F470534
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 343 | 581 | 487 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10020068|Ga0070692_100200682 |
| Length | 543 |
| Sequence | VHATLKPKLGFAQLWNISFGFFGIQVGFALQNANMSRIFQSLGTSIDTLPALWVAAPLTGLLVQPVIGHMSDRTWLGRLGRRRPYFLAGAILAGLALFAMPEAPALLFAALLLWVLDASLNISMEPFRAFVGDMLPRDQHSAGYAMQTAFIGAGAVVGSIVPWALERFGVSNAAPGGGIPDTVRFAFWLGGGALVLAVLWTVVTTREFSPEELARFEAAAEAEEDHALRVLAARTYRSSGLWAAAGAAVVLAVLRLGLEKEVYLLGGLLLAYGLASAXXIALAKSGRSAGMLCHIVGDFSGMPPVMKRLALVQFFSWSALFIMWINTTPVVAQVFYGAPDATGPVYQEGANWVDVLFAAYNGVAAVAALALLPFVARAIGRVRTHVAALLCGALGYASFFFIRDPKLLLLSEVGIGIAWASILAMPYAILASSLPQKKLGIFMGLFNVFVVVPQLLVATVMGSIMKHFFPGQPIWTMAFAAGVMALAALAMLRVEEPPVILPGTGRGTMRSMVEGGLCQVLDPLHHAASRRGPPPRPGEEQNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 6 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 7 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 8 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 9 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 10 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 11 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 12 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 13 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 14 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 15 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 16 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 17 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 18 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 19 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 20 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 21 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 22 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 23 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 24 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 25 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 26 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 27 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 28 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 29 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 30 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 31 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 32 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 33 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 34 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 35 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 36 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 37 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 38 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 39 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 40 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 41 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 42 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 43 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 44 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 45 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 46 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 49 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 58 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 65 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 67 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 237 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 240 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 242 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 311 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 312 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 313 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 314 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 327 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 340 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 341 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 342 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 343 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.34 |
| Metatranscriptomes | 0.32 |
| Isolates | 7.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.8 |
| Bulb | 0 |
| Endosphere | 9.57 |
| Nodule | 0.8 |
| Rhizoplane | 2.87 |
| Rhizosphere | 74.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002025 | 3300001989 | Bacteria | 7755 |
| 2 | JGI24737J22298_10002017 | 3300001990 | Bacteria | 7252 |
| 3 | JGI24737J22298_10005866 | 3300001990 | Bacteria | 4226 |
| 4 | JGI24744J21845_10000092 | 3300002077 | Bacteria | 11841 |
| 5 | JGI25150J39212_1000324 | 3300002774 | Bacteria | 23500 |
| 6 | JGI25150J39212_1003968 | 3300002774 | Bacteria | 3369 |
| 7 | JGI25153J46596_10000093 | 3300003215 | Bacteria | 103442 |
| 8 | JGI25153J46596_10015682 | 3300003215 | Bacteria | 3072 |
| 9 | rootL2_10127512 | 3300003322 | Bacteria | 3371 |
| 10 | rootH1_10024342 | 3300003323 | Bacteria | 18481 |
| 11 | rootH1_10050362 | 3300003323 | Bacteria | 10703 |
| 12 | Ga0055526_1000850 | 3300003771 | Bacteria | 22751 |
| 13 | Ga0055526_1002192 | 3300003771 | Bacteria | 13396 |
| 14 | Ga0055537_1000357 | 3300003773 | Bacteria | 31036 |
| 15 | Ga0055524_1000361 | 3300003775 | Bacteria | 40768 |
| 16 | Ga0055524_1000721 | 3300003775 | Bacteria | 22672 |
| 17 | Ga0055536_1000717 | 3300003781 | Bacteria | 22204 |
| 18 | Ga0055536_1002872 | 3300003781 | Bacteria | 9486 |
| 19 | Ga0055530_10000092 | 3300003791 | Bacteria | 77982 |
| 20 | Ga0055531_10000100 | 3300003794 | Bacteria | 93692 |
| 21 | Ga0055531_10000223 | 3300003794 | Bacteria | 62728 |
| 22 | Ga0055531_10000609 | 3300003794 | Bacteria | 31067 |
| 23 | Ga0055531_10006181 | 3300003794 | Bacteria | 6842 |
| 24 | Ga0055543_1000603 | 3300004625 | Bacteria | 19476 |
| 25 | Ga0065165_1001948 | 3300005262 | Bacteria | 19602 |
| 26 | Ga0065715_10017692 | 3300005293 | Bacteria | 2192 |
| 27 | Ga0070658_10000126 | 3300005327 | Bacteria | 67900 |
| 28 | Ga0070658_10006493 | 3300005327 | Bacteria | 9479 |
| 29 | Ga0070658_10155770 | 3300005327 | Bacteria | 1915 |
| 30 | Ga0070676_10002591 | 3300005328 | Bacteria | 9298 |
| 31 | Ga0070676_10012477 | 3300005328 | Bacteria | 4640 |
| 32 | Ga0070683_100015689 | 3300005329 | Bacteria | 6660 |
| 33 | Ga0070670_100003903 | 3300005331 | Bacteria | 12436 |
| 34 | Ga0070670_100026650 | 3300005331 | Bacteria | 4972 |
| 35 | Ga0070677_10000776 | 3300005333 | Bacteria | 10645 |
| 36 | Ga0068869_100000448 | 3300005334 | Bacteria | 22602 |
| 37 | Ga0070666_10010617 | 3300005335 | Bacteria | 5764 |
| 38 | Ga0070666_10013961 | 3300005335 | Bacteria | 5106 |
| 39 | Ga0068868_100001969 | 3300005338 | Bacteria | 14079 |
| 40 | Ga0068868_100101971 | 3300005338 | Bacteria | 2323 |
| 41 | Ga0068868_100159793 | 3300005338 | Bacteria | 1860 |
| 42 | Ga0070660_100000921 | 3300005339 | Bacteria | 19669 |
| 43 | Ga0070660_100005855 | 3300005339 | Bacteria | 8510 |
| 44 | Ga0070660_100014704 | 3300005339 | Bacteria | 5646 |
| 45 | Ga0070660_100023827 | 3300005339 | Bacteria | 4537 |
| 46 | Ga0070661_100004370 | 3300005344 | Bacteria | 9746 |
| 47 | Ga0070692_10004884 | 3300005345 | Bacteria | 5644 |
| 48 | Ga0070692_10020068 | 3300005345 | Bacteria | 3235 |
| 49 | Ga0070668_100004822 | 3300005347 | Bacteria | 9999 |
| 50 | Ga0070668_100034769 | 3300005347 | Bacteria | 3841 |
| 51 | Ga0070668_100052128 | 3300005347 | Bacteria | 3153 |
| 52 | Ga0070669_100005619 | 3300005353 | Bacteria | 9062 |
| 53 | Ga0070669_100006160 | 3300005353 | Bacteria | 8659 |
| 54 | Ga0070675_100003209 | 3300005354 | Bacteria | 12385 |
| 55 | Ga0070671_100001233 | 3300005355 | Bacteria | 19164 |
| 56 | Ga0070671_100012166 | 3300005355 | Bacteria | 6926 |
| 57 | Ga0070671_100019561 | 3300005355 | Bacteria | 5513 |
| 58 | Ga0070671_100038689 | 3300005355 | Bacteria | 3958 |
| 59 | Ga0070674_100004248 | 3300005356 | Bacteria | 8148 |
| 60 | Ga0070674_100017587 | 3300005356 | Bacteria | 4502 |
| 61 | Ga0070674_100042674 | 3300005356 | Bacteria | 3082 |
| 62 | Ga0070673_100004233 | 3300005364 | Bacteria | 9053 |
| 63 | Ga0070673_100009404 | 3300005364 | Bacteria | 6560 |
| 64 | Ga0070673_100087221 | 3300005364 | Bacteria | 2543 |
| 65 | Ga0070659_100003530 | 3300005366 | Bacteria | 11139 |
| 66 | Ga0070659_100004141 | 3300005366 | Bacteria | 10343 |
| 67 | Ga0070659_100052832 | 3300005366 | Bacteria | 3197 |
| 68 | Ga0070659_100094380 | 3300005366 | Bacteria | 2402 |
| 69 | Ga0070667_100007904 | 3300005367 | Bacteria | 8823 |
| 70 | Ga0070667_100010506 | 3300005367 | Bacteria | 7644 |
| 71 | Ga0070667_100016087 | 3300005367 | Bacteria | 6188 |
| 72 | Ga0070709_10013162 | 3300005434 | Bacteria | 4645 |
| 73 | Ga0070709_10025804 | 3300005434 | Bacteria | 3474 |
| 74 | Ga0070714_100032886 | 3300005435 | Bacteria | 4332 |
| 75 | Ga0070714_100042885 | 3300005435 | Bacteria | 3824 |
| 76 | Ga0070713_100031712 | 3300005436 | Bacteria | 4212 |
| 77 | Ga0070711_100000056 | 3300005439 | Bacteria | 67294 |
| 78 | Ga0070694_100001260 | 3300005444 | Bacteria | 14706 |
| 79 | Ga0070663_100036273 | 3300005455 | Bacteria | 3425 |
| 80 | Ga0070663_100041855 | 3300005455 | Bacteria | 3216 |
| 81 | Ga0070678_100029833 | 3300005456 | Bacteria | 3740 |
| 82 | Ga0070662_100001271 | 3300005457 | Bacteria | 15503 |
| 83 | Ga0070662_100031608 | 3300005457 | Bacteria | 3716 |
| 84 | Ga0070662_100036920 | 3300005457 | Bacteria | 3461 |
| 85 | Ga0070662_100045811 | 3300005457 | Bacteria | 3140 |
| 86 | Ga0068867_100003211 | 3300005459 | Bacteria | 11519 |
| 87 | Ga0068867_100019298 | 3300005459 | Bacteria | 4860 |
| 88 | Ga0068867_100031850 | 3300005459 | Bacteria | 3810 |
| 89 | Ga0070699_100017609 | 3300005518 | Bacteria | 6133 |
| 90 | Ga0068853_100054738 | 3300005539 | Bacteria | 3439 |
| 91 | Ga0070672_100022246 | 3300005543 | Bacteria | 4652 |
| 92 | Ga0070695_100001410 | 3300005545 | Bacteria | 13315 |
| 93 | Ga0070665_100000905 | 3300005548 | Bacteria | 38051 |
| 94 | Ga0070665_100007805 | 3300005548 | Bacteria | 10861 |
| 95 | Ga0070665_100021722 | 3300005548 | Bacteria | 6453 |
| 96 | Ga0070665_100071880 | 3300005548 | Bacteria | 3467 |
| 97 | Ga0068855_100002466 | 3300005563 | Bacteria | 22833 |
| 98 | Ga0068855_100170696 | 3300005563 | Bacteria | 2463 |
| 99 | Ga0068855_100185406 | 3300005563 | Bacteria | 2350 |
| 100 | Ga0070664_100000197 | 3300005564 | Bacteria | 42730 |
| 101 | Ga0070664_100040150 | 3300005564 | Bacteria | 3945 |
| 102 | Ga0070664_100056833 | 3300005564 | Bacteria | 3325 |
| 103 | Ga0068854_100006975 | 3300005578 | Bacteria | 7206 |
| 104 | Ga0068854_100039463 | 3300005578 | Bacteria | 3326 |
| 105 | Ga0068854_100043706 | 3300005578 | Bacteria | 3177 |
| 106 | Ga0068856_100006709 | 3300005614 | Bacteria | 11280 |
| 107 | Ga0068856_100011902 | 3300005614 | Bacteria | 8424 |
