 Unclassified 2086
479 Ga0501046_0417805 3300049580 Bacteria 967
480 Ga0501047_0098709 3300049581 Bacteria 2799
481 Ga0501048_0048914 3300049582 Unclassified 3015
482 Ga0501048_0271632 3300049582 Bacteria 1205
483 Ga0501048_0325143 3300049582 Bacteria 1096
484 Ga0501048_0641104 3300049582 Viruses 763
485 Ga0501048_0699887 3300049582 Bacteria 728
486 Ga0501067_0039899 3300049583 Bacteria 2607
487 Ga0501069_0036837 3300049585 Bacteria 2699
488 Ga0501069_0266934 3300049585 Bacteria 1000
489 Ga0501069_0556097 3300049585 Bacteria 687
490 Ga0501070_0230990 3300049586 Bacteria 1516
491 Ga0501071_0019912 3300049587 Bacteria 4660
492 Ga0501071_0071518 3300049587 Unclassified 2529
493 Ga0501071_0092378 3300049587 Bacteria 2224
494 Ga0501071_0103155 3300049587 Bacteria 2104
495 Ga0501071_0184435 3300049587 Bacteria 1564
496 Ga0501071_0197551 3300049587 Unclassified 1510
497 Ga0501071_0225145 3300049587 Viruses 1412
498 Ga0501071_0401869 3300049587 Bacteria 1046
499 Ga0501071_1109621 3300049587 Bacteria 611
500 Ga0501072_0027575 3300049588 Bacteria 4431
501 Ga0501072_0082110 3300049588 Bacteria 2555
502 Ga0501072_0105062 3300049588 Bacteria 2246
503 Ga0501072_0466031 3300049588 Viruses 1000
504 Ga0501072_1309220 3300049588 Bacteria 561
505 Ga0501073_0007964 3300049589 Bacteria 7864
506 Ga0501074_0144387 3300049590 Bacteria 1702
507 Ga0501075_0039445 3300049591 Bacteria 3535
508 Ga0501075_0114938 3300049591 Bacteria 2046
509 Ga0501075_0274999 3300049591 Bacteria 1283
510 Ga0501076_0030800 3300049592 Bacteria 4180
511 Ga0501076_0042506 3300049592 Bacteria 3578
512 Ga0501076_0068512 3300049592 Bacteria 2834
513 Ga0501076_0114977 3300049592 Unclassified 2177
514 Ga0501076_0264023 3300049592 Unclassified 1410
515 Ga0501076_1004853 3300049592 Bacteria 687
516 Ga0501077_0089653 3300049593 Unclassified 1949
517 Ga0501077_0166409 3300049593 Unclassified 1401
518 Ga0501077_0214345 3300049593 Bacteria 1224
519 Ga0501077_0215864 3300049593 Viruses 1219
520 Ga0501240_052352 3300049673 Bacteria 703
521 Ga0501249_037638 3300049679 Bacteria 1092
522 Ga0501245_058692 3300049708 Bacteria 699
523 Ga0501079_0043660 3300049741 Bacteria 3461
524 Ga0501079_0049299 3300049741 Bacteria 3250
525 Ga0501079_0129335 3300049741 Bacteria 1965
526 Ga0501079_0165070 3300049741 Bacteria 1727
527 Ga0501079_0194046 3300049741 Unclassified 1585
528 Ga0501079_0209303 3300049741 Bacteria 1523
529 Ga0501079_0281972 3300049741 Bacteria 1299
530 Ga0501079_0767868 3300049741 Bacteria 759
531 Ga0501079_0912079 3300049741 Bacteria 692
532 Ga0501079_0957240 3300049741 Bacteria 674
533 Ga0501079_1482749 3300049741 Unclassified 534
534 Ga0501080_0336229 3300049742 Viruses 1365
535 Ga0501080_1097006 3300049742 Bacteria 687
536 Ga0501081_0163993 3300049743 Bacteria 1602
537 Ga0501081_0248746 3300049743 Unclassified 1297
538 Ga0501081_0290481 3300049743 Bacteria 1198
539 Ga0501081_0442450 3300049743 Bacteria 965
540 Ga0501083_0643375 3300049744 Unclassified 690
541 Ga0501283_005691 3300049779 Bacteria 1722