| 108 | Ga0068856_100149059 | 3300005614 | Bacteria | 2347 |
| 109 | Ga0068856_100201311 | 3300005614 | Bacteria | 2006 |
| 110 | Ga0068852_100001133 | 3300005616 | Bacteria | 17620 |
| 111 | Ga0068852_100024888 | 3300005616 | Bacteria | 4844 |
| 112 | Ga0068852_100026985 | 3300005616 | Bacteria | 4675 |
| 113 | Ga0068859_100001175 | 3300005617 | Bacteria | 26727 |
| 114 | Ga0068864_100005277 | 3300005618 | Bacteria | 10584 |
| 115 | Ga0068864_100022152 | 3300005618 | Bacteria | 5326 |
| 116 | Ga0068866_10050927 | 3300005718 | Bacteria | 2105 |
| 117 | Ga0068851_10014247 | 3300005834 | Bacteria | 3774 |
| 118 | Ga0068863_100004152 | 3300005841 | Bacteria | 14299 |
| 119 | Ga0068858_100004433 | 3300005842 | Bacteria | 13771 |
| 120 | Ga0068858_100029916 | 3300005842 | Bacteria | 5059 |
| 121 | Ga0068860_100007652 | 3300005843 | Bacteria | 10808 |
| 122 | Ga0068860_100009218 | 3300005843 | Bacteria | 9810 |
| 123 | Ga0068862_100094392 | 3300005844 | Bacteria | 2609 |
| 124 | Ga0068862_100149173 | 3300005844 | Bacteria | 2080 |
| 125 | Ga0081539_10009077 | 3300005985 | Bacteria | 8424 |
| 126 | Ga0081539_10009122 | 3300005985 | Bacteria | 8387 |
| 127 | Ga0081539_10014271 | 3300005985 | Bacteria | 5894 |
| 128 | Ga0070717_10004265 | 3300006028 | Bacteria | 10306 |
| 129 | Ga0070712_100004917 | 3300006175 | Bacteria | 8264 |
| 130 | Ga0068871_100005301 | 3300006358 | Bacteria | 9028 |
| 131 | Ga0075433_10003773 | 3300006852 | Bacteria | 11728 |
| 132 | Ga0068865_100131440 | 3300006881 | Bacteria | 1876 |
| 133 | Ga0075436_100028723 | 3300006914 | Bacteria | 3825 |
| 134 | Ga0097620_100001175 | 3300006931 | Bacteria | 26727 |
| 135 | Ga0099824_1000030 | 3300006942 | Bacteria | 83906 |
| 136 | Ga0079104_1000256 | 3300006946 | Bacteria | 71046 |
| 137 | Ga0099826_10000148 | 3300006948 | Bacteria | 30005 |
| 138 | Ga0105240_10166068 | 3300009093 | Bacteria | 2618 |
| 139 | Ga0105245_10003165 | 3300009098 | Bacteria | 14715 |
| 140 | Ga0105245_10063340 | 3300009098 | Bacteria | 3338 |
| 141 | Ga0114129_10069408 | 3300009147 | Bacteria | 4912 |
| 142 | Ga0114129_10164486 | 3300009147 | Bacteria | 3029 |
| 143 | Ga0105241_10094491 | 3300009174 | Bacteria | 2365 |
| 144 | Ga0105242_10082761 | 3300009176 | Bacteria | 2686 |
| 145 | Ga0105248_10000960 | 3300009177 | Bacteria | 32135 |
| 146 | Ga0105248_10200737 | 3300009177 | Bacteria | 2247 |
| 147 | Ga0105249_10001260 | 3300009553 | Bacteria | 22219 |
| 148 | Ga0105239_10050417 | 3300010375 | Bacteria | 4566 |
| 149 | Ga0105239_10231107 | 3300010375 | Bacteria | 2075 |
| 150 | Ga0105246_10005729 | 3300011119 | Bacteria | 7585 |
| 151 | Ga0105246_10036060 | 3300011119 | Bacteria | 3310 |
| 152 | Ga0157373_10005567 | 3300013100 | Bacteria | 9442 |
| 153 | Ga0157371_10003227 | 3300013102 | Bacteria | 14962 |
| 154 | Ga0157371_10031261 | 3300013102 | Bacteria | 3835 |
| 155 | Ga0157371_10085492 | 3300013102 | Bacteria | 2234 |
| 156 | Ga0157370_10002213 | 3300013104 | Bacteria | 23732 |
| 157 | Ga0157369_10051485 | 3300013105 | Bacteria | 4456 |
| 158 | Ga0157369_10086621 | 3300013105 | Bacteria | 3345 |
| 159 | Ga0157369_10119780 | 3300013105 | Bacteria | 2793 |
| 160 | Ga0157369_10153672 | 3300013105 | Bacteria | 2432 |
| 161 | Ga0157378_10008051 | 3300013297 | Bacteria | 9199 |
| 162 | Ga0157378_10072940 | 3300013297 | Bacteria | 3085 |
| 163 | Ga0163162_10106995 | 3300013306 | Bacteria | 2892 |
| 164 | Ga0163163_10124150 | 3300014325 | Bacteria | 2618 |
| 165 | Ga0157380_10002530 | 3300014326 | Bacteria | 12346 |
| 166 | Ga0157380_10073493 | 3300014326 | Bacteria | 2772 |
| 167 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 168 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 169 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 170 | Ga0213872_10002079 | 3300021361 | Bacteria | 12111 |
| 171 | Ga0213872_10003961 | 3300021361 | Bacteria | 7988 |
| 172 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 173 | Ga0213876_10000138 | 3300021384 | Bacteria | 79857 |
| 174 | Ga0213876_10004860 | 3300021384 | Bacteria | 7451 |
| 175 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 176 | Ga0213875_10000163 | 3300021388 | Bacteria | 69287 |
| 177 | Ga0213875_10007605 | 3300021388 | Bacteria | 5587 |
| 178 | Ga0213875_10015587 | 3300021388 | Bacteria | 3697 |
| 179 | Ga0213875_10020953 | 3300021388 | Bacteria | 3134 |
| 180 | Ga0213875_10053052 | 3300021388 | Bacteria | 1899 |
| 181 | Ga0209147_100288 | 3300025229 | Bacteria | 42776 |
| 182 | Ga0207425_1000047 | 3300025245 | Bacteria | 189158 |
| 183 | Ga0209129_1002125 | 3300025258 | Bacteria | 10073 |
| 184 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 185 | Ga0209565_1000177 | 3300025263 | Bacteria | 80620 |
| 186 | Ga0209673_1002201 | 3300025273 | Bacteria | 14286 |
| 187 | Ga0209675_1000366 | 3300025291 | Bacteria | 38418 |
| 188 | Ga0209675_1005715 | 3300025291 | Bacteria | 5138 |
| 189 | Ga0209676_1000045 | 3300025292 | Bacteria | 412331 |
| 190 | Ga0209676_1000133 | 3300025292 | Bacteria | 184430 |
| 191 | Ga0209676_1012243 | 3300025292 | Bacteria | 3389 |
| 192 | Ga0209025_1001194 | 3300025294 | Bacteria | 36680 |
| 193 | Ga0209564_1001282 | 3300025295 | Bacteria | 27530 |
| 194 | Ga0209564_1006875 | 3300025295 | Bacteria | 5998 |
| 195 | Ga0209564_1007245 | 3300025295 | Bacteria | 5770 |
| 196 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 197 | Ga0209758_1002209 | 3300025297 | Bacteria | 20282 |
| 198 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 199 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 200 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 201 | Ga0209050_1000195 | 3300025298 | Bacteria | 136316 |
| 202 | Ga0209050_1001014 | 3300025298 | Bacteria | 35068 |
| 203 | Ga0209050_1005941 | 3300025298 | Bacteria | 7430 |
| 204 | Ga0209050_1012320 | 3300025298 | Bacteria | 3933 |
| 205 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 206 | Ga0209051_1000414 | 3300025303 | Bacteria | 58981 |
| 207 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 208 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 209 | Ga0209257_1000132 | 3300025304 | Bacteria | 210870 |
| 210 | Ga0209257_1001608 | 3300025304 | Bacteria | 25865 |
| 211 | Ga0209257_1001633 | 3300025304 | Bacteria | 25692 |
| 212 | Ga0209257_1004785 | 3300025304 | Bacteria | 10089 |
| 213 | Ga0209257_1006878 | 3300025304 | Bacteria | 7131 |
| 214 | Ga0207697_10000038 | 3300025315 | Bacteria | 49617 |
| 215 | Ga0207697_10002878 | 3300025315 | Bacteria | 8718 |
| 216 | Ga0207656_10000684 | 3300025321 | Bacteria | 11102 |
| 217 | Ga0207682_10002044 | 3300025893 | Bacteria | 9134 |
| 218 | Ga0207682_10029510 | 3300025893 | Bacteria | 2193 |
| 219 | Ga0207688_10008875 | 3300025901 | Bacteria | 5469 |
| 220 | Ga0207680_10041105 | 3300025903 | Bacteria | 2696 |
| 221 | Ga0207680_10058330 | 3300025903 | Bacteria | 2339 |
| 222 | Ga0207680_10083205 | 3300025903 | Bacteria | 2016 |
| 223 | Ga0207647_10000047 | 3300025904 | Bacteria | 89112 |
| 224 | Ga0207647_10000509 | 3300025904 | Bacteria | 31126 |
| 225 | Ga0207647_10006949 | 3300025904 | Bacteria | 8202 |
| 226 | Ga0207699_10019924 | 3300025906 | Bacteria | 3586 |
| 227 | Ga0207645_10035294 | 3300025907 | Bacteria | 3211 |
| 228 | Ga0207643_10011785 | 3300025908 | Bacteria | 4719 |
| 229 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 230 | Ga0207705_10012713 | 3300025909 | Bacteria | 6074 |
| 231 | Ga0207705_10099653 | 3300025909 | Bacteria | 2136 |
| 232 | Ga0207654_10066566 | 3300025911 | Bacteria | 2125 |
| 233 | Ga0207671_10096496 | 3300025914 | Bacteria | 2234 |
| 234 | Ga0207693_10018850 | 3300025915 | Bacteria | 5493 |
| 235 | Ga0207663_10001497 | 3300025916 | Bacteria | 10894 |
| 236 | Ga0207657_10004995 | 3300025919 | Bacteria | 13941 |
| 237 | Ga0207657_10014174 | 3300025919 | Bacteria | 7797 |
| 238 | Ga0207657_10017906 | 3300025919 | Bacteria | 6778 |
| 239 | Ga0207657_10026326 | 3300025919 | Bacteria | 5346 |
| 240 | Ga0207657_10031889 | 3300025919 | Bacteria | 4766 |
| 241 | Ga0207681_10001354 | 3300025923 | Bacteria | 15827 |
| 242 | Ga0207681_10029467 | 3300025923 | Bacteria | 3566 |
| 243 | Ga0207650_10004732 | 3300025925 | Bacteria | 9300 |
| 244 | Ga0207650_10009190 | 3300025925 | Bacteria | 6754 |
| 245 | Ga0207650_10090567 | 3300025925 | Bacteria | 2336 |
| 246 | Ga0207700_10034947 | 3300025928 | Bacteria | 3614 |
| 247 | Ga0207664_10056599 | 3300025929 | Bacteria | 3114 |
| 248 | Ga0207664_10069933 | 3300025929 | Bacteria | 2823 |
| 249 | Ga0207664_10193804 | 3300025929 | Bacteria | 1750 |
| 250 | Ga0207644_10000699 | 3300025931 | Bacteria | 21250 |
| 251 | Ga0207644_10010689 | 3300025931 | Bacteria | 6052 |
| 252 | Ga0207644_10027059 | 3300025931 | Bacteria | 3959 |
| 253 | Ga0207690_10002251 | 3300025932 | Bacteria | 11768 |
| 254 | Ga0207690_10004693 | 3300025932 | Bacteria | 8071 |
| 255 | Ga0207690_10019305 | 3300025932 | Bacteria | 4195 |
| 256 | Ga0207706_10000857 | 3300025933 | Bacteria | 31350 |
| 257 | Ga0207706_10007565 | 3300025933 | Bacteria | 10048 |
| 258 | Ga0207706_10017239 | 3300025933 | Bacteria | 6511 |
| 259 | Ga0207706_10020890 | 3300025933 | Bacteria | 5879 |
| 260 | Ga0207706_10047188 | 3300025933 | Bacteria | 3812 |
| 261 | Ga0207706_10050328 | 3300025933 | Bacteria | 3682 |
| 262 | Ga0207706_10052387 | 3300025933 | Bacteria | 3603 |
| 263 | Ga0207706_10054124 | 3300025933 | Bacteria | 3542 |
| 264 | Ga0207706_10074372 | 3300025933 | Bacteria | 2988 |
| 265 | Ga0207706_10076453 | 3300025933 | Bacteria | 2945 |
| 266 | Ga0207709_10017316 | 3300025935 | Bacteria | 4020 |
| 267 | Ga0207670_10022046 | 3300025936 | Bacteria | 3940 |
| 268 | Ga0207669_10031408 | 3300025937 | Bacteria | 2967 |
| 269 | Ga0207669_10057417 | 3300025937 | Bacteria | 2369 |
| 270 | Ga0207704_10143228 | 3300025938 | Bacteria | 1675 |
| 271 | Ga0207691_10000672 | 3300025940 | Bacteria | 33790 |
| 272 | Ga0207691_10002554 | 3300025940 | Bacteria | 17791 |
| 273 | Ga0207691_10010917 | 3300025940 | Bacteria | 8720 |
| 274 | Ga0207691_10031057 | 3300025940 | Bacteria | 4989 |
| 275 | Ga0207691_10187079 | 3300025940 | Bacteria | 1807 |
| 276 | Ga0207711_10000496 | 3300025941 | Bacteria | 40666 |
| 277 | Ga0207711_10010559 | 3300025941 | Bacteria | 7676 |
| 278 | Ga0207711_10021022 | 3300025941 | Bacteria | 5450 |
| 279 | Ga0207711_10136940 | 3300025941 | Bacteria | 2200 |
| 280 | Ga0207689_10000190 | 3300025942 | Bacteria | 53407 |
| 281 | Ga0207689_10015713 | 3300025942 | Bacteria | 6408 |
| 282 | Ga0207679_10005414 | 3300025945 | Bacteria | 7997 |
| 283 | Ga0207667_10031142 | 3300025949 | Bacteria | 5761 |
| 284 | Ga0207651_10000287 | 3300025960 | Bacteria | 21681 |
| 285 | Ga0207651_10000990 | 3300025960 | Bacteria | 12553 |