542 Ga0501035_0270977 3300049822 Unclassified 1437
543 Ga0501035_0340561 3300049822 Bacteria 1257
544 Ga0501035_0416370 3300049822 Bacteria 1116
545 Ga0501035_0572398 3300049822 Bacteria 923
546 Ga0501045_0007609 3300049824 Bacteria 7529
547 Ga0501045_0018171 3300049824 Bacteria 4997
548 Ga0501045_0025539 3300049824 Bacteria 4248
549 Ga0501045_0131448 3300049824 Unclassified 1861
550 nmdc:mga03n38_157859_c1 3300050490 Bacteria 1146
551 nmdc:mga03n38_200613_c1 3300050490 Bacteria 1032
552 nmdc:mga00v17_404207_c1 3300050491 Bacteria 887
553 nmdc:mga00v17_66432_c1 3300050491 Bacteria 2227
554 nmdc:mga0yw44_279189_c1 3300050492 Bacteria 1116
555 nmdc:mga0k408_311991_c1 3300050493 Bacteria 939
556 nmdc:mga06z11_145600_c1 3300050494 Unclassified 1342
557 nmdc:mga06z11_54092_c1 3300050494 Bacteria 2068
558 nmdc:mga04h51_10272_c1 3300050495 Bacteria 2567
559 nmdc:mga04h51_108828_c1 3300050495 Bacteria 1019
560 nmdc:mga05p37_101486_c1 3300050507 Bacteria 3543
561 nmdc:mga05p37_10752_c1 3300050507 Bacteria 10865
562 nmdc:mga05p37_1228458_c1 3300050507 Bacteria 771
563 nmdc:mga05p37_129664_c1 3300050507 Bacteria 3094
564 nmdc:mga05p37_251244_c1 3300050507 Unclassified 2121
565 nmdc:mga05p37_38671_c1 3300050507 Bacteria 5854
566 nmdc:mga05p37_79286_c1 3300050507 Bacteria 4044
567 nmdc:mga09592_126177_c1 3300050508 Bacteria 2200
568 nmdc:mga09592_160001_c1 3300050508 Bacteria 1945
569 nmdc:mga09592_1602065_c1 3300050508 Unclassified 527
570 nmdc:mga09592_243342_c1 3300050508 Unclassified 1559
571 nmdc:mga09592_282778_c1 3300050508 Bacteria 1439
572 nmdc:mga09592_283113_c1 3300050508 Bacteria 1438
573 nmdc:mga09592_325420_c1 3300050508 Viruses 1331
574 nmdc:mga09592_421095_c1 3300050508 Bacteria 1153
575 nmdc:mga09592_519073_c1 3300050508 Bacteria 1025
576 nmdc:mga09592_98676_c1 3300050508 Bacteria 2501
577 nmdc:mga0qj67_11170_c1 3300050509 Bacteria 6725
578 nmdc:mga0qj67_2637_c1 3300050509 Bacteria 12848
579 nmdc:mga0qj67_33100_c1 3300050509 Bacteria 4033
580 nmdc:mga0qj67_774557_c1 3300050509 Unclassified 760
581 nmdc:mga06r32_16241_c1 3300050510 Bacteria 6781
582 nmdc:mga06r32_280387_c1 3300050510 Bacteria 1654
583 nmdc:mga06r32_43448_c1 3300050510 Bacteria 4276
584 nmdc:mga06r32_47914_c1 3300050510 Bacteria 4084
585 nmdc:mga08y16_1223978_c1 3300050511 Unclassified 721
586 nmdc:mga08y16_202909_c1 3300050511 Bacteria 2055
587 nmdc:mga08y16_25255_c1 3300050511 Bacteria 6265
588 nmdc:mga08y16_253085_c1 3300050511 Unclassified 1820
589 nmdc:mga08y16_532012_c1 3300050511 Bacteria 1191
590 nmdc:mga08y16_554613_c1 3300050511 Bacteria 1163
591 nmdc:mga08y16_65053_c1 3300050511 Unclassified 3807
592 nmdc:mga08y16_7358_c1 3300050511 Bacteria 11548
593 nmdc:mga08y16_74127_c1 3300050511 Bacteria 3546
594 nmdc:mga08y16_87_c1 3300050511 Bacteria 77764
595 nmdc:mga0n895_13885_c1 3300050512 Bacteria 7292
596 nmdc:mga0n895_1471829_c1 3300050512 Bacteria 648
597 nmdc:mga0n895_1741084_c1 3300050512 Unclassified 585
598 nmdc:mga0n895_360997_c1 3300050512 Bacteria 1471