| 286 | Ga0207651_10031604 | 3300025960 | Bacteria | 3387 |
| 287 | Ga0207651_10124119 | 3300025960 | Bacteria | 1964 |
| 288 | Ga0207712_10000280 | 3300025961 | Bacteria | 48628 |
| 289 | Ga0207640_10035326 | 3300025981 | Bacteria | 3127 |
| 290 | Ga0207658_10027128 | 3300025986 | Bacteria | 4022 |
| 291 | Ga0207658_10144181 | 3300025986 | Bacteria | 1931 |
| 292 | Ga0207677_10003280 | 3300026023 | Bacteria | 8554 |
| 293 | Ga0207703_10004007 | 3300026035 | Bacteria | 12195 |
| 294 | Ga0207703_10008076 | 3300026035 | Bacteria | 8318 |
| 295 | Ga0207639_10184445 | 3300026041 | Bacteria | 1778 |
| 296 | Ga0207678_10012762 | 3300026067 | Bacteria | 7380 |
| 297 | Ga0207678_10046937 | 3300026067 | Bacteria | 3735 |
| 298 | Ga0207702_10006625 | 3300026078 | Bacteria | 9961 |
| 299 | Ga0207702_10053077 | 3300026078 | Bacteria | 3431 |
| 300 | Ga0207641_10020578 | 3300026088 | Bacteria | 5421 |
| 301 | Ga0207641_10022509 | 3300026088 | Bacteria | 5186 |
| 302 | Ga0207648_10008175 | 3300026089 | Bacteria | 10171 |
| 303 | Ga0207648_10009201 | 3300026089 | Bacteria | 9490 |
| 304 | Ga0207648_10015911 | 3300026089 | Bacteria | 6895 |
| 305 | Ga0207648_10021959 | 3300026089 | Bacteria | 5734 |
| 306 | Ga0207676_10002566 | 3300026095 | Bacteria | 12965 |
| 307 | Ga0207676_10003827 | 3300026095 | Bacteria | 10631 |
| 308 | Ga0207674_10001422 | 3300026116 | Bacteria | 30915 |
| 309 | Ga0207674_10020538 | 3300026116 | Bacteria | 7133 |
| 310 | Ga0207674_10075707 | 3300026116 | Bacteria | 3375 |
| 311 | Ga0207675_100135922 | 3300026118 | Bacteria | 2332 |
| 312 | Ga0207683_10012421 | 3300026121 | Bacteria | 7267 |
| 313 | Ga0207683_10058239 | 3300026121 | Bacteria | 3392 |
| 314 | Ga0207683_10146835 | 3300026121 | Bacteria | 2127 |
| 315 | Ga0207698_10006283 | 3300026142 | Bacteria | 7393 |
| 316 | Ga0207698_10011190 | 3300026142 | Bacteria | 5805 |
| 317 | Ga0209281_1000115 | 3300027111 | Bacteria | 210393 |
| 318 | Ga0209282_1033149 | 3300027666 | Bacteria | 3150 |
| 319 | Ga0209974_10005841 | 3300027876 | Bacteria | 4315 |
| 320 | Ga0268266_10000423 | 3300028379 | Bacteria | 64113 |
| 321 | Ga0268266_10006759 | 3300028379 | Bacteria | 10457 |
| 322 | Ga0268266_10008869 | 3300028379 | Bacteria | 8902 |
| 323 | Ga0268265_10003997 | 3300028380 | Bacteria | 10380 |
| 324 | Ga0268265_10007583 | 3300028380 | Bacteria | 7319 |
| 325 | Ga0268264_10003154 | 3300028381 | Bacteria | 14286 |
| 326 | Ga0268264_10007972 | 3300028381 | Bacteria | 8812 |
| 327 | Ga0268264_10018910 | 3300028381 | Bacteria | 5632 |
| 328 | Ga0265326_10025541 | 3300028558 | Bacteria | 1685 |
| 329 | Ga0265316_10004231 | 3300031344 | Bacteria | 14340 |
| 330 | Ga0265316_10023635 | 3300031344 | Bacteria | 5160 |
| 331 | Ga0307408_100001219 | 3300031548 | Bacteria | 19363 |
| 332 | Ga0307508_10036606 | 3300031616 | Bacteria | 4418 |
| 333 | Ga0316578_10031811 | 3300031728 | Bacteria | 3009 |
| 334 | Ga0316578_10052930 | 3300031728 | Bacteria | 2379 |
| 335 | Ga0307405_10000004 | 3300031731 | Bacteria | 444977 |
| 336 | Ga0307405_10009917 | 3300031731 | Bacteria | 4905 |
| 337 | Ga0307405_10032401 | 3300031731 | Bacteria | 3089 |
| 338 | Ga0307405_10080589 | 3300031731 | Bacteria | 2126 |
| 339 | Ga0307413_10000007 | 3300031824 | Bacteria | 65102 |
| 340 | Ga0307413_10011708 | 3300031824 | Bacteria | 4330 |
| 341 | Ga0307410_10000879 | 3300031852 | Bacteria | 12839 |
| 342 | Ga0307410_10007304 | 3300031852 | Bacteria | 6037 |
| 343 | Ga0307410_10041853 | 3300031852 | Bacteria | 3023 |
| 344 | Ga0307410_10074262 | 3300031852 | Bacteria | 2367 |
| 345 | Ga0307410_10089479 | 3300031852 | Bacteria | 2181 |
| 346 | Ga0307406_10000044 | 3300031901 | Bacteria | 71261 |
| 347 | Ga0307406_10126904 | 3300031901 | Bacteria | 1784 |
| 348 | Ga0307407_10010751 | 3300031903 | Bacteria | 4327 |
| 349 | Ga0307412_10004709 | 3300031911 | Bacteria | 7613 |
| 350 | Ga0307412_10008175 | 3300031911 | Bacteria | 5965 |
| 351 | Ga0307409_100000126 | 3300031995 | Bacteria | 28589 |
| 352 | Ga0307409_100120519 | 3300031995 | Bacteria | 2220 |
| 353 | Ga0307409_100233516 | 3300031995 | Bacteria | 1669 |
| 354 | Ga0307416_100039255 | 3300032002 | Bacteria | 3663 |
| 355 | Ga0307416_100092270 | 3300032002 | Bacteria | 2604 |
| 356 | Ga0307416_100162193 | 3300032002 | Bacteria | 2068 |
| 357 | Ga0307416_100245032 | 3300032002 | Bacteria | 1740 |
| 358 | Ga0307414_10000014 | 3300032004 | Bacteria | 302974 |
| 359 | Ga0307414_10005163 | 3300032004 | Bacteria | 7165 |
| 360 | Ga0307414_10032471 | 3300032004 | Bacteria | 3437 |
| 361 | Ga0307414_10044387 | 3300032004 | Bacteria | 3035 |
| 362 | Ga0307414_10073381 | 3300032004 | Bacteria | 2475 |
| 363 | Ga0307411_10000002 | 3300032005 | Bacteria | 534807 |
| 364 | Ga0307411_10000168 | 3300032005 | Bacteria | 21123 |
| 365 | Ga0307411_10051596 | 3300032005 | Bacteria | 2684 |
| 366 | Ga0307415_100007658 | 3300032126 | Bacteria | 5925 |
| 367 | Ga0307415_100007831 | 3300032126 | Bacteria | 5873 |
| 368 | Ga0316585_10015382 | 3300032137 | Bacteria | 2294 |
| 369 | Ga0307510_10007193 | 3300033180 | Bacteria | 13255 |
| 370 | Ga0373943_0047327 | 3300035170 | Bacteria | 2102 |
| 371 | Ga0316584_0000657 | 3300036712 | Bacteria | 18859 |
| 372 | Ga0316584_0068139 | 3300036712 | Bacteria | 2667 |
| 373 | Ga0395899_0015906 | 3300037312 | Bacteria | 5736 |
| 374 | Ga0395899_0073235 | 3300037312 | Bacteria | 2506 |
| 375 | Ga0395900_0005369 | 3300037418 | Bacteria | 13430 |
| 376 | Ga0395900_0008230 | 3300037418 | Bacteria | 10739 |
| 377 | Ga0395900_0017277 | 3300037418 | Bacteria | 7363 |
| 378 | Ga0395900_0026110 | 3300037418 | Bacteria | 5980 |
| 379 | Ga0395900_0047646 | 3300037418 | Bacteria | 4414 |
| 380 | Ga0395900_0070727 | 3300037418 | Bacteria | 3587 |
| 381 | Ga0395900_0077265 | 3300037418 | Bacteria | 3420 |
| 382 | Ga0395900_0134602 | 3300037418 | Bacteria | 2531 |
| 383 | Ga0395898_0058424 | 3300037466 | Bacteria | 3754 |
| 384 | Ga0395898_0073080 | 3300037466 | Bacteria | 3312 |
| 385 | Ga0395898_0093601 | 3300037466 | Bacteria | 2888 |
| 386 | Ga0395898_0253848 | 3300037466 | Bacteria | 1677 |
| 387 | Ga0395905_0001690 | 3300037471 | Bacteria | 26013 |
| 388 | Ga0395905_0001817 | 3300037471 | Bacteria | 24687 |
| 389 | Ga0395905_0003401 | 3300037471 | Bacteria | 17036 |
| 390 | Ga0395905_0005643 | 3300037471 | Bacteria | 12728 |
| 391 | Ga0395905_0012268 | 3300037471 | Bacteria | 8254 |
| 392 | Ga0395905_0049448 | 3300037471 | Bacteria | 3940 |
| 393 | Ga0395905_0056782 | 3300037471 | Bacteria | 3661 |
| 394 | Ga0395905_0199636 | 3300037471 | Bacteria | 1875 |
| 395 | Ga0436364_0157811 | 3300037853 | Bacteria | 430293 |
| 396 | Ga0436364_0373695 | 3300037853 | Bacteria | 14677 |
| 397 | Ga0436364_0417080 | 3300037853 | Bacteria | 3068 |
| 398 | Ga0436364_0586215 | 3300037853 | Bacteria | 68755 |
| 399 | Ga0436364_1037728 | 3300037853 | Bacteria | 3683 |
| 400 | Ga0436364_1278270 | 3300037853 | Bacteria | 10113 |
| 401 | Ga0436364_1316265 | 3300037853 | Bacteria | 2852 |
| 402 | Ga0436364_1345932 | 3300037853 | Bacteria | 5440 |
| 403 | Ga0395901_0006115 | 3300038443 | Bacteria | 12198 |
| 404 | Ga0395901_0015133 | 3300038443 | Bacteria | 7844 |
| 405 | Ga0395901_0057940 | 3300038443 | Bacteria | 4029 |
| 406 | Ga0395901_0126021 | 3300038443 | Bacteria | 2691 |
| 407 | Ga0436365_0426069 | 3300039437 | Bacteria | 4399 |
| 408 | Ga0436365_0798724 | 3300039437 | Bacteria | 89017 |
| 409 | Ga0436365_0862833 | 3300039437 | Bacteria | 88455 |
| 410 | Ga0436365_1467160 | 3300039437 | Bacteria | 7424 |
| 411 | Ga0436360_0316468 | 3300039438 | Bacteria | 2214 |
| 412 | Ga0436361_0491527 | 3300039447 | Bacteria | 29855 |
| 413 | Ga0436361_0510126 | 3300039447 | Bacteria | 27659 |
| 414 | Ga0436361_0770157 | 3300039447 | Bacteria | 14822 |
| 415 | Ga0436363_0278312 | 3300039450 | Bacteria | 3122 |
| 416 | Ga0436363_0618120 | 3300039450 | Bacteria | 12910 |
| 417 | Ga0436363_0706963 | 3300039450 | Bacteria | 4152 |
| 418 | Ga0436362_0024386 | 3300039453 | Bacteria | 5380 |
| 419 | Ga0436362_0949954 | 3300039453 | Bacteria | 89092 |
| 420 | Ga0439447_000094 | 3300041407 | Bacteria | 31565 |
| 421 | Ga0439461_0004314 | 3300041410 | Bacteria | 2371 |
| 422 | Ga0439466_0000154 | 3300041411 | Bacteria | 27308 |
| 423 | Ga0439465_0000779 | 3300041413 | Bacteria | 9938 |
| 424 | Ga0451795_0814101 | 3300041456 | Bacteria | 1809 |
| 425 | Ga0439431_0000238 | 3300041997 | Bacteria | 11179 |
| 426 | Ga0439442_001068 | 3300042002 | Bacteria | 5524 |
| 427 | Ga0439445_0000152 | 3300042004 | Bacteria | 12156 |
| 428 | Ga0439432_000314 | 3300042006 | Bacteria | 17522 |
| 429 | Ga0439432_029021 | 3300042006 | Bacteria | 1800 |
| 430 | Ga0439449_0018359 | 3300042007 | Bacteria | 2625 |
| 431 | Ga0439462_0000557 | 3300042015 | Bacteria | 7389 |
| 432 | Ga0439458_0000155 | 3300042157 | Bacteria | 15100 |
| 433 | Ga0439434_0000358 | 3300042435 | Bacteria | 13106 |
| 434 | Ga0451577_0000410 | 3300042876 | Bacteria | 77885 |
| 435 | Ga0466969_0002291 | 3300044656 | Bacteria | 10223 |
| 436 | Ga0453683_0004670 | 3300044673 | Bacteria | 9667 |
| 437 | Ga0466966_0045470 | 3300044684 | Bacteria | 2807 |
| 438 | Ga0466961_0022950 | 3300044693 | Bacteria | 4014 |
| 439 | Ga0466963_0000326 | 3300044694 | Bacteria | 21596 |
| 440 | Ga0466963_0176573 | 3300044694 | Bacteria | 1490 |
| 441 | Ga0453684_0002228 | 3300044712 | Bacteria | 48078 |
| 442 | Ga0453684_0002290 | 3300044712 | Bacteria | 47049 |
| 443 | Ga0453684_0009510 | 3300044712 | Bacteria | 16995 |
| 444 | Ga0453684_0053642 | 3300044712 | Bacteria | 5260 |
| 445 | Ga0466970_0054679 | 3300044765 | Bacteria | 2132 |
| 446 | Ga0466957_0001368 | 3300044842 | Bacteria | 12723 |
| 447 | Ga0466957_0006842 | 3300044842 | Bacteria | 6444 |
| 448 | Ga0466957_0078620 | 3300044842 | Bacteria | 2051 |
| 449 | Ga0466959_0093414 | 3300045049 | Bacteria | 2159 |
| 450 | Ga0451576_0000252 | 3300045051 | Bacteria | 132040 |
| 451 | Ga0451576_0038003 | 3300045051 | Bacteria | 5097 |
| 452 | Ga0466958_0058553 | 3300045836 | Bacteria | 2342 |
| 453 | Ga0466967_0000149 | 3300045976 | Bacteria | 27415 |
| 454 | Ga0466967_0039872 | 3300045976 | Bacteria | 4041 |
| 455 | Ga0466967_0084707 | 3300045976 | Bacteria | 2869 |
| 456 | Ga0495627_000172 | 3300046453 | Bacteria | 73650 |
| 457 | Ga0495627_000834 | 3300046453 | Bacteria | 22232 |
| 458 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 459 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 460 | Ga0495650_0006084 | 3300046471 | Bacteria | 7609 |
| 461 | Ga0495605_0000063 | 3300046474 | Bacteria | 140789 |
| 462 | Ga0495584_0000171 | 3300046491 | Bacteria | 45582 |
| 463 | Ga0495584_0005986 | 3300046491 | Bacteria | 6407 |
| 464 | Ga0495584_0014235 | 3300046491 | Bacteria | 4054 |
| 465 | Ga0495594_0000164 | 3300046499 | Bacteria | 31802 |
| 466 | Ga0495594_0086548 | 3300046499 | Bacteria | 1753 |
| 467 | Ga0495596_0000341 | 3300046500 | Bacteria | 30274 |
| 468 | Ga0495607_0011506 | 3300046501 | Bacteria | 5888 |
| 469 | Ga0495607_0022644 | 3300046501 | Bacteria | 3941 |
| 470 | Ga0495607_0049320 | 3300046501 | Bacteria | 2456 |
| 471 | Ga0495583_0000180 | 3300046506 | Bacteria | 108471 |
| 472 | Ga0495606_0003841 | 3300046507 | Bacteria | 15523 |
| 473 | Ga0495606_0008461 | 3300046507 | Bacteria | 8932 |
| 474 | Ga0495606_0064443 | 3300046507 | Bacteria | 2332 |
| 475 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 476 | Ga0495610_0000182 | 3300046512 | Bacteria | 70063 |
| 477 | Ga0495616_0007305 | 3300046513 | Bacteria | 6613 |
| 478 | Ga0495620_0016769 | 3300046515 | Bacteria | 3667 |
| 479 | Ga0495631_0008883 | 3300046518 | Bacteria | 5042 |
| 480 | Ga0495632_0000070 | 3300046519 | Bacteria | 107264 |
| 481 | Ga0495632_0000248 | 3300046519 | Bacteria | 53538 |
| 482 | Ga0495632_0000480 | 3300046519 | Bacteria | 37906 |
| 483 | Ga0495637_0000307 | 3300046520 | Bacteria | 37985 |
| 484 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 485 | Ga0495643_0000110 | 3300046522 | Bacteria | 135600 |
| 486 | Ga0495643_0001129 | 3300046522 | Bacteria | 26367 |
| 487 | Ga0495648_0000151 | 3300046524 | Bacteria | 83011 |
| 488 | Ga0495648_0008824 | 3300046524 | Bacteria | 7888 |
| 489 | Ga0495648_0017791 | 3300046524 | Bacteria | 5067 |
| 490 | Ga0495648_0034818 | 3300046524 | Bacteria | 3272 |
| 491 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 492 | Ga0495598_0007560 | 3300046537 | Bacteria | 2497 |
| 493 | Ga0495597_0000841 | 3300046542 | Bacteria | 24132 |
| 494 | Ga0495633_0000105 | 3300046558 | Bacteria | 113385 |
| 495 | Ga0495633_0000910 | 3300046558 | Bacteria | 25099 |
| 496 | Ga0495633_0020315 | 3300046558 | Bacteria | 3342 |
| 497 | Ga0495668_0000015 | 3300046616 | Bacteria | 441932 |
| 498 | Ga0495668_0057127 | 3300046616 | Bacteria | 2153 |
| 499 | Ga0495611_0002595 | 3300046648 | Bacteria | 8177 |
| 500 | Ga0495625_0000841 | 3300046660 | Bacteria | 42026 |
| 501 | Ga0495661_0049252 | 3300046665 | Bacteria | 2555 |
| 502 | Ga0495669_0000454 | 3300046684 | Bacteria | 19203 |
| 503 | Ga0495669_0007971 | 3300046684 | Bacteria | 4444 |
| 504 | Ga0495669_0032992 | 3300046684 | Bacteria | 2278 |
| 505 | Ga0495670_0000033 | 3300046691 | Bacteria | 81716 |
| 506 | Ga0495670_0004202 | 3300046691 | Bacteria | 7057 |
| 507 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 508 | Ga0495671_0000023 | 3300046692 | Bacteria | 252939 |
| 509 | Ga0495671_0091790 | 3300046692 | Bacteria | 1486 |
| 510 | Ga0495589_0000204 | 3300046794 | Bacteria | 51361 |
| 511 | Ga0495660_0000349 | 3300046810 | Bacteria | 40937 |
| 512 | Ga0495636_0003650 | 3300047318 | Bacteria | 5977 |
| 513 | Ga0495687_000075 | 3300047443 | Bacteria | 152218 |
| 514 | Ga0495687_000578 | 3300047443 | Bacteria | 43065 |
| 515 | Ga0495677_0001651 | 3300047445 | Bacteria | 8962 |
| 516 | Ga0495677_0003663 | 3300047445 | Bacteria | 5944 |
| 517 | Ga0495673_0000054 | 3300047469 | Bacteria | 252207 |
| 518 | Ga0495681_0000064 | 3300047470 | Bacteria | 99007 |
| 519 | Ga0495681_0000322 | 3300047470 | Bacteria | 38088 |
| 520 | Ga0495681_0031141 | 3300047470 | Bacteria | 2706 |
| 521 | Ga0495686_0009434 | 3300047472 | Bacteria | 7030 |
| 522 | Ga0495615_0000128 | 3300048090 | Bacteria | 19080 |
| 523 | Ga0495626_0000618 | 3300048091 | Bacteria | 34677 |
| 524 | Ga0495626_0008050 | 3300048091 | Bacteria | 5816 |
| 525 | Ga0496101_0000325 | 3300048904 | Bacteria | 32628 |
| 526 | Ga0496107_0001305 | 3300048910 | Bacteria | 15271 |
| 527 | Ga0496107_0088270 | 3300048910 | Bacteria | 2264 |
| 528 | Ga0496108_0004818 | 3300048911 | Bacteria | 10885 |
| 529 | Ga0496109_0002536 | 3300048912 | Bacteria | 15301 |
| 530 | Ga0496109_0113120 | 3300048912 | Bacteria | 2524 |
| 531 | Ga0496109_0150260 | 3300048912 | Bacteria | 2181 |
| 532 | Ga0496110_0000100 | 3300048913 | Bacteria | 46561 |
| 533 | Ga0496110_0026788 | 3300048913 | Bacteria | 4937 |
| 534 | Ga0496112_0000364 | 3300048915 | Bacteria | 29565 |
| 535 | Ga0496113_0000086 | 3300048916 | Bacteria | 40370 |
| 536 | Ga0496113_0155068 | 3300048916 | Bacteria | 1808 |
| 537 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 538 | Ga0496115_0000231 | 3300048918 | Bacteria | 50772 |
| 539 | Ga0496115_0004662 | 3300048918 | Bacteria | 9933 |
| 540 | Ga0496116_0000195 | 3300048919 | Bacteria | 120438 |
| 541 | Ga0496117_0016813 | 3300048920 | Bacteria | 6147 |
| 542 | Ga0496118_0039724 | 3300048921 | Bacteria | 3751 |
| 543 | Ga0496119_0037310 | 3300048922 | Bacteria | 3159 |
| 544 | Ga0496120_0021602 | 3300048923 | Bacteria | 4066 |
| 545 | Ga0496121_0000413 | 3300048924 | Bacteria | 84919 |
| 546 | Ga0496121_0009670 | 3300048924 | Bacteria | 11045 |
| 547 | Ga0496122_0003997 | 3300048925 | Bacteria | 18802 |
| 548 | Ga0496122_0010921 | 3300048925 | Bacteria | 9286 |
| 549 | Ga0496122_0045752 | 3300048925 | Bacteria | 3397 |
| 550 | Ga0496123_0002162 | 3300048926 | Bacteria | 25094 |
| 551 | Ga0496123_0003021 | 3300048926 | Bacteria | 19404 |
| 552 | Ga0496124_0000054 | 3300048927 | Bacteria | 252172 |
| 553 | Ga0496124_0000623 | 3300048927 | Bacteria | 59105 |
| 554 | Ga0496124_0000631 | 3300048927 | Bacteria | 58432 |
| 555 | Ga0496124_0008281 | 3300048927 | Bacteria | 10893 |
| 556 | Ga0496124_0058316 | 3300048927 | Bacteria | 3248 |
| 557 | Ga0496125_0000024 | 3300048928 | Bacteria | 442149 |
| 558 | Ga0496125_0024185 | 3300048928 | Bacteria | 5588 |
| 559 | Ga0496126_0000136 | 3300048929 | Bacteria | 167497 |
| 560 | Ga0501310_003040 | 3300049130 | Bacteria | 1626 |
| 561 | Ga0501314_001441 | 3300049530 | Bacteria | 1722 |
| 562 | Ga0501033_0001724 | 3300049570 | Bacteria | 19138 |
| 563 | Ga0501034_0004606 | 3300049571 | Bacteria | 15279 |
| 564 | Ga0501042_0026413 | 3300049578 | Bacteria | 4080 |
| 565 | Ga0501238_000179 | 3300049671 | Bacteria | 9482 |
| 566 | Ga0501249_000015 | 3300049679 | Bacteria | 124336 |
| 567 | Ga0501249_005201 | 3300049679 | Bacteria | 2657 |
| 568 | Ga0501080_0045116 | 3300049742 | Bacteria | 4103 |
| 569 | Ga0501266_000001 | 3300049763 | Bacteria | 562004 |
| 570 | Ga0501044_0221797 | 3300049823 | Bacteria | 1841 |
| 571 | nmdc:mga08x19_13680_c1 | 3300050514 | Bacteria | 4910 |
| 572 | nmdc:mga0a205_1958_c1 | 3300050515 | Bacteria | 17919 |
| 573 | Ga0500566_0000258 | 3300053094 | Bacteria | 28578 |
| 574 | Ga0500641_0000065 | 3300053096 | Bacteria | 42860 |
| 575 | Ga0500641_0000328 | 3300053096 | Bacteria | 17563 |
| 576 | Ga0500594_0014474 | 3300053118 | Bacteria | 1889 |
| 577 | Ga0500594_0022516 | 3300053118 | Bacteria | 1590 |
| 578 | Ga0500595_000624 | 3300053119 | Bacteria | 21192 |
| 579 | Ga0500618_002294 | 3300053125 | Bacteria | 7367 |
| 580 | Ga0500658_0000001 | 3300053134 | Bacteria | 592738 |
| 581 | Ga0500568_0003022 | 3300053139 | Bacteria | 9625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046692 | Ga0495671_0091790 | Ga0495671_0091790_221_1411 | 373 |
| 2 | 3300005434 | Ga0070709_10013162 | Ga0070709_100131622 | 382 |
| 3 | 3300005444 | Ga0070694_100001260 | Ga0070694_1000012606 | 382 |
| 4 | 3300005545 | Ga0070695_100001410 | Ga0070695_1000014102 | 382 |
| 5 | 3300005439 | Ga0070711_100000056 | Ga0070711_10000005653 | 385 |
| 6 | 3300025916 | Ga0207663_10001497 | Ga0207663_100014975 | 385 |
| 7 | 3300006914 | Ga0075436_100028723 | Ga0075436_1000287232 | 409 |
| 8 | 3300050514 | nmdc:mga08x19_13680_c1 | nmdc:mga08x19_13680_c1_964_2277 | 409 |
| 9 | 3300037853 | Ga0436364_0586215 | Ga0436364_0586215_10650_11942 | 413 |
| 10 | 3300003322 | rootL2_10127512 | rootL2_101275123 | 414 |
| 11 | 3300037853 | Ga0436364_1278270 | Ga0436364_1278270_6870_8222 | 423 |
| 12 | 3300005518 | Ga0070699_100017609 | Ga0070699_1000176092 | 424 |
| 13 | 3300039437 | Ga0436365_0426069 | Ga0436365_0426069_1767_3128 | 424 |
| 14 | 3300039450 | Ga0436363_0278312 | Ga0436363_0278312_1374_2735 | 424 |
| 15 | 3300044712 | Ga0453684_0002228 | Ga0453684_0002228_25436_26755 | 424 |
| 16 | 3300045051 | Ga0451576_0038003 | Ga0451576_0038003_2593_3912 | 424 |
| 17 | iso_pu_bacteria | 2513020052 | 2513232885 | 424 |
| 18 | iso_pu_bacteria | 2519899754 | 2520880819 | 424 |
| 19 | iso_pu_bacteria | 2643221600 | 2644012335 | 424 |
| 20 | iso_pu_bacteria | 2643221667 | 2644371597 | 424 |
| 21 | iso_pu_bacteria | 2739367857 | 2740000017 | 424 |
| 22 | iso_pu_bacteria | 2739367858 | 2740004833 | 424 |
| 23 | iso_pu_bacteria | 2816332280 | 2817414466 | 424 |
| 24 | iso_pu_bacteria | 2857613821 | 2857615553 | 424 |
| 25 | iso_pu_bacteria | 2857618242 | 2857622030 | 424 |
| 26 | iso_pu_bacteria | 2881359912 | 2881360763 | 424 |
| 27 | iso_pu_bacteria | 2903895155 | 2903895548 | 424 |
| 28 | iso_pu_bacteria | 2904419702 | 2904424172 | 424 |
| 29 | iso_pu_bacteria | 2919683626 | 2919683873 | 424 |
| 30 | iso_pu_bacteria | 2929150217 | 2929151617 | 424 |
| 31 | iso_pu_bacteria | 2958458903 | 2958459901 | 424 |
| 32 | iso_pu_bacteria | 8054307821 | 8054309172 | 424 |
| 33 | iso_pu_bacteria | 8055592153 | 8055596030 | 424 |
| 34 | iso_pu_bacteria | 8056440228 | 8056442871 | 424 |
| 35 | 3300021388 | Ga0213875_10015587 | Ga0213875_100155873 | 425 |
| 36 | 3300021388 | Ga0213875_10053052 | Ga0213875_100530522 | 425 |
| 37 | 3300037853 | Ga0436364_1037728 | Ga0436364_1037728_875_2248 | 425 |
| 38 | 3300037853 | Ga0436364_1316265 | Ga0436364_1316265_1235_2569 | 425 |
| 39 | 3300039450 | Ga0436363_0618120 | Ga0436363_0618120_8481_9800 | 425 |
| 40 | 3300005435 | Ga0070714_100042885 | Ga0070714_1000428852 | 426 |
| 41 | 3300005614 | Ga0068856_100006709 | Ga0068856_1000067098 | 426 |
| 42 | 3300014326 | Ga0157380_10073493 | Ga0157380_100734932 | 426 |
| 43 | 3300021361 | Ga0213872_10003961 | Ga0213872_100039617 | 426 |
| 44 | 3300021384 | Ga0213876_10004860 | Ga0213876_100048607 | 426 |
| 45 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005264 | 426 |
| 46 | 3300021388 | Ga0213875_10020953 | Ga0213875_100209532 | 426 |
| 47 | 3300025929 | Ga0207664_10193804 | Ga0207664_101938042 | 426 |
| 48 | 3300037853 | Ga0436364_0417080 | Ga0436364_0417080_231_1568 | 426 |
| 49 | 3300037853 | Ga0436364_1345932 | Ga0436364_1345932_905_2251 | 426 |
| 50 | 3300039437 | Ga0436365_1467160 | Ga0436365_1467160_151_1491 | 426 |
| 51 | 3300039438 | Ga0436360_0316468 | Ga0436360_0316468_626_1963 | 426 |
| 52 | 3300039447 | Ga0436361_0510126 | Ga0436361_0510126_20573_21910 | 426 |
| 53 | 3300039453 | Ga0436362_0024386 | Ga0436362_0024386_3148_4485 | 426 |
| 54 | 3300031731 | Ga0307405_10000004 | Ga0307405_10000004142 | 427 |
| 55 | 3300044842 | Ga0466957_0001368 | Ga0466957_0001368_2402_3736 | 427 |