599 nmdc:mga0n895_97918_c1 3300050512 Bacteria 2939
600 nmdc:mga0rr50_132830_c1 3300050513 Bacteria 1995
601 nmdc:mga0rr50_432356_c1 3300050513 Bacteria 1114
602 nmdc:mga0rr50_482916_c1 3300050513 Unclassified 1052
603 nmdc:mga0rr50_483320_c1 3300050513 Bacteria 1052
604 nmdc:mga0a205_43843_c1 3300050515 Bacteria 4312
605 nmdc:mga0a205_546647_c1 3300050515 Bacteria 1013
606 nmdc:mga0a205_716753_c1 3300050515 Bacteria 850
607 nmdc:mga0a205_76883_c2 3300050515 Bacteria 2779
608 Ga0500646_0037578 3300053090 Unclassified 1353
609 Ga0500652_314779 3300053131 Unclassified 601
610 Ga0500568_0003412 3300053139 Bacteria 8870
611 Ga0501084_0018012 3300054114 Bacteria 5882
612 Ga0501084_0034476 3300054114 Bacteria 4233
613 Ga0501084_0314081 3300054114 Unclassified 1323
614 Ga0501084_0488725 3300054114 Bacteria 1040
615 Ga0501084_0974216 3300054114 Bacteria 713
616 Ga0590071_123578 3300059421 Bacteria 662
617 Ga0501082_0007448 3300060353 Bacteria 9445
618 Ga0501082_0044348 3300060353 Bacteria 3836
619 Ga0501082_0191927 3300060353 Bacteria 1777
620 Ga0501082_0255035 3300060353 Bacteria 1526
621 Ga0501082_1342520 3300060353 Unclassified 625
622 Ga0530510_0001585 3300061734 Bacteria 15338
623 Ga0530510_0263447 3300061734 Viruses 1286
624 Ga0530510_0415488 3300061734 Bacteria 1015
625 Ga0530510_0595950 3300061734 Bacteria 840
626 Ga0530510_1268441 3300061734 Unclassified 565
627 Ga0530510_1423717 3300061734 Unclassified 532
628 Ga0114129_10319046
629 Ga0065714_10076672
630 Ga0065712_10003454
631 Ga0065712_10068756
632 Ga0065712_10072809
633 Ga0065715_10095716
634 Ga0065707_10139993
635 Ga0065707_10317449
636 Ga0065707_10594841
637 Ga0070683_100000094
638 Ga0070690_100112431
639 Ga0070670_100004478
640 Ga0070670_100008888
641 Ga0070670_100031102
642 Ga0070670_100849852
643 Ga0070677_10039382
644 Ga0070677_10051830
645 Ga0070677_10405384
646 Ga0070666_10027592
647 Ga0070666_10164040
648 Ga0070680_100232691
649 Ga0070680_100319542
650 Ga0070680_100686670
651 Ga0068868_100567818
652 Ga0068868_101415927
653 Ga0070660_100687092
654 Ga0070689_100013543
655 Ga0070689_100553303
656 Ga0070689_100937153
657 Ga0070687_100112807
658 Ga0070687_100881332
659 Ga0070661_100001504
660 Ga0070661_100221642
661 Ga0070661_101275114
662 Ga0070692_10742338
663 Ga0070668_100119754
664 Ga0070668_101015788
665 Ga0070669_100001822
666 Ga0070669_100066685
667 Ga0070669_100122210
668 Ga0070669_100587884
669 Ga0070669_101121560
670 Ga0070675_100036403
671 Ga0070675_100112373
672 Ga0070675_100391707
673 Ga0070675_100395682
674 Ga0070675_100441104
675 Ga0070675_100614817
676 Ga0070674_100524705
677 Ga0070673_100001452
678 Ga0070673_100056097
679 Ga0070673_100630278
680 Ga0070688_100012005
681 Ga0070688_100237812
682 Ga0070688_101505569
683 Ga0070659_100381744
684 Ga0070667_100217984
685 Ga0070667_101368692
686 Ga0070701_10049894
687 Ga0070701_10114757
688 Ga0070701_10207855
689 Ga0070711_101301305
690 Ga0070700_100207781
691 Ga0070700_100359190
692 Ga0070700_100462626
693 Ga0070700_100471741