| 56 | 3300048918 | Ga0496115_0004662 | Ga0496115_0004662_3137_4495 | 427 |
| 57 | 3300048928 | Ga0496125_0000024 | Ga0496125_0000024_410677_412035 | 427 |
| 58 | 3300053096 | Ga0500641_0000328 | Ga0500641_0000328_2121_3473 | 427 |
| 59 | iso_pu_bacteria | 2738541276 | 2738716766 | 427 |
| 60 | 3300005293 | Ga0065715_10017692 | Ga0065715_100176922 | 428 |
| 61 | 3300006942 | Ga0099824_1000030 | Ga0099824_100003040 | 428 |
| 62 | 3300006946 | Ga0079104_1000256 | Ga0079104_100025659 | 428 |
| 63 | 3300006948 | Ga0099826_10000148 | Ga0099826_1000014820 | 428 |
| 64 | 3300013104 | Ga0157370_10002213 | Ga0157370_100022133 | 428 |
| 65 | 3300021388 | Ga0213875_10000163 | Ga0213875_1000016364 | 428 |
| 66 | 3300027111 | Ga0209281_1000115 | Ga0209281_100011514 | 428 |
| 67 | 3300027666 | Ga0209282_1033149 | Ga0209282_10331492 | 428 |
| 68 | 3300031548 | Ga0307408_100001219 | Ga0307408_1000012196 | 428 |
| 69 | 3300031824 | Ga0307413_10000007 | Ga0307413_1000000738 | 428 |
| 70 | 3300031852 | Ga0307410_10000879 | Ga0307410_100008794 | 428 |
| 71 | 3300031901 | Ga0307406_10000044 | Ga0307406_1000004413 | 428 |
| 72 | 3300031903 | Ga0307407_10010751 | Ga0307407_100107513 | 428 |
| 73 | 3300032004 | Ga0307414_10000014 | Ga0307414_10000014130 | 428 |
| 74 | 3300032004 | Ga0307414_10073381 | Ga0307414_100733812 | 428 |
| 75 | 3300032005 | Ga0307411_10000002 | Ga0307411_10000002452 | 428 |
| 76 | 3300033180 | Ga0307510_10007193 | Ga0307510_100071934 | 428 |
| 77 | 3300041407 | Ga0439447_000094 | Ga0439447_000094_8773_10125 | 428 |
| 78 | 3300041411 | Ga0439466_0000154 | Ga0439466_0000154_4400_5752 | 428 |
| 79 | 3300048924 | Ga0496121_0009670 | Ga0496121_0009670_6852_8204 | 428 |
| 80 | 3300049130 | Ga0501310_003040 | Ga0501310_003040_213_1565 | 428 |
| 81 | 3300049530 | Ga0501314_001441 | Ga0501314_001441_76_1428 | 428 |
| 82 | 3300049671 | Ga0501238_000179 | Ga0501238_000179_2851_4203 | 428 |
| 83 | 3300049679 | Ga0501249_000015 | Ga0501249_000015_32450_33802 | 428 |
| 84 | 3300049679 | Ga0501249_005201 | Ga0501249_005201_1158_2510 | 428 |
| 85 | 3300049763 | Ga0501266_000001 | Ga0501266_000001_133935_135287 | 428 |
| 86 | 3300053096 | Ga0500641_0000065 | Ga0500641_0000065_18906_20261 | 428 |
| 87 | 3300053118 | Ga0500594_0014474 | Ga0500594_0014474_165_1520 | 428 |
| 88 | 3300053134 | Ga0500658_0000001 | Ga0500658_0000001_313075_314430 | 428 |
| 89 | 3300003323 | rootH1_10024342 | rootH1_100243428 | 429 |
| 90 | 3300041456 | Ga0451795_0814101 | Ga0451795_0814101_40_1416 | 429 |
| 91 | 3300005327 | Ga0070658_10155770 | Ga0070658_101557702 | 430 |
| 92 | 3300037853 | Ga0436364_0157811 | Ga0436364_0157811_285868_287256 | 430 |
| 93 | iso_pu_bacteria | 2887630918 | 2887632527 | 430 |
| 94 | 3300003323 | rootH1_10050362 | rootH1_100503629 | 431 |
| 95 | 3300021361 | Ga0213872_10000002 | Ga0213872_10000002306 | 433 |
| 96 | 3300021361 | Ga0213872_10002079 | Ga0213872_100020799 | 433 |
| 97 | 3300039447 | Ga0436361_0491527 | Ga0436361_0491527_23826_25148 | 433 |
| 98 | 3300039447 | Ga0436361_0770157 | Ga0436361_0770157_4341_5663 | 433 |
| 99 | iso_pu_bacteria | 2690315857 | 2691332228 | 433 |
| 100 | iso_pu_bacteria | 2919534386 | 2919535194 | 433 |
| 101 | 3300003775 | Ga0055524_1000721 | Ga0055524_10007213 | 434 |
| 102 | 3300037466 | Ga0395898_0253848 | Ga0395898_0253848_298_1611 | 434 |
| 103 | 3300046491 | Ga0495584_0005986 | Ga0495584_0005986_4516_5835 | 434 |
| 104 | 3300046491 | Ga0495584_0014235 | Ga0495584_0014235_2201_3520 | 434 |
| 105 | 3300046499 | Ga0495594_0000164 | Ga0495594_0000164_10766_12085 | 434 |
| 106 | 3300046499 | Ga0495594_0086548 | Ga0495594_0086548_41_1360 | 434 |
| 107 | 3300046518 | Ga0495631_0008883 | Ga0495631_0008883_755_2074 | 434 |
| 108 | 3300046542 | Ga0495597_0000841 | Ga0495597_0000841_17630_18949 | 434 |
| 109 | 3300046558 | Ga0495633_0020315 | Ga0495633_0020315_941_2260 | 434 |
| 110 | 3300046648 | Ga0495611_0002595 | Ga0495611_0002595_3032_4351 | 434 |
| 111 | 3300046691 | Ga0495670_0004202 | Ga0495670_0004202_134_1453 | 434 |
| 112 | 3300047318 | Ga0495636_0003650 | Ga0495636_0003650_573_1892 | 434 |
| 113 | 3300047445 | Ga0495677_0001651 | Ga0495677_0001651_686_2005 | 434 |
| 114 | 3300047470 | Ga0495681_0031141 | Ga0495681_0031141_291_1610 | 434 |
| 115 | 3300048091 | Ga0495626_0008050 | Ga0495626_0008050_789_2108 | 434 |
| 116 | 3300002774 | JGI25150J39212_1003968 | JGI25150J39212_10039681 | 435 |
| 117 | 3300003771 | Ga0055526_1002192 | Ga0055526_10021923 | 435 |
| 118 | 3300004625 | Ga0055543_1000603 | Ga0055543_10006034 | 435 |
| 119 | 3300005366 | Ga0070659_100094380 | Ga0070659_1000943802 | 435 |
| 120 | 3300005563 | Ga0068855_100170696 | Ga0068855_1001706962 | 435 |
| 121 | 3300006881 | Ga0068865_100131440 | Ga0068865_1001314401 | 435 |
| 122 | 3300025295 | Ga0209564_1007245 | Ga0209564_10072452 | 435 |
| 123 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_357033_358370 | 435 |
| 124 | 3300046474 | Ga0495605_0000063 | Ga0495605_0000063_24558_25886 | 435 |
| 125 | 3300046491 | Ga0495584_0000171 | Ga0495584_0000171_35182_36516 | 435 |
| 126 | 3300046501 | Ga0495607_0022644 | Ga0495607_0022644_1877_3205 | 435 |
| 127 | 3300046507 | Ga0495606_0003841 | Ga0495606_0003841_5667_7001 | 435 |
| 128 | 3300046507 | Ga0495606_0008461 | Ga0495606_0008461_6505_7842 | 435 |
| 129 | 3300046513 | Ga0495616_0007305 | Ga0495616_0007305_4484_5818 | 435 |
| 130 | 3300046522 | Ga0495643_0001129 | Ga0495643_0001129_15627_16955 | 435 |
| 131 | 3300046524 | Ga0495648_0017791 | Ga0495648_0017791_2238_3572 | 435 |
| 132 | 3300046665 | Ga0495661_0049252 | Ga0495661_0049252_39_1373 | 435 |
| 133 | 3300046794 | Ga0495589_0000204 | Ga0495589_0000204_39774_41102 | 435 |
| 134 | 3300046810 | Ga0495660_0000349 | Ga0495660_0000349_21791_23119 | 435 |
| 135 | 3300047443 | Ga0495687_000075 | Ga0495687_000075_102882_104216 | 435 |
| 136 | 3300047443 | Ga0495687_000578 | Ga0495687_000578_17180_18508 | 435 |
| 137 | 3300047445 | Ga0495677_0003663 | Ga0495677_0003663_32_1360 | 435 |
| 138 | 3300048091 | Ga0495626_0000618 | Ga0495626_0000618_24565_25893 | 435 |
| 139 | 3300048916 | Ga0496113_0155068 | Ga0496113_0155068_411_1739 | 435 |
| 140 | 3300046507 | Ga0495606_0064443 | Ga0495606_0064443_158_1678 | 451 |
| 141 | 3300046500 | Ga0495596_0000341 | Ga0495596_0000341_11397_12914 | 457 |
| 142 | 3300046512 | Ga0495610_0000020 | Ga0495610_0000020_213889_215403 | 457 |
| 143 | 3300046512 | Ga0495610_0000182 | Ga0495610_0000182_9125_10642 | 457 |
| 144 | 3300031728 | Ga0316578_10052930 | Ga0316578_100529301 | 460 |
| 145 | 3300032137 | Ga0316585_10015382 | Ga0316585_100153822 | 460 |
| 146 | 3300042006 | Ga0439432_029021 | Ga0439432_029021_20_1420 | 463 |
| 147 | 3300044694 | Ga0466963_0176573 | Ga0466963_0176573_37_1446 | 464 |
| 148 | 3300046519 | Ga0495632_0000480 | Ga0495632_0000480_32079_33593 | 466 |
| 149 | 3300028558 | Ga0265326_10025541 | Ga0265326_100255411 | 467 |
| 150 | 3300003794 | Ga0055531_10000223 | Ga0055531_1000022336 | 473 |
| 151 | 3300025304 | Ga0209257_1000005 | Ga0209257_10000051308 | 473 |
| 152 | 3300003771 | Ga0055526_1000850 | Ga0055526_10008506 | 474 |
| 153 | 3300025295 | Ga0209564_1001282 | Ga0209564_100128212 | 474 |
| 154 | 3300031728 | Ga0316578_10031811 | Ga0316578_100318112 | 474 |
| 155 | 3300036712 | Ga0316584_0000657 | Ga0316584_0000657_10404_11897 | 474 |
| 156 | 3300005339 | Ga0070660_100005855 | Ga0070660_1000058555 | 476 |
| 157 | 3300025919 | Ga0207657_10014174 | Ga0207657_100141747 | 476 |
| 158 | 3300025932 | Ga0207690_10019305 | Ga0207690_100193052 | 476 |
| 159 | 3300025933 | Ga0207706_10017239 | Ga0207706_100172393 | 476 |
| 160 | 3300026067 | Ga0207678_10046937 | Ga0207678_100469373 | 476 |
| 161 | 3300042876 | Ga0451577_0000410 | Ga0451577_0000410_75532_77046 | 476 |
| 162 | 3300044712 | Ga0453684_0002290 | Ga0453684_0002290_32260_33774 | 476 |
| 163 | 3300044712 | Ga0453684_0009510 | Ga0453684_0009510_9811_11289 | 476 |
| 164 | 3300045051 | Ga0451576_0000252 | Ga0451576_0000252_13300_14814 | 476 |
| 165 | 3300025941 | Ga0207711_10000496 | Ga0207711_1000049639 | 477 |
| 166 | 3300036712 | Ga0316584_0068139 | Ga0316584_0068139_143_1804 | 478 |
| 167 | 3300009147 | Ga0114129_10069408 | Ga0114129_100694082 | 479 |
| 168 | 3300009147 | Ga0114129_10164486 | Ga0114129_101644862 | 479 |
| 169 | 3300025298 | Ga0209050_1005941 | Ga0209050_10059414 | 479 |
| 170 | 3300031731 | Ga0307405_10009917 | Ga0307405_100099172 | 480 |
| 171 | 3300031852 | Ga0307410_10041853 | Ga0307410_100418532 | 480 |
| 172 | 3300031911 | Ga0307412_10008175 | Ga0307412_100081752 | 480 |
| 173 | iso_pu_bacteria | 2928027323 | 2928028979 | 481 |
| 174 | iso_pu_bacteria | 2984555340 | 2984557789 | 481 |
| 175 | iso_pu_bacteria | 2984564862 | 2984567845 | 481 |
| 176 | iso_pu_bacteria | 2993356040 | 2993358896 | 481 |
| 177 | 3300046501 | Ga0495607_0011506 | Ga0495607_0011506_239_1759 | 482 |
| 178 | 3300031995 | Ga0307409_100120519 | Ga0307409_1001205191 | 483 |
| 179 | 3300044656 | Ga0466969_0002291 | Ga0466969_0002291_1054_2580 | 483 |
| 180 | 3300027876 | Ga0209974_10005841 | Ga0209974_100058413 | 484 |
| 181 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_410443_411948 | 484 |
| 182 | 3300046506 | Ga0495583_0000180 | Ga0495583_0000180_43221_44726 | 484 |
| 183 | 3300046524 | Ga0495648_0000151 | Ga0495648_0000151_57872_59377 | 484 |
| 184 | 3300046692 | Ga0495671_0000023 | Ga0495671_0000023_186957_188462 | 484 |
| 185 | 3300047469 | Ga0495673_0000054 | Ga0495673_0000054_186942_188447 | 484 |
| 186 | 3300025929 | Ga0207664_10056599 | Ga0207664_100565992 | 485 |
| 187 | 3300032004 | Ga0307414_10032471 | Ga0307414_100324711 | 485 |
| 188 | 3300032126 | Ga0307415_100007658 | Ga0307415_1000076583 | 485 |
| 189 | 3300002774 | JGI25150J39212_1000324 | JGI25150J39212_100032413 | 486 |
| 190 | 3300003215 | JGI25153J46596_10000093 | JGI25153J46596_1000009320 | 486 |
| 191 | 3300025245 | Ga0207425_1000047 | Ga0207425_10000471 | 486 |
| 192 | 3300025258 | Ga0209129_1002125 | Ga0209129_10021259 | 486 |
| 193 | 3300025292 | Ga0209676_1012243 | Ga0209676_10122432 | 486 |
| 194 | 3300025294 | Ga0209025_1001194 | Ga0209025_10011949 | 486 |
| 195 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009728 | 486 |
| 196 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005440 | 486 |
| 197 | 3300025298 | Ga0209050_1000195 | Ga0209050_100019544 | 486 |
| 198 | 3300025298 | Ga0209050_1012320 | Ga0209050_10123204 | 486 |
| 199 | 3300025303 | Ga0209051_1000414 | Ga0209051_100041443 | 486 |
| 200 | 3300025304 | Ga0209257_1001608 | Ga0209257_10016086 | 486 |
| 201 | 3300025304 | Ga0209257_1001633 | Ga0209257_10016336 | 486 |
| 202 | 3300031852 | Ga0307410_10074262 | Ga0307410_100742622 | 486 |