694 Ga0070700_100748888
695 Ga0070694_100066348
696 Ga0070663_100031649
697 Ga0070663_100966692
698 Ga0070678_100424413
699 Ga0070678_100490339
700 Ga0070662_100101790
701 Ga0070681_10306759
702 Ga0070681_10829821
703 Ga0068867_100110944
704 Ga0068867_100962733
705 Ga0070685_10674855
706 Ga0070698_100061088
707 Ga0070699_101872595
708 Ga0070684_100000166
709 Ga0070697_100855841
710 Ga0068853_100555673
711 Ga0068853_101823449
712 Ga0070672_100093466
713 Ga0070672_100381314
714 Ga0070686_100013945
715 Ga0070686_100046476
716 Ga0070686_100244630
717 Ga0070695_100539418
718 Ga0070696_100464853
719 Ga0070693_100069719
720 Ga0070693_100165471
721 Ga0070665_100578360
722 Ga0070704_100180565
723 Ga0070704_101149022
724 Ga0070664_100000479
725 Ga0070664_100236971
726 Ga0068857_100214085
727 Ga0068859_100029319
728 Ga0068859_100227740
729 Ga0068859_100495032
730 Ga0068859_100836877
731 Ga0068859_100861279
732 Ga0068859_101978496
733 Ga0068864_100016718
734 Ga0068864_100051188
735 Ga0068864_100498793
736 Ga0068861_100131526
737 Ga0068861_100464600
738 Ga0068861_101816525
739 Ga0068870_10052773
740 Ga0068870_10135828
741 Ga0068870_10506236
742 Ga0068863_101054231
743 Ga0068863_101161866
744 Ga0068858_100142793
745 Ga0068860_100075114
746 Ga0068860_100592012
747 Ga0068862_100003872
748 Ga0068862_100160769
749 Ga0068862_100591120
750 Ga0068862_100796479
751 Ga0068862_101047260
752 Ga0068862_101195630
753 Ga0081539_10107959
754 Ga0075368_10062463
755 Ga0075368_10087176
756 Ga0075363_100185746
757 Ga0075364_10498334
758 Ga0075362_10000807
759 Ga0075367_10021992
760 Ga0075367_10174876
761 Ga0075367_10223355
762 Ga0075366_10094996
763 Ga0068871_100916860
764 Ga0075428_100005429
765 Ga0075428_100016351
766 Ga0075428_100807833
767 Ga0075428_100920923
768 Ga0075428_102299134
769 Ga0075430_100008089
770 Ga0075430_100014194
771 Ga0075430_100028865
772 Ga0075430_100550398
773 Ga0075430_100567582
774 Ga0075431_100002210
775 Ga0075431_100003437
776 Ga0075431_100061459
777 Ga0075431_100143145
778 Ga0075431_100577399
779 Ga0075431_100590205
780 Ga0075431_101361150
781 Ga0075433_10070067
782 Ga0075433_10267827
783 Ga0075433_10548851
784 Ga0075434_100014324
785 Ga0075434_100052504
786 Ga0075434_100360045
787 Ga0075434_101341517
788 Ga0075429_100055901
789 Ga0075429_100136898
790 Ga0075429_100204162
791 Ga0075429_100234745
792 Ga0075429_100296123
793 Ga0075429_100323792
794 Ga0075429_100538817
795 Ga0075429_100659369
796 Ga0097620_100029320
797 Ga0097620_100227760
798 Ga0097620_100495031
799 Ga0097620_100836873
800 Ga0097620_100861398
801 Ga0097620_101978471
802 Ga0075435_100118183
803 Ga0075435_100496711
804 Ga0075435_100650969
805 Ga0111539_10001221
806 Ga0111539_10002763
807 Ga0111539_10007496
808 Ga0111539_10202525
809 Ga0111539_10209691
810 Ga0111539_10440993
811 Ga0111539_10452015
812 Ga0105245_10209996
813 Ga0114129_10001925
814 Ga0114129_10020336
815 Ga0114129_10039657
816 Ga0114129_10058610
817 Ga0114129_10132183
818 Ga0114129_10606915
819 Ga0114129_10928813
820 Ga0114129_11415120
821 Ga0114129_12685367
822 Ga0105243_10149366
823 Ga0105243_10552488
824 Ga0105243_10970258
825 Ga0105243_11092610
826 Ga0105243_12197940
827 Ga0105248_10026969
828 Ga0105248_10138037
829 Ga0105237_10728344
830 Ga0105249_10005969
831 Ga0105249_10258425
832 Ga0105249_10282402
833 Ga0105249_12415499
834 Ga0105249_13136142
835 Ga0105239_10852277
836 Ga0105246_10417715
837 Ga0105246_10435151
838 Ga0105246_10884805
839 Ga0105246_11600570
840 Ga0157378_10980462
841 Ga0163162_10590344
842 Ga0157372_11963887
843 Ga0157375_10445981
844 Ga0157375_11233740
845 Ga0157375_11686537
846 Ga0163163_10023433
847 Ga0163163_10451186
848 Ga0157380_10021536
849 Ga0157380_10030172
850 Ga0157380_10035132
851 Ga0157380_10120349
852 Ga0157380_10377452
853 Ga0157380_10514449
854 Ga0157380_10915155
855 Ga0157380_12882337
856 Ga0157377_10068750
857 Ga0157377_10322163
858 Ga0157377_11268190
859 Ga0157376_10510336
860 Ga0157376_11810919
861 Ga0163161_10322872
862 Ga0206352_10288250
863 Ga0207666_1023119
864 Ga0207697_10011895
865 Ga0207682_10032808
866 Ga0207682_10471105
867 Ga0207680_10083249
868 Ga0207680_10413520
869 Ga0207643_10025731
870 Ga0207643_10036423
871 Ga0207643_10168925
872 Ga0207707_10319318
873 Ga0207660_10126412
874 Ga0207660_10185050
875 Ga0207660_10267720
876 Ga0207662_10086532
877 Ga0207662_10331020
878 Ga0207649_10010919
879 Ga0207649_10099179
880 Ga0207649_11078307
881 Ga0207681_10004627
882 Ga0207681_10062026
883 Ga0207681_10145322
884 Ga0207681_10594733
885 Ga0207650_10014293
886 Ga0207650_10292077
887 Ga0207650_10328838
888 Ga0207650_10459461
889 Ga0207659_10006771
890 Ga0207659_10035597
891 Ga0207659_10057016
892 Ga0207659_10372245
893 Ga0207644_10762059
894 Ga0207690_10069385
895 Ga0207706_10211730
896 Ga0207706_11272472
897 Ga0207709_10665376
898 Ga0207670_10169628
899 Ga0207670_11513942
900 Ga0207704_10513657
901 Ga0207691_10065061
902 Ga0207691_10076125
903 Ga0207691_10150655
904 Ga0207691_10593140
905 Ga0207711_10044920
906 Ga0207711_10326178
907 Ga0207711_10976720
908 Ga0207661_10090080
909 Ga0207679_10002245
910 Ga0207679_10051895
911 Ga0207679_10226441
912 Ga0207679_10766629
913 Ga0207679_11372028
914 Ga0207651_10042760
915 Ga0207651_11030766
916 Ga0207712_10038469
917 Ga0207712_10223660
918 Ga0207712_10328890
919 Ga0207668_10815992
920 Ga0207668_10820605
921 Ga0207658_10662500
922 Ga0207658_11104533
923 Ga0207703_10109772
924 Ga0207639_11138195
925 Ga0207678_10040510
926 Ga0207678_10605629
927 Ga0207678_10849482
928 Ga0207708_10241565
929 Ga0207708_10323838
930 Ga0207708_10525360
931 Ga0207708_10675148
932 Ga0207641_10566450
933 Ga0207641_10796165
934 Ga0207641_12589981
935 Ga0207648_10112008
936 Ga0207648_10123446
937 Ga0207648_10609073
938 Ga0207648_10859992
939 Ga0207676_10175862
940 Ga0207676_10250448
941 Ga0207676_10806759
942 Ga0207674_10279677
943 Ga0207674_10789733
944 Ga0207674_11505233
945 Ga0207675_100047032
946 Ga0207675_100810719
947 Ga0207675_101913856
948 Ga0207683_10116393
949 Ga0207683_10279576