| 203 | 3300032004 | Ga0307414_10044387 | Ga0307414_100443872 | 486 |
| 204 | iso_pu_bacteria | 2919138771 | 2919142899 | 486 |
| 205 | 3300001990 | JGI24737J22298_10005866 | JGI24737J22298_100058663 | 487 |
| 206 | 3300002077 | JGI24744J21845_10000092 | JGI24744J21845_100000925 | 487 |
| 207 | 3300005338 | Ga0068868_100101971 | Ga0068868_1001019712 | 487 |
| 208 | 3300005355 | Ga0070671_100019561 | Ga0070671_1000195614 | 487 |
| 209 | 3300005356 | Ga0070674_100017587 | Ga0070674_1000175872 | 487 |
| 210 | 3300005564 | Ga0070664_100040150 | Ga0070664_1000401502 | 487 |
| 211 | 3300005578 | Ga0068854_100039463 | Ga0068854_1000394632 | 487 |
| 212 | 3300005618 | Ga0068864_100022152 | Ga0068864_1000221524 | 487 |
| 213 | 3300009098 | Ga0105245_10063340 | Ga0105245_100633401 | 487 |
| 214 | 3300013297 | Ga0157378_10072940 | Ga0157378_100729402 | 487 |
| 215 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006149 | 487 |
| 216 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004655 | 487 |
| 217 | 3300025263 | Ga0209565_1000177 | Ga0209565_100017744 | 487 |
| 218 | 3300025295 | Ga0209564_1006875 | Ga0209564_10068756 | 487 |
| 219 | 3300025315 | Ga0207697_10002878 | Ga0207697_100028782 | 487 |
| 220 | 3300025893 | Ga0207682_10029510 | Ga0207682_100295101 | 487 |
| 221 | 3300025901 | Ga0207688_10008875 | Ga0207688_100088752 | 487 |
| 222 | 3300025908 | Ga0207643_10011785 | Ga0207643_100117852 | 487 |
| 223 | 3300025919 | Ga0207657_10026326 | Ga0207657_100263263 | 487 |
| 224 | 3300025931 | Ga0207644_10010689 | Ga0207644_100106893 | 487 |
| 225 | 3300025933 | Ga0207706_10007565 | Ga0207706_100075655 | 487 |
| 226 | 3300025937 | Ga0207669_10057417 | Ga0207669_100574171 | 487 |
| 227 | 3300025940 | Ga0207691_10031057 | Ga0207691_100310573 | 487 |
| 228 | 3300025942 | Ga0207689_10015713 | Ga0207689_100157135 | 487 |
| 229 | 3300025981 | Ga0207640_10035326 | Ga0207640_100353262 | 487 |
| 230 | 3300026089 | Ga0207648_10009201 | Ga0207648_100092013 | 487 |
| 231 | 3300026121 | Ga0207683_10012421 | Ga0207683_100124214 | 487 |
| 232 | 3300037418 | Ga0395900_0026110 | Ga0395900_0026110_3908_5428 | 487 |
| 233 | 3300037471 | Ga0395905_0012268 | Ga0395905_0012268_5644_7164 | 487 |
| 234 | 3300039437 | Ga0436365_0862833 | Ga0436365_0862833_53600_55102 | 487 |
| 235 | 3300039453 | Ga0436362_0949954 | Ga0436362_0949954_48762_50264 | 487 |
| 236 | 3300048910 | Ga0496107_0088270 | Ga0496107_0088270_350_1870 | 487 |
| 237 | 3300048913 | Ga0496110_0026788 | Ga0496110_0026788_811_2316 | 487 |
| 238 | 3300048922 | Ga0496119_0037310 | Ga0496119_0037310_603_2078 | 487 |
| 239 | 3300049823 | Ga0501044_0221797 | Ga0501044_0221797_248_1723 | 487 |
| 240 | 3300005457 | Ga0070662_100045811 | Ga0070662_1000458112 | 488 |
| 241 | 3300005539 | Ga0068853_100054738 | Ga0068853_1000547382 | 488 |
| 242 | 3300005985 | Ga0081539_10009077 | Ga0081539_100090776 | 488 |
| 243 | 3300025932 | Ga0207690_10002251 | Ga0207690_100022515 | 488 |
| 244 | 3300025933 | Ga0207706_10054124 | Ga0207706_100541242 | 488 |
| 245 | 3300026041 | Ga0207639_10184445 | Ga0207639_101844452 | 488 |
| 246 | 3300037471 | Ga0395905_0001817 | Ga0395905_0001817_6846_8354 | 488 |
| 247 | 3300042157 | Ga0439458_0000155 | Ga0439458_0000155_5861_7372 | 488 |
| 248 | 3300046453 | Ga0495627_000834 | Ga0495627_000834_4411_5886 | 488 |
| 249 | 3300046519 | Ga0495632_0000070 | Ga0495632_0000070_78056_79528 | 488 |
| 250 | 3300046520 | Ga0495637_0000307 | Ga0495637_0000307_27834_29306 | 488 |
| 251 | 3300046522 | Ga0495643_0000010 | Ga0495643_0000010_109365_110837 | 488 |
| 252 | 3300046522 | Ga0495643_0000110 | Ga0495643_0000110_98780_100297 | 488 |
| 253 | 3300046524 | Ga0495648_0008824 | Ga0495648_0008824_2616_4088 | 488 |
| 254 | 3300046524 | Ga0495648_0034818 | Ga0495648_0034818_712_2187 | 488 |
| 255 | 3300046525 | Ga0495663_0000004 | Ga0495663_0000004_78065_79537 | 488 |
| 256 | 3300046537 | Ga0495598_0007560 | Ga0495598_0007560_958_2481 | 488 |
| 257 | 3300046558 | Ga0495633_0000105 | Ga0495633_0000105_3366_4838 | 488 |
| 258 | 3300046558 | Ga0495633_0000910 | Ga0495633_0000910_12119_13591 | 488 |
| 259 | 3300046692 | Ga0495671_0000014 | Ga0495671_0000014_109365_110837 | 488 |
| 260 | 3300047470 | Ga0495681_0000322 | Ga0495681_0000322_27800_29272 | 488 |
| 261 | 3300047472 | Ga0495686_0009434 | Ga0495686_0009434_3528_5000 | 488 |
| 262 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_430624_432144 | 488 |
| 263 | 3300048918 | Ga0496115_0000231 | Ga0496115_0000231_7236_8708 | 488 |
| 264 | 3300048919 | Ga0496116_0000195 | Ga0496116_0000195_25442_26950 | 488 |
| 265 | 3300048925 | Ga0496122_0003997 | Ga0496122_0003997_16040_17548 | 488 |
| 266 | 3300048926 | Ga0496123_0002162 | Ga0496123_0002162_12478_13986 | 488 |
| 267 | 3300048927 | Ga0496124_0000623 | Ga0496124_0000623_25330_26838 | 488 |
| 268 | 3300048928 | Ga0496125_0024185 | Ga0496125_0024185_834_2342 | 488 |
| 269 | 3300048929 | Ga0496126_0000136 | Ga0496126_0000136_1264_2772 | 488 |
| 270 | iso_pu_bacteria | 2990265787 | 2990268742 | 488 |
| 271 | iso_pu_bacteria | 2993693658 | 2993694551 | 488 |
| 272 | 3300005356 | Ga0070674_100004248 | Ga0070674_1000042485 | 489 |
| 273 | 3300005366 | Ga0070659_100052832 | Ga0070659_1000528323 | 489 |
| 274 | 3300005434 | Ga0070709_10025804 | Ga0070709_100258042 | 489 |
| 275 | 3300005435 | Ga0070714_100032886 | Ga0070714_1000328862 | 489 |
| 276 | 3300005436 | Ga0070713_100031712 | Ga0070713_1000317124 | 489 |
| 277 | 3300005457 | Ga0070662_100036920 | Ga0070662_1000369202 | 489 |
| 278 | 3300005459 | Ga0068867_100031850 | Ga0068867_1000318503 | 489 |
| 279 | 3300005614 | Ga0068856_100149059 | Ga0068856_1001490592 | 489 |
| 280 | 3300005718 | Ga0068866_10050927 | Ga0068866_100509272 | 489 |
| 281 | 3300005841 | Ga0068863_100004152 | Ga0068863_1000041527 | 489 |
| 282 | 3300006028 | Ga0070717_10004265 | Ga0070717_100042659 | 489 |
| 283 | 3300006175 | Ga0070712_100004917 | Ga0070712_1000049173 | 489 |
| 284 | 3300006358 | Ga0068871_100005301 | Ga0068871_1000053015 | 489 |
| 285 | 3300009176 | Ga0105242_10082761 | Ga0105242_100827612 | 489 |
| 286 | 3300010375 | Ga0105239_10231107 | Ga0105239_102311072 | 489 |
| 287 | 3300013102 | Ga0157371_10085492 | Ga0157371_100854922 | 489 |
| 288 | 3300013105 | Ga0157369_10086621 | Ga0157369_100866212 | 489 |
| 289 | 3300013105 | Ga0157369_10119780 | Ga0157369_101197802 | 489 |
| 290 | 3300013306 | Ga0163162_10106995 | Ga0163162_101069952 | 489 |
| 291 | 3300014325 | Ga0163163_10124150 | Ga0163163_101241502 | 489 |
| 292 | 3300025904 | Ga0207647_10006949 | Ga0207647_100069494 | 489 |
| 293 | 3300025906 | Ga0207699_10019924 | Ga0207699_100199242 | 489 |
| 294 | 3300025909 | Ga0207705_10012713 | Ga0207705_100127135 | 489 |
| 295 | 3300025915 | Ga0207693_10018850 | Ga0207693_100188504 | 489 |
| 296 | 3300025928 | Ga0207700_10034947 | Ga0207700_100349472 | 489 |
| 297 | 3300025929 | Ga0207664_10069933 | Ga0207664_100699332 | 489 |
| 298 | 3300025933 | Ga0207706_10020890 | Ga0207706_100208902 | 489 |
| 299 | 3300025935 | Ga0207709_10017316 | Ga0207709_100173163 | 489 |
| 300 | 3300025940 | Ga0207691_10010917 | Ga0207691_100109172 | 489 |
| 301 | 3300025941 | Ga0207711_10010559 | Ga0207711_100105594 | 489 |
| 302 | 3300025960 | Ga0207651_10000990 | Ga0207651_100009907 | 489 |
| 303 | 3300025986 | Ga0207658_10144181 | Ga0207658_101441811 | 489 |
| 304 | 3300026078 | Ga0207702_10053077 | Ga0207702_100530773 | 489 |
| 305 | 3300026088 | Ga0207641_10022509 | Ga0207641_100225093 | 489 |
| 306 | 3300026089 | Ga0207648_10021959 | Ga0207648_100219593 | 489 |
| 307 | 3300026142 | Ga0207698_10006283 | Ga0207698_100062832 | 489 |
| 308 | 3300037471 | Ga0395905_0049448 | Ga0395905_0049448_2072_3655 | 489 |
| 309 | 3300046453 | Ga0495627_000172 | Ga0495627_000172_41412_42941 | 489 |
| 310 | 3300046471 | Ga0495650_0006084 | Ga0495650_0006084_4386_5915 | 489 |
| 311 | 3300046519 | Ga0495632_0000248 | Ga0495632_0000248_11899_13404 | 489 |
| 312 | 3300047470 | Ga0495681_0000064 | Ga0495681_0000064_56004_57533 | 489 |
| 313 | 3300048904 | Ga0496101_0000325 | Ga0496101_0000325_21574_23097 | 489 |
| 314 | 3300048910 | Ga0496107_0001305 | Ga0496107_0001305_12520_14043 | 489 |
| 315 | 3300048911 | Ga0496108_0004818 | Ga0496108_0004818_349_1872 | 489 |
| 316 | 3300048912 | Ga0496109_0002536 | Ga0496109_0002536_8728_10251 | 489 |
| 317 | 3300048913 | Ga0496110_0000100 | Ga0496110_0000100_21107_22630 | 489 |
| 318 | 3300048915 | Ga0496112_0000364 | Ga0496112_0000364_18470_19993 | 489 |
| 319 | 3300048916 | Ga0496113_0000086 | Ga0496113_0000086_8300_9823 | 489 |
| 320 | 3300048920 | Ga0496117_0016813 | Ga0496117_0016813_4432_5925 | 489 |
| 321 | 3300048921 | Ga0496118_0039724 | Ga0496118_0039724_409_1902 | 489 |
| 322 | iso_pu_bacteria | 2643221563 | 2643836408 | 489 |
| 323 | iso_pu_bacteria | 2643221608 | 2644052884 | 489 |
| 324 | iso_pu_bacteria | 2852653556 | 2852657257 | 489 |
| 325 | iso_pu_bacteria | 2896253425 | 2896253604 | 489 |
| 326 | 3300025229 | Ga0209147_100288 | Ga0209147_10028820 | 490 |
| 327 | 3300044712 | Ga0453684_0053642 | Ga0453684_0053642_3164_4675 | 490 |
| 328 | 3300053094 | Ga0500566_0000258 | Ga0500566_0000258_22677_24170 | 490 |
| 329 | iso_pu_bacteria | 2599185354 | 2600201437 | 490 |
| 330 | iso_pu_bacteria | 2852680915 | 2852683389 | 490 |
| 331 | iso_pu_bacteria | 2879163058 | 2879165562 | 490 |
| 332 | iso_pu_bacteria | 2946787523 | 2946790828 | 490 |
| 333 | 3300005262 | Ga0065165_1001948 | Ga0065165_10019482 | 491 |
| 334 | 3300031344 | Ga0265316_10004231 | Ga0265316_100042316 | 491 |
| 335 | 3300031344 | Ga0265316_10023635 | Ga0265316_100236352 | 491 |
| 336 | 3300037418 | Ga0395900_0005369 | Ga0395900_0005369_8001_9581 | 491 |
| 337 | 3300044673 | Ga0453683_0004670 | Ga0453683_0004670_5388_6905 | 491 |
| 338 | 3300048924 | Ga0496121_0000413 | Ga0496121_0000413_71060_72544 | 491 |
| 339 | iso_pu_bacteria | 2830075706 | 2830078904 | 491 |
| 340 | iso_pu_bacteria | 8054302542 | 8054307043 | 491 |
| 341 | 3300013105 | Ga0157369_10051485 | Ga0157369_100514854 | 492 |
| 342 | 3300013105 | Ga0157369_10153672 | Ga0157369_101536722 | 492 |
| 343 | 3300037418 | Ga0395900_0017277 | Ga0395900_0017277_5264_6775 | 492 |
| 344 | 3300037466 | Ga0395898_0073080 | Ga0395898_0073080_847_2358 | 492 |
| 345 | 3300037471 | Ga0395905_0003401 | Ga0395905_0003401_8945_10456 | 492 |
| 346 | 3300038443 | Ga0395901_0006115 | Ga0395901_0006115_7476_8987 | 492 |
| 347 | 3300046660 | Ga0495625_0000841 | Ga0495625_0000841_16399_17907 | 492 |
| 348 | 3300048912 | Ga0496109_0113120 | Ga0496109_0113120_657_2171 | 492 |
| 349 | 3300053118 | Ga0500594_0022516 | Ga0500594_0022516_50_1576 | 492 |
| 350 | 3300053119 | Ga0500595_000624 | Ga0500595_000624_6269_7768 | 492 |