950 Ga0207683_10551978
951 Ga0207698_11321603
952 Ga0209983_1103026
953 Ga0209813_10092021
954 Ga0207428_10000515
955 Ga0207428_10004630
956 Ga0207428_10005890
957 Ga0207428_10018539
958 Ga0207428_10183358
959 Ga0207428_10479186
960 Ga0268265_10112537
961 Ga0268265_10167768
962 Ga0268265_10894654
963 Ga0268265_10941703
964 Ga0268265_11321373
965 Ga0268265_11666398
966 Ga0268264_10963560
967 Ga0316182_1189504
968 Ga0307408_100257486
969 Ga0307408_100993425
970 Ga0307408_101735160
971 Ga0307405_10078180
972 Ga0307413_10045019
973 Ga0307413_10356070
974 Ga0307410_10014419
975 Ga0307410_10028237
976 Ga0307410_10701036
977 Ga0307406_10111624
978 Ga0307406_10376319
979 Ga0307407_10047779
980 Ga0307407_10297077
981 Ga0307412_10415285
982 Ga0307409_100049813
983 Ga0307409_100086388
984 Ga0307409_100125645
985 Ga0307409_100271195
986 Ga0307409_100771776
987 Ga0307409_101215918
988 Ga0307409_101486771
989 Ga0307416_100039078
990 Ga0307416_100078896
991 Ga0307416_100112244
992 Ga0307416_100547463
993 Ga0307416_101025004
994 Ga0307416_101118099
995 Ga0307416_103357182
996 Ga0307414_10020289
997 Ga0307411_10108351
998 Ga0307411_10232245
999 Ga0307411_10749526
1000 Ga0307411_11308838
1001 Ga0307415_100027564
1002 Ga0373932_0152927
1003 Ga0373941_0089657
1004 Ga0439436_0114180
1005 Ga0439439_0097025
1006 Ga0451793_0400625
1007 Ga0451800_0253441
1008 Ga0451802_1238844
1009 Ga0451807_2259494
1010 Ga0451851_0852380
1011 Ga0451853_1556311
1012 Ga0439431_0082086
1013 Ga0439431_0137618
1014 Ga0439441_013191
1015 Ga0439443_047914
1016 Ga0439445_0035426
1017 Ga0439449_0323650
1018 Ga0439450_072441
1019 Ga0439462_0027089
1020 Ga0439462_0037506
1021 Ga0439462_0054389
1022 Ga0450917_012676
1023 Ga0450920_049653
1024 Ga0450920_133384
1025 Ga0450896_032480
1026 Ga0450898_020604
1027 Ga0450907_047640
1028 Ga0439446_0011335
1029 Ga0439446_0045117
1030 Ga0439446_0050601
1031 Ga0439434_0023326
1032 Ga0439434_0040837
1033 Ga0439435_0015406
1034 Ga0439460_0015508
1035 Ga0439460_0015632
1036 Ga0450916_004461
1037 Ga0450918_017799
1038 Ga0451577_0030854
1039 Ga0439440_0179006
1040 Ga0453684_0076262
1041 Ga0495641_0363052
1042 Ga0495594_0006412
1043 Ga0495630_0365918
1044 Ga0495631_0331554
1045 Ga0495643_0004858
1046 Ga0495663_0148394
1047 Ga0495640_0275940
1048 Ga0495598_0294041
1049 Ga0495621_0003200
1050 Ga0495621_0120794
1051 Ga0495656_0053832
1052 Ga0495659_0143685
1053 Ga0495599_0685939
1054 Ga0495658_0063586
1055 Ga0495658_0121754
1056 Ga0495658_0328815
1057 Ga0495669_0370322
1058 Ga0496101_0822320
1059 Ga0496102_0311733
1060 Ga0496104_0003182
1061 Ga0496105_0043898
1062 Ga0496106_0988144
1063 Ga0496108_0046024
1064 Ga0496109_0000869
1065 Ga0496109_0650698
1066 Ga0496110_0009331
1067 Ga0496110_0985823
1068 Ga0496111_0007522
1069 Ga0496112_0000918
1070 Ga0496113_0014536
1071 Ga0496114_0631563
1072 Ga0501296_043737
1073 Ga0501031_0045213
1074 Ga0501031_0419350
1075 Ga0501031_0962595
1076 Ga0501033_0180785
1077 Ga0501033_0273618
1078 Ga0501033_0673930