| 351 | iso_pu_bacteria | 2599185359 | 2600225137 | 492 |
| 352 | iso_pu_bacteria | 2643221622 | 2644125179 | 492 |
| 353 | iso_pu_bacteria | 2818991466 | 2819713418 | 492 |
| 354 | iso_pu_bacteria | 2928526807 | 2928530337 | 492 |
| 355 | iso_pu_bacteria | 2928968154 | 2928971830 | 492 |
| 356 | 3300003781 | Ga0055536_1000717 | Ga0055536_10007173 | 493 |
| 357 | 3300003781 | Ga0055536_1002872 | Ga0055536_10028724 | 493 |
| 358 | 3300003791 | Ga0055530_10000092 | Ga0055530_1000009216 | 493 |
| 359 | 3300003794 | Ga0055531_10000609 | Ga0055531_100006095 | 493 |
| 360 | 3300025291 | Ga0209675_1000366 | Ga0209675_100036612 | 493 |
| 361 | 3300025292 | Ga0209676_1000045 | Ga0209676_1000045123 | 493 |
| 362 | 3300025292 | Ga0209676_1000133 | Ga0209676_1000133180 | 493 |
| 363 | 3300025298 | Ga0209050_1000067 | Ga0209050_1000067174 | 493 |
| 364 | 3300025304 | Ga0209257_1000132 | Ga0209257_10001327 | 493 |
| 365 | 3300031616 | Ga0307508_10036606 | Ga0307508_100366063 | 493 |
| 366 | 3300031731 | Ga0307405_10080589 | Ga0307405_100805891 | 493 |
| 367 | 3300035170 | Ga0373943_0047327 | Ga0373943_0047327_382_1911 | 493 |
| 368 | 3300053125 | Ga0500618_002294 | Ga0500618_002294_1331_2827 | 493 |
| 369 | 3300053139 | Ga0500568_0003022 | Ga0500568_0003022_6816_8321 | 493 |
| 370 | iso_pu_bacteria | 2896429255 | 2896429593 | 493 |
| 371 | 3300046616 | Ga0495668_0000015 | Ga0495668_0000015_381212_382720 | 494 |
| 372 | 3300048090 | Ga0495615_0000128 | Ga0495615_0000128_7504_9015 | 494 |
| 373 | 3300048923 | Ga0496120_0021602 | Ga0496120_0021602_2210_3700 | 494 |
| 374 | 3300048925 | Ga0496122_0010921 | Ga0496122_0010921_87_1598 | 494 |
| 375 | 3300048925 | Ga0496122_0045752 | Ga0496122_0045752_739_2229 | 494 |
| 376 | 3300048926 | Ga0496123_0003021 | Ga0496123_0003021_7659_9170 | 494 |
| 377 | 3300048927 | Ga0496124_0000054 | Ga0496124_0000054_147322_148812 | 494 |
| 378 | 3300048927 | Ga0496124_0000631 | Ga0496124_0000631_6901_8391 | 494 |
| 379 | 3300048927 | Ga0496124_0058316 | Ga0496124_0058316_1574_3085 | 494 |
| 380 | iso_pu_bacteria | 2818991438 | 2819555063 | 494 |
| 381 | 3300025304 | Ga0209257_1006878 | Ga0209257_10068785 | 495 |
| 382 | 3300045049 | Ga0466959_0093414 | Ga0466959_0093414_393_1895 | 495 |
| 383 | 3300046691 | Ga0495670_0000033 | Ga0495670_0000033_18504_20009 | 495 |
| 384 | 3300003215 | JGI25153J46596_10015682 | JGI25153J46596_100156822 | 496 |
| 385 | 3300003773 | Ga0055537_1000357 | Ga0055537_100035730 | 496 |
| 386 | 3300003775 | Ga0055524_1000361 | Ga0055524_100036126 | 496 |
| 387 | 3300003794 | Ga0055531_10000100 | Ga0055531_1000010093 | 496 |
| 388 | 3300003794 | Ga0055531_10006181 | Ga0055531_100061812 | 496 |
| 389 | 3300005327 | Ga0070658_10000126 | Ga0070658_1000012636 | 496 |
| 390 | 3300005339 | Ga0070660_100000921 | Ga0070660_1000009218 | 496 |
| 391 | 3300005355 | Ga0070671_100012166 | Ga0070671_1000121663 | 496 |
| 392 | 3300005366 | Ga0070659_100003530 | Ga0070659_1000035306 | 496 |
| 393 | 3300009177 | Ga0105248_10200737 | Ga0105248_102007372 | 496 |
| 394 | 3300015690 | Ga0183363_1001 | Ga0183363_1001431 | 496 |
| 395 | 3300021384 | Ga0213876_10000138 | Ga0213876_1000013815 | 496 |
| 396 | 3300021388 | Ga0213875_10007605 | Ga0213875_100076053 | 496 |
| 397 | 3300025263 | Ga0209565_1000011 | Ga0209565_100001132 | 496 |
| 398 | 3300025273 | Ga0209673_1002201 | Ga0209673_100220110 | 496 |
| 399 | 3300025291 | Ga0209675_1005715 | Ga0209675_10057153 | 496 |
| 400 | 3300025297 | Ga0209758_1002209 | Ga0209758_10022093 | 496 |
| 401 | 3300025298 | Ga0209050_1000071 | Ga0209050_1000071117 | 496 |
| 402 | 3300025298 | Ga0209050_1001014 | Ga0209050_100101431 | 496 |
| 403 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016567 | 496 |
| 404 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027186 | 496 |
| 405 | 3300025304 | Ga0209257_1004785 | Ga0209257_10047855 | 496 |
| 406 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002930 | 496 |
| 407 | 3300025914 | Ga0207671_10096496 | Ga0207671_100964962 | 496 |
| 408 | 3300025919 | Ga0207657_10004995 | Ga0207657_100049952 | 496 |
| 409 | 3300025941 | Ga0207711_10136940 | Ga0207711_101369402 | 496 |
| 410 | 3300037418 | Ga0395900_0134602 | Ga0395900_0134602_470_1975 | 496 |
| 411 | 3300037466 | Ga0395898_0058424 | Ga0395898_0058424_706_2211 | 496 |
| 412 | 3300037471 | Ga0395905_0005643 | Ga0395905_0005643_213_1718 | 496 |
| 413 | 3300037853 | Ga0436364_0373695 | Ga0436364_0373695_5082_6608 | 496 |
| 414 | 3300039437 | Ga0436365_0798724 | Ga0436365_0798724_21708_23204 | 496 |
| 415 | 3300039450 | Ga0436363_0706963 | Ga0436363_0706963_1696_3192 | 496 |
| 416 | 3300041410 | Ga0439461_0004314 | Ga0439461_0004314_208_1701 | 496 |
| 417 | 3300041413 | Ga0439465_0000779 | Ga0439465_0000779_4658_6154 | 496 |
| 418 | 3300041997 | Ga0439431_0000238 | Ga0439431_0000238_3757_5253 | 496 |
| 419 | 3300042002 | Ga0439442_001068 | Ga0439442_001068_2753_4249 | 496 |
| 420 | 3300042004 | Ga0439445_0000152 | Ga0439445_0000152_3461_4957 | 496 |
| 421 | 3300042006 | Ga0439432_000314 | Ga0439432_000314_7126_8622 | 496 |
| 422 | 3300042015 | Ga0439462_0000557 | Ga0439462_0000557_606_2102 | 496 |
| 423 | 3300042435 | Ga0439434_0000358 | Ga0439434_0000358_10904_12400 | 496 |
| 424 | 3300045976 | Ga0466967_0039872 | Ga0466967_0039872_519_2024 | 496 |
| 425 | 3300045976 | Ga0466967_0084707 | Ga0466967_0084707_104_1618 | 496 |
| 426 | 3300046515 | Ga0495620_0016769 | Ga0495620_0016769_493_1992 | 496 |
| 427 | 3300046616 | Ga0495668_0057127 | Ga0495668_0057127_491_2056 | 496 |
| 428 | 3300046684 | Ga0495669_0000454 | Ga0495669_0000454_9569_11134 | 496 |
| 429 | 3300046684 | Ga0495669_0007971 | Ga0495669_0007971_1249_2814 | 496 |
| 430 | 3300048912 | Ga0496109_0150260 | Ga0496109_0150260_439_1944 | 496 |
| 431 | 3300048927 | Ga0496124_0008281 | Ga0496124_0008281_1718_3214 | 496 |
| 432 | 3300049570 | Ga0501033_0001724 | Ga0501033_0001724_8861_10384 | 496 |
| 433 | 3300049571 | Ga0501034_0004606 | Ga0501034_0004606_328_1851 | 496 |
| 434 | 3300005333 | Ga0070677_10000776 | Ga0070677_1000077610 | 497 |
| 435 | 3300005347 | Ga0070668_100034769 | Ga0070668_1000347693 | 497 |
| 436 | 3300005353 | Ga0070669_100005619 | Ga0070669_1000056194 | 497 |
| 437 | 3300005354 | Ga0070675_100003209 | Ga0070675_1000032093 | 497 |
| 438 | 3300005548 | Ga0070665_100071880 | Ga0070665_1000718803 | 497 |
| 439 | 3300005985 | Ga0081539_10014271 | Ga0081539_100142716 | 497 |
| 440 | 3300014326 | Ga0157380_10002530 | Ga0157380_100025304 | 497 |
| 441 | 3300025893 | Ga0207682_10002044 | Ga0207682_100020446 | 497 |
| 442 | 3300025923 | Ga0207681_10029467 | Ga0207681_100294671 | 497 |
| 443 | 3300025925 | Ga0207650_10009190 | Ga0207650_100091903 | 497 |
| 444 | 3300025933 | Ga0207706_10050328 | Ga0207706_100503283 | 497 |
| 445 | 3300025933 | Ga0207706_10076453 | Ga0207706_100764533 | 497 |
| 446 | 3300025940 | Ga0207691_10187079 | Ga0207691_101870792 | 497 |
| 447 | 3300026121 | Ga0207683_10146835 | Ga0207683_101468352 | 497 |
| 448 | 3300028379 | Ga0268266_10008869 | Ga0268266_100088698 | 497 |
| 449 | 3300031731 | Ga0307405_10032401 | Ga0307405_100324013 | 497 |
| 450 | 3300031852 | Ga0307410_10007304 | Ga0307410_100073043 | 497 |
| 451 | 3300031852 | Ga0307410_10089479 | Ga0307410_100894792 | 497 |
| 452 | 3300031901 | Ga0307406_10126904 | Ga0307406_101269041 | 497 |
| 453 | 3300031911 | Ga0307412_10004709 | Ga0307412_100047095 | 497 |
| 454 | 3300031995 | Ga0307409_100000126 | Ga0307409_10000012619 | 497 |
| 455 | 3300032002 | Ga0307416_100039255 | Ga0307416_1000392553 | 497 |
| 456 | 3300032002 | Ga0307416_100092270 | Ga0307416_1000922702 | 497 |
| 457 | 3300032002 | Ga0307416_100162193 | Ga0307416_1001621931 | 497 |
| 458 | 3300032002 | Ga0307416_100245032 | Ga0307416_1002450322 | 497 |
| 459 | 3300032004 | Ga0307414_10005163 | Ga0307414_100051632 | 497 |
| 460 | 3300032005 | Ga0307411_10000168 | Ga0307411_100001685 | 497 |
| 461 | 3300032005 | Ga0307411_10051596 | Ga0307411_100515962 | 497 |
| 462 | 3300032126 | Ga0307415_100007831 | Ga0307415_1000078313 | 497 |
| 463 | 3300037466 | Ga0395898_0093601 | Ga0395898_0093601_705_2198 | 497 |
| 464 | 3300037471 | Ga0395905_0001690 | Ga0395905_0001690_14524_16032 | 497 |
| 465 | 3300038443 | Ga0395901_0015133 | Ga0395901_0015133_2814_4322 | 497 |
| 466 | 3300042007 | Ga0439449_0018359 | Ga0439449_0018359_425_1927 | 497 |
| 467 | 3300049578 | Ga0501042_0026413 | Ga0501042_0026413_1829_3442 | 497 |
| 468 | 3300049742 | Ga0501080_0045116 | Ga0501080_0045116_1039_2595 | 497 |
| 469 | 3300001990 | JGI24737J22298_10002017 | JGI24737J22298_100020172 | 498 |
| 470 | 3300005327 | Ga0070658_10006493 | Ga0070658_100064935 | 498 |
| 471 | 3300005328 | Ga0070676_10002591 | Ga0070676_100025916 | 498 |
| 472 | 3300005328 | Ga0070676_10012477 | Ga0070676_100124773 | 498 |
| 473 | 3300005331 | Ga0070670_100003903 | Ga0070670_1000039033 | 498 |
| 474 | 3300005334 | Ga0068869_100000448 | Ga0068869_10000044810 | 498 |
| 475 | 3300005335 | Ga0070666_10010617 | Ga0070666_100106174 | 498 |
| 476 | 3300005338 | Ga0068868_100001969 | Ga0068868_1000019696 | 498 |
| 477 | 3300005339 | Ga0070660_100014704 | Ga0070660_1000147041 | 498 |
| 478 | 3300005339 | Ga0070660_100023827 | Ga0070660_1000238272 | 498 |
| 479 | 3300005345 | Ga0070692_10004884 | Ga0070692_100048846 | 498 |
| 480 | 3300005345 | Ga0070692_10020068 | Ga0070692_100200682 | 498 |
| 481 | 3300005347 | Ga0070668_100004822 | Ga0070668_1000048224 | 498 |
| 482 | 3300005347 | Ga0070668_100052128 | Ga0070668_1000521282 | 498 |
| 483 | 3300005353 | Ga0070669_100006160 | Ga0070669_1000061602 | 498 |
| 484 | 3300005355 | Ga0070671_100038689 | Ga0070671_1000386893 | 498 |
| 485 | 3300005356 | Ga0070674_100042674 | Ga0070674_1000426742 | 498 |
| 486 | 3300005364 | Ga0070673_100009404 | Ga0070673_1000094046 | 498 |
| 487 | 3300005364 | Ga0070673_100087221 | Ga0070673_1000872212 | 498 |
| 488 | 3300005366 | Ga0070659_100004141 | Ga0070659_1000041414 | 498 |
| 489 | 3300005367 | Ga0070667_100010506 | Ga0070667_1000105062 | 498 |
| 490 | 3300005367 | Ga0070667_100016087 | Ga0070667_1000160874 | 498 |
| 491 | 3300005456 | Ga0070678_100029833 | Ga0070678_1000298333 | 498 |
| 492 | 3300005457 | Ga0070662_100001271 | Ga0070662_1000012712 | 498 |
| 493 | 3300005459 | Ga0068867_100003211 | Ga0068867_1000032118 | 498 |
| 494 | 3300005459 | Ga0068867_100019298 | Ga0068867_1000192982 | 498 |
| 495 | 3300005543 | Ga0070672_100022246 | Ga0070672_1000222463 | 498 |
| 496 | 3300005548 | Ga0070665_100000905 | Ga0070665_1000009054 | 498 |
| 497 | 3300005548 | Ga0070665_100007805 | Ga0070665_1000078052 | 498 |
| 498 | 3300005563 | Ga0068855_100002466 | Ga0068855_10000246611 | 498 |
| 499 | 3300005563 | Ga0068855_100185406 | Ga0068855_1001854062 | 498 |