1079 Ga0501036_0108720
1080 Ga0501036_0285378
1081 Ga0501036_0287459
1082 Ga0501036_0541507
1083 Ga0501038_0077419
1084 Ga0501038_1036445
1085 Ga0501039_0018193
1086 Ga0501039_0043886
1087 Ga0501039_0616218
1088 Ga0501040_0006238
1089 Ga0501040_0082085
1090 Ga0501040_0295052
1091 Ga0501040_0615794
1092 Ga0501040_0620241
1093 Ga0501041_0059897
1094 Ga0501041_0156035
1095 Ga0501041_0296755
1096 Ga0501041_0318900
1097 Ga0501041_0556970
1098 Ga0501042_0023695
1099 Ga0501042_0076184
1100 Ga0501042_0096327
1101 Ga0501042_0225790
1102 Ga0501042_0343744
1103 Ga0501042_0438623
1104 Ga0501042_0490406
1105 Ga0501046_0111766
1106 Ga0501046_0417805
1107 Ga0501047_0098709
1108 Ga0501048_0048914
1109 Ga0501048_0271632
1110 Ga0501048_0325143
1111 Ga0501048_0641104
1112 Ga0501048_0699887
1113 Ga0501067_0039899
1114 Ga0501069_0036837
1115 Ga0501069_0266934
1116 Ga0501069_0556097
1117 Ga0501070_0230990
1118 Ga0501071_0019912
1119 Ga0501071_0071518
1120 Ga0501071_0092378
1121 Ga0501071_0103155
1122 Ga0501071_0184435
1123 Ga0501071_0197551
1124 Ga0501071_0225145
1125 Ga0501071_0401869
1126 Ga0501071_1109621
1127 Ga0501072_0027575
1128 Ga0501072_0082110
1129 Ga0501072_0105062
1130 Ga0501072_0466031
1131 Ga0501072_1309220
1132 Ga0501073_0007964
1133 Ga0501074_0144387
1134 Ga0501075_0039445
1135 Ga0501075_0114938
1136 Ga0501075_0274999
1137 Ga0501076_0030800
1138 Ga0501076_0042506
1139 Ga0501076_0068512
1140 Ga0501076_0114977
1141 Ga0501076_0264023
1142 Ga0501076_1004853
1143 Ga0501077_0089653
1144 Ga0501077_0166409
1145 Ga0501077_0214345
1146 Ga0501077_0215864
1147 Ga0501240_052352
1148 Ga0501249_037638
1149 Ga0501245_058692
1150 Ga0501079_0043660
1151 Ga0501079_0049299
1152 Ga0501079_0129335
1153 Ga0501079_0165070
1154 Ga0501079_0194046
1155 Ga0501079_0209303
1156 Ga0501079_0281972
1157 Ga0501079_0767868
1158 Ga0501079_0912079
1159 Ga0501079_0957240
1160 Ga0501079_1482749
1161 Ga0501080_0336229
1162 Ga0501080_1097006
1163 Ga0501081_0163993
1164 Ga0501081_0248746
1165 Ga0501081_0290481
1166 Ga0501081_0442450
1167 Ga0501083_0643375
1168 Ga0501283_005691
1169 Ga0501035_0270977
1170 Ga0501035_0340561
1171 Ga0501035_0416370
1172 Ga0501035_0572398
1173 Ga0501045_0007609
1174 Ga0501045_0018171
1175 Ga0501045_0025539
1176 Ga0501045_0131448
1177 nmdc:mga03n38_157859_c1
1178 nmdc:mga03n38_200613_c1
1179 nmdc:mga00v17_404207_c1
1180 nmdc:mga00v17_66432_c1
1181 nmdc:mga0yw44_279189_c1
1182 nmdc:mga0k408_311991_c1
1183 nmdc:mga06z11_145600_c1
1184 nmdc:mga06z11_54092_c1
1185 nmdc:mga04h51_10272_c1
1186 nmdc:mga04h51_108828_c1
1187 nmdc:mga05p37_101486_c1
1188 nmdc:mga05p37_10752_c1
1189 nmdc:mga05p37_1228458_c1
1190 nmdc:mga05p37_129664_c1
1191 nmdc:mga05p37_251244_c1
1192 nmdc:mga05p37_38671_c1
1193 nmdc:mga05p37_79286_c1
1194 nmdc:mga09592_126177_c1
1195 nmdc:mga09592_160001_c1
1196 nmdc:mga09592_1602065_c1
1197 nmdc:mga09592_243342_c1
1198 nmdc:mga09592_282778_c1
1199 nmdc:mga09592_283113_c1
1200 nmdc:mga09592_325420_c1
1201 nmdc:mga09592_421095_c1
1202 nmdc:mga09592_519073_c1
1203 nmdc:mga09592_98676_c1
1204 nmdc:mga0qj67_11170_c1
1205 nmdc:mga0qj67_2637_c1
1206 nmdc:mga0qj67_33100_c1
1207 nmdc:mga0qj67_774557_c1
1208 nmdc:mga06r32_16241_c1
1209 nmdc:mga06r32_280387_c1
1210 nmdc:mga06r32_43448_c1
1211 nmdc:mga06r32_47914_c1
1212 nmdc:mga08y16_1223978_c1
1213 nmdc:mga08y16_202909_c1
1214 nmdc:mga08y16_25255_c1
1215 nmdc:mga08y16_253085_c1
1216 nmdc:mga08y16_532012_c1
1217 nmdc:mga08y16_554613_c1
1218 nmdc:mga08y16_65053_c1
1219 nmdc:mga08y16_7358_c1
1220 nmdc:mga08y16_74127_c1
1221 nmdc:mga08y16_87_c1
1222 nmdc:mga0n895_13885_c1
1223 nmdc:mga0n895_1471829_c1
1224 nmdc:mga0n895_1741084_c1
1225 nmdc:mga0n895_360997_c1
1226 nmdc:mga0n895_97918_c1
1227 nmdc:mga0rr50_132830_c1
1228 nmdc:mga0rr50_432356_c1
1229 nmdc:mga0rr50_482916_c1
1230 nmdc:mga0rr50_483320_c1
1231 nmdc:mga0a205_43843_c1
1232 nmdc:mga0a205_546647_c1
1233 nmdc:mga0a205_716753_c1
1234 nmdc:mga0a205_76883_c2
1235 Ga0500646_0037578
1236 Ga0500652_314779
1237 Ga0500568_0003412
1238 Ga0501084_0018012
1239 Ga0501084_0034476
1240 Ga0501084_0314081
1241 Ga0501084_0488725
1242 Ga0501084_0974216
1243 Ga0590071_123578
1244 Ga0501082_0007448
1245 Ga0501082_0044348
1246 Ga0501082_0191927
1247 Ga0501082_0255035
1248 Ga0501082_1342520
1249 Ga0530510_0001585
1250 Ga0530510_0263447
1251 Ga0530510_0415488
1252 Ga0530510_0595950
1253 Ga0530510_1268441
1254 Ga0530510_1423717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

28

120

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cwo-assembly1.cif.gz_F cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.9524 3 93
6yt9-assembly1.cif.gz_g acinetobacter baumannii ribosome-tigecycline complex - 30s subunit body 0.9322 3 93
7oii-assembly1.cif.gz_j cspa-70 cotranslational folding intermediate 2 0.9319 3 93
7msm-assembly1.cif.gz_f mtb 70sic in complex with mtbetta at trans_r0 state 0.9312 3 95
7unu-assembly1.cif.gz_f pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9297 3 93
ID Description Score Start End Superfamily
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9313 1 93 3.30.70.60
af_P9WH31_1_96_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.929 3 96 3.30.70.60
af_Q8IKJ9_3_103_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9219 5 92 3.30.70.60
af_I1J4K1_1_101_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9214 3 93 3.30.70.60
af_Q2G113_1_98_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9213 3 96 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A1F9HSN0-F1-model_v4 Small ribosomal subunit protein bS6 0.9721 1 93 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-E6YL93-F1-model_v4 Small ribosomal subunit protein bS6 0.9698 3 94 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A353QPV4-F1-model_v4 deleted 0.9681 1 94
AF-A0A1F9M7Y1-F1-model_v4 Small ribosomal subunit protein bS6 0.9667 3 96 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A3A0AA77-F1-model_v4 Small ribosomal subunit protein bS6 0.9664 2 95 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904

Map