| 500 | 3300005564 | Ga0070664_100056833 | Ga0070664_1000568332 | 498 |
| 501 | 3300005578 | Ga0068854_100006975 | Ga0068854_1000069758 | 498 |
| 502 | 3300005614 | Ga0068856_100201311 | Ga0068856_1002013112 | 498 |
| 503 | 3300005616 | Ga0068852_100001133 | Ga0068852_1000011336 | 498 |
| 504 | 3300005616 | Ga0068852_100024888 | Ga0068852_1000248883 | 498 |
| 505 | 3300005617 | Ga0068859_100001175 | Ga0068859_1000011756 | 498 |
| 506 | 3300005618 | Ga0068864_100005277 | Ga0068864_1000052772 | 498 |
| 507 | 3300005834 | Ga0068851_10014247 | Ga0068851_100142472 | 498 |
| 508 | 3300005842 | Ga0068858_100004433 | Ga0068858_1000044338 | 498 |
| 509 | 3300005842 | Ga0068858_100029916 | Ga0068858_1000299161 | 498 |
| 510 | 3300005843 | Ga0068860_100007652 | Ga0068860_10000765210 | 498 |
| 511 | 3300005843 | Ga0068860_100009218 | Ga0068860_1000092187 | 498 |
| 512 | 3300005844 | Ga0068862_100094392 | Ga0068862_1000943922 | 498 |
| 513 | 3300005844 | Ga0068862_100149173 | Ga0068862_1001491731 | 498 |
| 514 | 3300006852 | Ga0075433_10003773 | Ga0075433_100037739 | 498 |
| 515 | 3300006931 | Ga0097620_100001175 | Ga0097620_1000011756 | 498 |
| 516 | 3300009093 | Ga0105240_10166068 | Ga0105240_101660682 | 498 |
| 517 | 3300009098 | Ga0105245_10003165 | Ga0105245_100031654 | 498 |
| 518 | 3300009174 | Ga0105241_10094491 | Ga0105241_100944911 | 498 |
| 519 | 3300009177 | Ga0105248_10000960 | Ga0105248_1000096024 | 498 |
| 520 | 3300009553 | Ga0105249_10001260 | Ga0105249_100012604 | 498 |
| 521 | 3300010375 | Ga0105239_10050417 | Ga0105239_100504172 | 498 |
| 522 | 3300011119 | Ga0105246_10005729 | Ga0105246_100057294 | 498 |
| 523 | 3300011119 | Ga0105246_10036060 | Ga0105246_100360602 | 498 |
| 524 | 3300013100 | Ga0157373_10005567 | Ga0157373_100055676 | 498 |
| 525 | 3300013102 | Ga0157371_10003227 | Ga0157371_100032273 | 498 |
| 526 | 3300013297 | Ga0157378_10008051 | Ga0157378_100080513 | 498 |
| 527 | 3300025315 | Ga0207697_10000038 | Ga0207697_1000003840 | 498 |
| 528 | 3300025321 | Ga0207656_10000684 | Ga0207656_100006847 | 498 |
| 529 | 3300025903 | Ga0207680_10041105 | Ga0207680_100411052 | 498 |
| 530 | 3300025903 | Ga0207680_10083205 | Ga0207680_100832051 | 498 |
| 531 | 3300025904 | Ga0207647_10000047 | Ga0207647_1000004795 | 498 |
| 532 | 3300025904 | Ga0207647_10000509 | Ga0207647_1000050911 | 498 |
| 533 | 3300025907 | Ga0207645_10035294 | Ga0207645_100352942 | 498 |
| 534 | 3300025909 | Ga0207705_10099653 | Ga0207705_100996531 | 498 |
| 535 | 3300025911 | Ga0207654_10066566 | Ga0207654_100665662 | 498 |
| 536 | 3300025919 | Ga0207657_10031889 | Ga0207657_100318891 | 498 |
| 537 | 3300025923 | Ga0207681_10001354 | Ga0207681_100013543 | 498 |
| 538 | 3300025931 | Ga0207644_10027059 | Ga0207644_100270592 | 498 |
| 539 | 3300025932 | Ga0207690_10004693 | Ga0207690_100046932 | 498 |
| 540 | 3300025933 | Ga0207706_10000857 | Ga0207706_1000085718 | 498 |
| 541 | 3300025933 | Ga0207706_10052387 | Ga0207706_100523871 | 498 |
| 542 | 3300025936 | Ga0207670_10022046 | Ga0207670_100220461 | 498 |
| 543 | 3300025938 | Ga0207704_10143228 | Ga0207704_101432281 | 498 |
| 544 | 3300025940 | Ga0207691_10000672 | Ga0207691_100006728 | 498 |
| 545 | 3300025940 | Ga0207691_10002554 | Ga0207691_100025543 | 498 |
| 546 | 3300025941 | Ga0207711_10021022 | Ga0207711_100210223 | 498 |
| 547 | 3300025942 | Ga0207689_10000190 | Ga0207689_1000019041 | 498 |
| 548 | 3300025949 | Ga0207667_10031142 | Ga0207667_100311424 | 498 |
| 549 | 3300025960 | Ga0207651_10000287 | Ga0207651_1000028711 | 498 |
| 550 | 3300025960 | Ga0207651_10031604 | Ga0207651_100316042 | 498 |
| 551 | 3300025960 | Ga0207651_10124119 | Ga0207651_101241191 | 498 |
| 552 | 3300025961 | Ga0207712_10000280 | Ga0207712_1000028023 | 498 |
| 553 | 3300025986 | Ga0207658_10027128 | Ga0207658_100271284 | 498 |
| 554 | 3300026023 | Ga0207677_10003280 | Ga0207677_100032804 | 498 |
| 555 | 3300026035 | Ga0207703_10004007 | Ga0207703_100040077 | 498 |
| 556 | 3300026035 | Ga0207703_10008076 | Ga0207703_100080762 | 498 |
| 557 | 3300026088 | Ga0207641_10020578 | Ga0207641_100205782 | 498 |
| 558 | 3300026089 | Ga0207648_10008175 | Ga0207648_100081754 | 498 |
| 559 | 3300026089 | Ga0207648_10015911 | Ga0207648_100159117 | 498 |
| 560 | 3300026095 | Ga0207676_10003827 | Ga0207676_100038275 | 498 |
| 561 | 3300026116 | Ga0207674_10020538 | Ga0207674_100205385 | 498 |
| 562 | 3300026116 | Ga0207674_10075707 | Ga0207674_100757073 | 498 |
| 563 | 3300026118 | Ga0207675_100135922 | Ga0207675_1001359222 | 498 |
| 564 | 3300026142 | Ga0207698_10011190 | Ga0207698_100111903 | 498 |
| 565 | 3300028379 | Ga0268266_10000423 | Ga0268266_1000042318 | 498 |
| 566 | 3300028379 | Ga0268266_10006759 | Ga0268266_100067595 | 498 |
| 567 | 3300028380 | Ga0268265_10003997 | Ga0268265_1000399710 | 498 |
| 568 | 3300028380 | Ga0268265_10007583 | Ga0268265_100075832 | 498 |
| 569 | 3300028381 | Ga0268264_10003154 | Ga0268264_100031549 | 498 |
| 570 | 3300028381 | Ga0268264_10007972 | Ga0268264_100079728 | 498 |
| 571 | 3300028381 | Ga0268264_10018910 | Ga0268264_100189102 | 498 |
| 572 | 3300031824 | Ga0307413_10011708 | Ga0307413_100117082 | 498 |
| 573 | 3300031995 | Ga0307409_100233516 | Ga0307409_1002335161 | 498 |
| 574 | 3300037312 | Ga0395899_0015906 | Ga0395899_0015906_485_1996 | 498 |
| 575 | 3300037312 | Ga0395899_0073235 | Ga0395899_0073235_826_2337 | 498 |
| 576 | 3300037418 | Ga0395900_0008230 | Ga0395900_0008230_7049_8566 | 498 |
| 577 | 3300037418 | Ga0395900_0047646 | Ga0395900_0047646_1313_2833 | 498 |
| 578 | 3300037418 | Ga0395900_0070727 | Ga0395900_0070727_380_1891 | 498 |
| 579 | 3300037418 | Ga0395900_0077265 | Ga0395900_0077265_1166_2677 | 498 |
| 580 | 3300037471 | Ga0395905_0056782 | Ga0395905_0056782_698_2209 | 498 |
| 581 | 3300037471 | Ga0395905_0199636 | Ga0395905_0199636_294_1826 | 498 |
| 582 | 3300038443 | Ga0395901_0057940 | Ga0395901_0057940_1492_3003 | 498 |
| 583 | 3300038443 | Ga0395901_0126021 | Ga0395901_0126021_1138_2661 | 498 |
| 584 | 3300046501 | Ga0495607_0049320 | Ga0495607_0049320_860_2446 | 498 |
| 585 | 3300046684 | Ga0495669_0032992 | Ga0495669_0032992_333_1847 | 498 |
| 586 | 3300050515 | nmdc:mga0a205_1958_c1 | nmdc:mga0a205_1958_c1_15448_16962 | 498 |
| 587 | 3300001989 | JGI24739J22299_10002025 | JGI24739J22299_100020252 | 499 |
| 588 | 3300005329 | Ga0070683_100015689 | Ga0070683_1000156892 | 499 |
| 589 | 3300005331 | Ga0070670_100026650 | Ga0070670_1000266503 | 499 |
| 590 | 3300005335 | Ga0070666_10013961 | Ga0070666_100139611 | 499 |
| 591 | 3300005338 | Ga0068868_100159793 | Ga0068868_1001597931 | 499 |
| 592 | 3300005344 | Ga0070661_100004370 | Ga0070661_1000043705 | 499 |
| 593 | 3300005355 | Ga0070671_100001233 | Ga0070671_1000012339 | 499 |
| 594 | 3300005364 | Ga0070673_100004233 | Ga0070673_1000042334 | 499 |
| 595 | 3300005367 | Ga0070667_100007904 | Ga0070667_1000079044 | 499 |
| 596 | 3300005455 | Ga0070663_100036273 | Ga0070663_1000362733 | 499 |
| 597 | 3300005455 | Ga0070663_100041855 | Ga0070663_1000418552 | 499 |
| 598 | 3300005457 | Ga0070662_100031608 | Ga0070662_1000316082 | 499 |
| 599 | 3300005548 | Ga0070665_100021722 | Ga0070665_1000217224 | 499 |
| 600 | 3300005564 | Ga0070664_100000197 | Ga0070664_1000001977 | 499 |
| 601 | 3300005578 | Ga0068854_100043706 | Ga0068854_1000437063 | 499 |
| 602 | 3300005614 | Ga0068856_100011902 | Ga0068856_1000119026 | 499 |
| 603 | 3300005616 | Ga0068852_100026985 | Ga0068852_1000269851 | 499 |
| 604 | 3300005985 | Ga0081539_10009122 | Ga0081539_100091222 | 499 |
| 605 | 3300013102 | Ga0157371_10031261 | Ga0157371_100312612 | 499 |
| 606 | 3300025903 | Ga0207680_10058330 | Ga0207680_100583302 | 499 |
| 607 | 3300025919 | Ga0207657_10017906 | Ga0207657_100179065 | 499 |
| 608 | 3300025925 | Ga0207650_10004732 | Ga0207650_100047324 | 499 |
| 609 | 3300025925 | Ga0207650_10090567 | Ga0207650_100905672 | 499 |
| 610 | 3300025931 | Ga0207644_10000699 | Ga0207644_100006999 | 499 |
| 611 | 3300025933 | Ga0207706_10047188 | Ga0207706_100471883 | 499 |
| 612 | 3300025933 | Ga0207706_10074372 | Ga0207706_100743723 | 499 |
| 613 | 3300025937 | Ga0207669_10031408 | Ga0207669_100314082 | 499 |
| 614 | 3300025945 | Ga0207679_10005414 | Ga0207679_100054147 | 499 |
| 615 | 3300026067 | Ga0207678_10012762 | Ga0207678_100127623 | 499 |
| 616 | 3300026078 | Ga0207702_10006625 | Ga0207702_100066258 | 499 |
| 617 | 3300026095 | Ga0207676_10002566 | Ga0207676_100025663 | 499 |
| 618 | 3300026116 | Ga0207674_10001422 | Ga0207674_1000142222 | 499 |
| 619 | 3300026121 | Ga0207683_10058239 | Ga0207683_100582392 | 499 |
| 620 | 3300044684 | Ga0466966_0045470 | Ga0466966_0045470_355_1938 | 499 |
| 621 | 3300044693 | Ga0466961_0022950 | Ga0466961_0022950_916_2499 | 499 |
| 622 | 3300044694 | Ga0466963_0000326 | Ga0466963_0000326_10031_11557 | 499 |
| 623 | 3300044765 | Ga0466970_0054679 | Ga0466970_0054679_474_2057 | 499 |
| 624 | 3300044842 | Ga0466957_0006842 | Ga0466957_0006842_1148_2674 | 499 |
| 625 | 3300044842 | Ga0466957_0078620 | Ga0466957_0078620_168_1751 | 499 |
| 626 | 3300045836 | Ga0466958_0058553 | Ga0466958_0058553_213_1796 | 499 |
| 627 | 3300045976 | Ga0466967_0000149 | Ga0466967_0000149_5552_7078 | 499 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8jt9-assembly1.cif.gz_A | human vmat2 complex with ketanserin | 0.7922 | 17 | 494 |
| 8hpj-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form | 0.7893 | 13 | 487 |
| 7lo7-assembly1.cif.gz_Z | nora in complex with fab25 | 0.7891 | 14 | 488 |
| 6lyy-assembly1.cif.gz_A | cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. | 0.7877 | 8 | 490 |
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.7871 | 17 | 494 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FB53_277_463_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8831 | 15 | 205 | 1.20.1250.20 |
| af_A4HTX4_43_271_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8818 | 21 | 205 | 1.20.1250.20 |
| af_F1Q8H2_217_537_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8814 | 299 | 496 | 1.20.1250.20 |
| af_P9WLG3_19_213_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.881 | 13 | 202 | 1.20.1250.20 |
| af_Q9W509_423_624_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8808 | 10 | 204 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520EI61-F1-model_v4 | deleted | 0.9947 | 308 | 494 |
|
| AF-A0A2W4YSZ6-F1-model_v4 | MFS transporter | 0.9863 | 6 | 499 |
GO:0016020
GO:0022857 |
| AF-A0A2N5Z552-F1-model_v4 | MFS transporter | 0.9847 | 6 | 203 |
GO:0016020
GO:0022857 |
| AF-A0A7C1DYW7-F1-model_v4 | MFS transporter | 0.9817 | 7 | 218 |
GO:0016020
GO:0022857 |
| AF-A0A7V8A7L8-F1-model_v4 | MFS transporter | 0.9812 | 294 | 499 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar