F470534

General Info

Members Datasets Scaffolds Average Seq Length
627 343 581 487

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10020068|Ga0070692_100200682
Length 543
Sequence VHATLKPKLGFAQLWNISFGFFGIQVGFALQNANMSRIFQSLGTSIDTLPALWVAAPLTGLLVQPVIGHMSDRTWLGRLGRRRPYFLAGAILAGLALFAMPEAPALLFAALLLWVLDASLNISMEPFRAFVGDMLPRDQHSAGYAMQTAFIGAGAVVGSIVPWALERFGVSNAAPGGGIPDTVRFAFWLGGGALVLAVLWTVVTTREFSPEELARFEAAAEAEEDHALRVLAARTYRSSGLWAAAGAAVVLAVLRLGLEKEVYLLGGLLLAYGLASAXXIALAKSGRSAGMLCHIVGDFSGMPPVMKRLALVQFFSWSALFIMWINTTPVVAQVFYGAPDATGPVYQEGANWVDVLFAAYNGVAAVAALALLPFVARAIGRVRTHVAALLCGALGYASFFFIRDPKLLLLSEVGIGIAWASILAMPYAILASSLPQKKLGIFMGLFNVFVVVPQLLVATVMGSIMKHFFPGQPIWTMAFAAGVMALAALAMLRVEEPPVILPGTGRGTMRSMVEGGLCQVLDPLHHAASRRGPPPRPGEEQNR

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
9 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
10 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
11 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
15 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
16 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
17 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
18 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
19 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
20 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
21 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
22 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
23 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
24 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
25 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
26 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
27 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
28 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
29 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
30 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
31 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
32 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
33 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
34 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
35 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
36 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
37 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
38 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
39 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
40 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
41 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
42 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
45 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
237 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
243 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
244 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
280 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
327 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
341 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
342 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
343 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.34
Metatranscriptomes 0.32
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 9.57
Nodule 0.8
Rhizoplane 2.87
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002025 3300001989 Bacteria 7755
2 JGI24737J22298_10002017 3300001990 Bacteria 7252
3 JGI24737J22298_10005866 3300001990 Bacteria 4226
4 JGI24744J21845_10000092 3300002077 Bacteria 11841
5 JGI25150J39212_1000324 3300002774 Bacteria 23500
6 JGI25150J39212_1003968 3300002774 Bacteria 3369
7 JGI25153J46596_10000093 3300003215 Bacteria 103442
8 JGI25153J46596_10015682 3300003215 Bacteria 3072
9 rootL2_10127512 3300003322 Bacteria 3371
10 rootH1_10024342 3300003323 Bacteria 18481
11 rootH1_10050362 3300003323 Bacteria 10703
12 Ga0055526_1000850 3300003771 Bacteria 22751
13 Ga0055526_1002192 3300003771 Bacteria 13396
14 Ga0055537_1000357 3300003773 Bacteria 31036
15 Ga0055524_1000361 3300003775 Bacteria 40768
16 Ga0055524_1000721 3300003775 Bacteria 22672
17 Ga0055536_1000717 3300003781 Bacteria 22204
18 Ga0055536_1002872 3300003781 Bacteria 9486
19 Ga0055530_10000092 3300003791 Bacteria 77982
20 Ga0055531_10000100 3300003794 Bacteria 93692
21 Ga0055531_10000223 3300003794 Bacteria 62728
22 Ga0055531_10000609 3300003794 Bacteria 31067
23 Ga0055531_10006181 3300003794 Bacteria 6842
24 Ga0055543_1000603 3300004625 Bacteria 19476
25 Ga0065165_1001948 3300005262 Bacteria 19602
26 Ga0065715_10017692 3300005293 Bacteria 2192
27 Ga0070658_10000126 3300005327 Bacteria 67900
28 Ga0070658_10006493 3300005327 Bacteria 9479
29 Ga0070658_10155770 3300005327 Bacteria 1915
30 Ga0070676_10002591 3300005328 Bacteria 9298
31 Ga0070676_10012477 3300005328 Bacteria 4640
32 Ga0070683_100015689 3300005329 Bacteria 6660
33 Ga0070670_100003903 3300005331 Bacteria 12436
34 Ga0070670_100026650 3300005331 Bacteria 4972
35 Ga0070677_10000776 3300005333 Bacteria 10645
36 Ga0068869_100000448 3300005334 Bacteria 22602
37 Ga0070666_10010617 3300005335 Bacteria 5764
38 Ga0070666_10013961 3300005335 Bacteria 5106
39 Ga0068868_100001969 3300005338 Bacteria 14079
40 Ga0068868_100101971 3300005338 Bacteria 2323
41 Ga0068868_100159793 3300005338 Bacteria 1860
42 Ga0070660_100000921 3300005339 Bacteria 19669
43 Ga0070660_100005855 3300005339 Bacteria 8510
44 Ga0070660_100014704 3300005339 Bacteria 5646
45 Ga0070660_100023827 3300005339 Bacteria 4537
46 Ga0070661_100004370 3300005344 Bacteria 9746
47 Ga0070692_10004884 3300005345 Bacteria 5644
48 Ga0070692_10020068 3300005345 Bacteria 3235
49 Ga0070668_100004822 3300005347 Bacteria 9999
50 Ga0070668_100034769 3300005347 Bacteria 3841
51 Ga0070668_100052128 3300005347 Bacteria 3153
52 Ga0070669_100005619 3300005353 Bacteria 9062
53 Ga0070669_100006160 3300005353 Bacteria 8659
54 Ga0070675_100003209 3300005354 Bacteria 12385
55 Ga0070671_100001233 3300005355 Bacteria 19164
56 Ga0070671_100012166 3300005355 Bacteria 6926
57 Ga0070671_100019561 3300005355 Bacteria 5513
58 Ga0070671_100038689 3300005355 Bacteria 3958
59 Ga0070674_100004248 3300005356 Bacteria 8148
60 Ga0070674_100017587 3300005356 Bacteria 4502
61 Ga0070674_100042674 3300005356 Bacteria 3082
62 Ga0070673_100004233 3300005364 Bacteria 9053
63 Ga0070673_100009404 3300005364 Bacteria 6560
64 Ga0070673_100087221 3300005364 Bacteria 2543
65 Ga0070659_100003530 3300005366 Bacteria 11139
66 Ga0070659_100004141 3300005366 Bacteria 10343
67 Ga0070659_100052832 3300005366 Bacteria 3197
68 Ga0070659_100094380 3300005366 Bacteria 2402
69 Ga0070667_100007904 3300005367 Bacteria 8823
70 Ga0070667_100010506 3300005367 Bacteria 7644
71 Ga0070667_100016087 3300005367 Bacteria 6188
72 Ga0070709_10013162 3300005434 Bacteria 4645
73 Ga0070709_10025804 3300005434 Bacteria 3474
74 Ga0070714_100032886 3300005435 Bacteria 4332
75 Ga0070714_100042885 3300005435 Bacteria 3824
76 Ga0070713_100031712 3300005436 Bacteria 4212
77 Ga0070711_100000056 3300005439 Bacteria 67294
78 Ga0070694_100001260 3300005444 Bacteria 14706
79 Ga0070663_100036273 3300005455 Bacteria 3425
80 Ga0070663_100041855 3300005455 Bacteria 3216
81 Ga0070678_100029833 3300005456 Bacteria 3740
82 Ga0070662_100001271 3300005457 Bacteria 15503
83 Ga0070662_100031608 3300005457 Bacteria 3716
84 Ga0070662_100036920 3300005457 Bacteria 3461
85 Ga0070662_100045811 3300005457 Bacteria 3140
86 Ga0068867_100003211 3300005459 Bacteria 11519
87 Ga0068867_100019298 3300005459 Bacteria 4860
88 Ga0068867_100031850 3300005459 Bacteria 3810
89 Ga0070699_100017609 3300005518 Bacteria 6133
90 Ga0068853_100054738 3300005539 Bacteria 3439
91 Ga0070672_100022246 3300005543 Bacteria 4652
92 Ga0070695_100001410 3300005545 Bacteria 13315
93 Ga0070665_100000905 3300005548 Bacteria 38051
94 Ga0070665_100007805 3300005548 Bacteria 10861
95 Ga0070665_100021722 3300005548 Bacteria 6453
96 Ga0070665_100071880 3300005548 Bacteria 3467
97 Ga0068855_100002466 3300005563 Bacteria 22833
98 Ga0068855_100170696 3300005563 Bacteria 2463
99 Ga0068855_100185406 3300005563 Bacteria 2350
100 Ga0070664_100000197 3300005564 Bacteria 42730
101 Ga0070664_100040150 3300005564 Bacteria 3945
102 Ga0070664_100056833 3300005564 Bacteria 3325
103 Ga0068854_100006975 3300005578 Bacteria 7206
104 Ga0068854_100039463 3300005578 Bacteria 3326
105 Ga0068854_100043706 3300005578 Bacteria 3177
106 Ga0068856_100006709 3300005614 Bacteria 11280
107 Ga0068856_100011902 3300005614 Bacteria 8424
108 Ga0068856_100149059 3300005614 Bacteria 2347
109 Ga0068856_100201311 3300005614 Bacteria 2006
110 Ga0068852_100001133 3300005616 Bacteria 17620
111 Ga0068852_100024888 3300005616 Bacteria 4844
112 Ga0068852_100026985 3300005616 Bacteria 4675
113 Ga0068859_100001175 3300005617 Bacteria 26727
114 Ga0068864_100005277 3300005618 Bacteria 10584
115 Ga0068864_100022152 3300005618 Bacteria 5326
116 Ga0068866_10050927 3300005718 Bacteria 2105
117 Ga0068851_10014247 3300005834 Bacteria 3774
118 Ga0068863_100004152 3300005841 Bacteria 14299
119 Ga0068858_100004433 3300005842 Bacteria 13771
120 Ga0068858_100029916 3300005842 Bacteria 5059
121 Ga0068860_100007652 3300005843 Bacteria 10808
122 Ga0068860_100009218 3300005843 Bacteria 9810
123 Ga0068862_100094392 3300005844 Bacteria 2609
124 Ga0068862_100149173 3300005844 Bacteria 2080
125 Ga0081539_10009077 3300005985 Bacteria 8424
126 Ga0081539_10009122 3300005985 Bacteria 8387
127 Ga0081539_10014271 3300005985 Bacteria 5894
128 Ga0070717_10004265 3300006028 Bacteria 10306
129 Ga0070712_100004917 3300006175 Bacteria 8264
130 Ga0068871_100005301 3300006358 Bacteria 9028
131 Ga0075433_10003773 3300006852 Bacteria 11728
132 Ga0068865_100131440 3300006881 Bacteria 1876
133 Ga0075436_100028723 3300006914 Bacteria 3825
134 Ga0097620_100001175 3300006931 Bacteria 26727
135 Ga0099824_1000030 3300006942 Bacteria 83906
136 Ga0079104_1000256 3300006946 Bacteria 71046
137 Ga0099826_10000148 3300006948 Bacteria 30005
138 Ga0105240_10166068 3300009093 Bacteria 2618
139 Ga0105245_10003165 3300009098 Bacteria 14715
140 Ga0105245_10063340 3300009098 Bacteria 3338
141 Ga0114129_10069408 3300009147 Bacteria 4912
142 Ga0114129_10164486 3300009147 Bacteria 3029
143 Ga0105241_10094491 3300009174 Bacteria 2365
144 Ga0105242_10082761 3300009176 Bacteria 2686
145 Ga0105248_10000960 3300009177 Bacteria 32135
146 Ga0105248_10200737 3300009177 Bacteria 2247
147 Ga0105249_10001260 3300009553 Bacteria 22219
148 Ga0105239_10050417 3300010375 Bacteria 4566
149 Ga0105239_10231107 3300010375 Bacteria 2075
150 Ga0105246_10005729 3300011119 Bacteria 7585
151 Ga0105246_10036060 3300011119 Bacteria 3310
152 Ga0157373_10005567 3300013100 Bacteria 9442
153 Ga0157371_10003227 3300013102 Bacteria 14962
154 Ga0157371_10031261 3300013102 Bacteria 3835
155 Ga0157371_10085492 3300013102 Bacteria 2234
156 Ga0157370_10002213 3300013104 Bacteria 23732
157 Ga0157369_10051485 3300013105 Bacteria 4456
158 Ga0157369_10086621 3300013105 Bacteria 3345
159 Ga0157369_10119780 3300013105 Bacteria 2793
160 Ga0157369_10153672 3300013105 Bacteria 2432
161 Ga0157378_10008051 3300013297 Bacteria 9199
162 Ga0157378_10072940 3300013297 Bacteria 3085
163 Ga0163162_10106995 3300013306 Bacteria 2892
164 Ga0163163_10124150 3300014325 Bacteria 2618
165 Ga0157380_10002530 3300014326 Bacteria 12346
166 Ga0157380_10073493 3300014326 Bacteria 2772
167 Ga0183363_1001 3300015690 Bacteria 611534
168 Ga0213873_10000006 3300021358 Bacteria 408723
169 Ga0213872_10000002 3300021361 Bacteria 554092
170 Ga0213872_10002079 3300021361 Bacteria 12111
171 Ga0213872_10003961 3300021361 Bacteria 7988
172 Ga0213876_10000004 3300021384 Bacteria 943822
173 Ga0213876_10000138 3300021384 Bacteria 79857
174 Ga0213876_10004860 3300021384 Bacteria 7451
175 Ga0213875_10000005 3300021388 Bacteria 595146
176 Ga0213875_10000163 3300021388 Bacteria 69287
177 Ga0213875_10007605 3300021388 Bacteria 5587
178 Ga0213875_10015587 3300021388 Bacteria 3697
179 Ga0213875_10020953 3300021388 Bacteria 3134
180 Ga0213875_10053052 3300021388 Bacteria 1899
181 Ga0209147_100288 3300025229 Bacteria 42776
182 Ga0207425_1000047 3300025245 Bacteria 189158
183 Ga0209129_1002125 3300025258 Bacteria 10073
184 Ga0209565_1000011 3300025263 Bacteria 637062
185 Ga0209565_1000177 3300025263 Bacteria 80620
186 Ga0209673_1002201 3300025273 Bacteria 14286
187 Ga0209675_1000366 3300025291 Bacteria 38418
188 Ga0209675_1005715 3300025291 Bacteria 5138
189 Ga0209676_1000045 3300025292 Bacteria 412331
190 Ga0209676_1000133 3300025292 Bacteria 184430
191 Ga0209676_1012243 3300025292 Bacteria 3389
192 Ga0209025_1001194 3300025294 Bacteria 36680
193 Ga0209564_1001282 3300025295 Bacteria 27530
194 Ga0209564_1006875 3300025295 Bacteria 5998
195 Ga0209564_1007245 3300025295 Bacteria 5770
196 Ga0209758_1000009 3300025297 Bacteria 1123483
197 Ga0209758_1002209 3300025297 Bacteria 20282
198 Ga0209050_1000005 3300025298 Bacteria 1557793
199 Ga0209050_1000067 3300025298 Bacteria 304206
200 Ga0209050_1000071 3300025298 Bacteria 295478
201 Ga0209050_1000195 3300025298 Bacteria 136316
202 Ga0209050_1001014 3300025298 Bacteria 35068
203 Ga0209050_1005941 3300025298 Bacteria 7430
204 Ga0209050_1012320 3300025298 Bacteria 3933
205 Ga0209256_1000016 3300025299 Bacteria 599092
206 Ga0209051_1000414 3300025303 Bacteria 58981
207 Ga0209257_1000005 3300025304 Bacteria 1592528
208 Ga0209257_1000027 3300025304 Bacteria 703541
209 Ga0209257_1000132 3300025304 Bacteria 210870
210 Ga0209257_1001608 3300025304 Bacteria 25865
211 Ga0209257_1001633 3300025304 Bacteria 25692
212 Ga0209257_1004785 3300025304 Bacteria 10089
213 Ga0209257_1006878 3300025304 Bacteria 7131
214 Ga0207697_10000038 3300025315 Bacteria 49617
215 Ga0207697_10002878 3300025315 Bacteria 8718
216 Ga0207656_10000684 3300025321 Bacteria 11102
217 Ga0207682_10002044 3300025893 Bacteria 9134
218 Ga0207682_10029510 3300025893 Bacteria 2193
219 Ga0207688_10008875 3300025901 Bacteria 5469
220 Ga0207680_10041105 3300025903 Bacteria 2696
221 Ga0207680_10058330 3300025903 Bacteria 2339
222 Ga0207680_10083205 3300025903 Bacteria 2016
223 Ga0207647_10000047 3300025904 Bacteria 89112
224 Ga0207647_10000509 3300025904 Bacteria 31126
225 Ga0207647_10006949 3300025904 Bacteria 8202
226 Ga0207699_10019924 3300025906 Bacteria 3586
227 Ga0207645_10035294 3300025907 Bacteria 3211
228 Ga0207643_10011785 3300025908 Bacteria 4719
229 Ga0207705_10000002 3300025909 Bacteria 2046852
230 Ga0207705_10012713 3300025909 Bacteria 6074
231 Ga0207705_10099653 3300025909 Bacteria 2136
232 Ga0207654_10066566 3300025911 Bacteria 2125
233 Ga0207671_10096496 3300025914 Bacteria 2234
234 Ga0207693_10018850 3300025915 Bacteria 5493
235 Ga0207663_10001497 3300025916 Bacteria 10894
236 Ga0207657_10004995 3300025919 Bacteria 13941
237 Ga0207657_10014174 3300025919 Bacteria 7797
238 Ga0207657_10017906 3300025919 Bacteria 6778
239 Ga0207657_10026326 3300025919 Bacteria 5346
240 Ga0207657_10031889 3300025919 Bacteria 4766
241 Ga0207681_10001354 3300025923 Bacteria 15827
242 Ga0207681_10029467 3300025923 Bacteria 3566
243 Ga0207650_10004732 3300025925 Bacteria 9300
244 Ga0207650_10009190 3300025925 Bacteria 6754
245 Ga0207650_10090567 3300025925 Bacteria 2336
246 Ga0207700_10034947 3300025928 Bacteria 3614
247 Ga0207664_10056599 3300025929 Bacteria 3114
248 Ga0207664_10069933 3300025929 Bacteria 2823
249 Ga0207664_10193804 3300025929 Bacteria 1750
250 Ga0207644_10000699 3300025931 Bacteria 21250
251 Ga0207644_10010689 3300025931 Bacteria 6052
252 Ga0207644_10027059 3300025931 Bacteria 3959
253 Ga0207690_10002251 3300025932 Bacteria 11768
254 Ga0207690_10004693 3300025932 Bacteria 8071
255 Ga0207690_10019305 3300025932 Bacteria 4195
256 Ga0207706_10000857 3300025933 Bacteria 31350
257 Ga0207706_10007565 3300025933 Bacteria 10048
258 Ga0207706_10017239 3300025933 Bacteria 6511
259 Ga0207706_10020890 3300025933 Bacteria 5879
260 Ga0207706_10047188 3300025933 Bacteria 3812
261 Ga0207706_10050328 3300025933 Bacteria 3682
262 Ga0207706_10052387 3300025933 Bacteria 3603
263 Ga0207706_10054124 3300025933 Bacteria 3542
264 Ga0207706_10074372 3300025933 Bacteria 2988
265 Ga0207706_10076453 3300025933 Bacteria 2945
266 Ga0207709_10017316 3300025935 Bacteria 4020
267 Ga0207670_10022046 3300025936 Bacteria 3940
268 Ga0207669_10031408 3300025937 Bacteria 2967
269 Ga0207669_10057417 3300025937 Bacteria 2369
270 Ga0207704_10143228 3300025938 Bacteria 1675
271 Ga0207691_10000672 3300025940 Bacteria 33790
272 Ga0207691_10002554 3300025940 Bacteria 17791
273 Ga0207691_10010917 3300025940 Bacteria 8720
274 Ga0207691_10031057 3300025940 Bacteria 4989
275 Ga0207691_10187079 3300025940 Bacteria 1807
276 Ga0207711_10000496 3300025941 Bacteria 40666
277 Ga0207711_10010559 3300025941 Bacteria 7676
278 Ga0207711_10021022 3300025941 Bacteria 5450
279 Ga0207711_10136940 3300025941 Bacteria 2200
280 Ga0207689_10000190 3300025942 Bacteria 53407
281 Ga0207689_10015713 3300025942 Bacteria 6408
282 Ga0207679_10005414 3300025945 Bacteria 7997
283 Ga0207667_10031142 3300025949 Bacteria 5761
284 Ga0207651_10000287 3300025960 Bacteria 21681
285 Ga0207651_10000990 3300025960 Bacteria 12553
286 Ga0207651_10031604 3300025960 Bacteria 3387
287 Ga0207651_10124119 3300025960 Bacteria 1964
288 Ga0207712_10000280 3300025961 Bacteria 48628
289 Ga0207640_10035326 3300025981 Bacteria 3127
290 Ga0207658_10027128 3300025986 Bacteria 4022
291 Ga0207658_10144181 3300025986 Bacteria 1931
292 Ga0207677_10003280 3300026023 Bacteria 8554
293 Ga0207703_10004007 3300026035 Bacteria 12195
294 Ga0207703_10008076 3300026035 Bacteria 8318
295 Ga0207639_10184445 3300026041 Bacteria 1778
296 Ga0207678_10012762 3300026067 Bacteria 7380
297 Ga0207678_10046937 3300026067 Bacteria 3735
298 Ga0207702_10006625 3300026078 Bacteria 9961
299 Ga0207702_10053077 3300026078 Bacteria 3431
300 Ga0207641_10020578 3300026088 Bacteria 5421
301 Ga0207641_10022509 3300026088 Bacteria 5186
302 Ga0207648_10008175 3300026089 Bacteria 10171
303 Ga0207648_10009201 3300026089 Bacteria 9490
304 Ga0207648_10015911 3300026089 Bacteria 6895
305 Ga0207648_10021959 3300026089 Bacteria 5734
306 Ga0207676_10002566 3300026095 Bacteria 12965
307 Ga0207676_10003827 3300026095 Bacteria 10631
308 Ga0207674_10001422 3300026116 Bacteria 30915
309 Ga0207674_10020538 3300026116 Bacteria 7133
310 Ga0207674_10075707 3300026116 Bacteria 3375
311 Ga0207675_100135922 3300026118 Bacteria 2332
312 Ga0207683_10012421 3300026121 Bacteria 7267
313 Ga0207683_10058239 3300026121 Bacteria 3392
314 Ga0207683_10146835 3300026121 Bacteria 2127
315 Ga0207698_10006283 3300026142 Bacteria 7393
316 Ga0207698_10011190 3300026142 Bacteria 5805
317 Ga0209281_1000115 3300027111 Bacteria 210393
318 Ga0209282_1033149 3300027666 Bacteria 3150
319 Ga0209974_10005841 3300027876 Bacteria 4315
320 Ga0268266_10000423 3300028379 Bacteria 64113
321 Ga0268266_10006759 3300028379 Bacteria 10457
322 Ga0268266_10008869 3300028379 Bacteria 8902
323 Ga0268265_10003997 3300028380 Bacteria 10380
324 Ga0268265_10007583 3300028380 Bacteria 7319
325 Ga0268264_10003154 3300028381 Bacteria 14286
326 Ga0268264_10007972 3300028381 Bacteria 8812
327 Ga0268264_10018910 3300028381 Bacteria 5632
328 Ga0265326_10025541 3300028558 Bacteria 1685
329 Ga0265316_10004231 3300031344 Bacteria 14340
330 Ga0265316_10023635 3300031344 Bacteria 5160
331 Ga0307408_100001219 3300031548 Bacteria 19363
332 Ga0307508_10036606 3300031616 Bacteria 4418
333 Ga0316578_10031811 3300031728 Bacteria 3009
334 Ga0316578_10052930 3300031728 Bacteria 2379
335 Ga0307405_10000004 3300031731 Bacteria 444977
336 Ga0307405_10009917 3300031731 Bacteria 4905
337 Ga0307405_10032401 3300031731 Bacteria 3089
338 Ga0307405_10080589 3300031731 Bacteria 2126
339 Ga0307413_10000007 3300031824 Bacteria 65102
340 Ga0307413_10011708 3300031824 Bacteria 4330
341 Ga0307410_10000879 3300031852 Bacteria 12839
342 Ga0307410_10007304 3300031852 Bacteria 6037
343 Ga0307410_10041853 3300031852 Bacteria 3023
344 Ga0307410_10074262 3300031852 Bacteria 2367
345 Ga0307410_10089479 3300031852 Bacteria 2181
346 Ga0307406_10000044 3300031901 Bacteria 71261
347 Ga0307406_10126904 3300031901 Bacteria 1784
348 Ga0307407_10010751 3300031903 Bacteria 4327
349 Ga0307412_10004709 3300031911 Bacteria 7613
350 Ga0307412_10008175 3300031911 Bacteria 5965
351 Ga0307409_100000126 3300031995 Bacteria 28589
352 Ga0307409_100120519 3300031995 Bacteria 2220
353 Ga0307409_100233516 3300031995 Bacteria 1669
354 Ga0307416_100039255 3300032002 Bacteria 3663
355 Ga0307416_100092270 3300032002 Bacteria 2604
356 Ga0307416_100162193 3300032002 Bacteria 2068
357 Ga0307416_100245032 3300032002 Bacteria 1740
358 Ga0307414_10000014 3300032004 Bacteria 302974
359 Ga0307414_10005163 3300032004 Bacteria 7165
360 Ga0307414_10032471 3300032004 Bacteria 3437
361 Ga0307414_10044387 3300032004 Bacteria 3035
362 Ga0307414_10073381 3300032004 Bacteria 2475
363 Ga0307411_10000002 3300032005 Bacteria 534807
364 Ga0307411_10000168 3300032005 Bacteria 21123
365 Ga0307411_10051596 3300032005 Bacteria 2684
366 Ga0307415_100007658 3300032126 Bacteria 5925
367 Ga0307415_100007831 3300032126 Bacteria 5873
368 Ga0316585_10015382 3300032137 Bacteria 2294
369 Ga0307510_10007193 3300033180 Bacteria 13255
370 Ga0373943_0047327 3300035170 Bacteria 2102
371 Ga0316584_0000657 3300036712 Bacteria 18859
372 Ga0316584_0068139 3300036712 Bacteria 2667
373 Ga0395899_0015906 3300037312 Bacteria 5736
374 Ga0395899_0073235 3300037312 Bacteria 2506
375 Ga0395900_0005369 3300037418 Bacteria 13430
376 Ga0395900_0008230 3300037418 Bacteria 10739
377 Ga0395900_0017277 3300037418 Bacteria 7363
378 Ga0395900_0026110 3300037418 Bacteria 5980
379 Ga0395900_0047646 3300037418 Bacteria 4414
380 Ga0395900_0070727 3300037418 Bacteria 3587
381 Ga0395900_0077265 3300037418 Bacteria 3420
382 Ga0395900_0134602 3300037418 Bacteria 2531
383 Ga0395898_0058424 3300037466 Bacteria 3754
384 Ga0395898_0073080 3300037466 Bacteria 3312
385 Ga0395898_0093601 3300037466 Bacteria 2888
386 Ga0395898_0253848 3300037466 Bacteria 1677
387 Ga0395905_0001690 3300037471 Bacteria 26013
388 Ga0395905_0001817 3300037471 Bacteria 24687
389 Ga0395905_0003401 3300037471 Bacteria 17036
390 Ga0395905_0005643 3300037471 Bacteria 12728
391 Ga0395905_0012268 3300037471 Bacteria 8254
392 Ga0395905_0049448 3300037471 Bacteria 3940
393 Ga0395905_0056782 3300037471 Bacteria 3661
394 Ga0395905_0199636 3300037471 Bacteria 1875
395 Ga0436364_0157811 3300037853 Bacteria 430293
396 Ga0436364_0373695 3300037853 Bacteria 14677
397 Ga0436364_0417080 3300037853 Bacteria 3068
398 Ga0436364_0586215 3300037853 Bacteria 68755
399 Ga0436364_1037728 3300037853 Bacteria 3683
400 Ga0436364_1278270 3300037853 Bacteria 10113
401 Ga0436364_1316265 3300037853 Bacteria 2852
402 Ga0436364_1345932 3300037853 Bacteria 5440
403 Ga0395901_0006115 3300038443 Bacteria 12198
404 Ga0395901_0015133 3300038443 Bacteria 7844
405 Ga0395901_0057940 3300038443 Bacteria 4029
406 Ga0395901_0126021 3300038443 Bacteria 2691
407 Ga0436365_0426069 3300039437 Bacteria 4399
408 Ga0436365_0798724 3300039437 Bacteria 89017
409 Ga0436365_0862833 3300039437 Bacteria 88455
410 Ga0436365_1467160 3300039437 Bacteria 7424
411 Ga0436360_0316468 3300039438 Bacteria 2214
412 Ga0436361_0491527 3300039447 Bacteria 29855
413 Ga0436361_0510126 3300039447 Bacteria 27659
414 Ga0436361_0770157 3300039447 Bacteria 14822
415 Ga0436363_0278312 3300039450 Bacteria 3122
416 Ga0436363_0618120 3300039450 Bacteria 12910
417 Ga0436363_0706963 3300039450 Bacteria 4152
418 Ga0436362_0024386 3300039453 Bacteria 5380
419 Ga0436362_0949954 3300039453 Bacteria 89092
420 Ga0439447_000094 3300041407 Bacteria 31565
421 Ga0439461_0004314 3300041410 Bacteria 2371
422 Ga0439466_0000154 3300041411 Bacteria 27308
423 Ga0439465_0000779 3300041413 Bacteria 9938
424 Ga0451795_0814101 3300041456 Bacteria 1809
425 Ga0439431_0000238 3300041997 Bacteria 11179
426 Ga0439442_001068 3300042002 Bacteria 5524
427 Ga0439445_0000152 3300042004 Bacteria 12156
428 Ga0439432_000314 3300042006 Bacteria 17522
429 Ga0439432_029021 3300042006 Bacteria 1800
430 Ga0439449_0018359 3300042007 Bacteria 2625
431 Ga0439462_0000557 3300042015 Bacteria 7389
432 Ga0439458_0000155 3300042157 Bacteria 15100
433 Ga0439434_0000358 3300042435 Bacteria 13106
434 Ga0451577_0000410 3300042876 Bacteria 77885
435 Ga0466969_0002291 3300044656 Bacteria 10223
436 Ga0453683_0004670 3300044673 Bacteria 9667
437 Ga0466966_0045470 3300044684 Bacteria 2807
438 Ga0466961_0022950 3300044693 Bacteria 4014
439 Ga0466963_0000326 3300044694 Bacteria 21596
440 Ga0466963_0176573 3300044694 Bacteria 1490
441 Ga0453684_0002228 3300044712 Bacteria 48078
442 Ga0453684_0002290 3300044712 Bacteria 47049
443 Ga0453684_0009510 3300044712 Bacteria 16995
444 Ga0453684_0053642 3300044712 Bacteria 5260
445 Ga0466970_0054679 3300044765 Bacteria 2132
446 Ga0466957_0001368 3300044842 Bacteria 12723
447 Ga0466957_0006842 3300044842 Bacteria 6444
448 Ga0466957_0078620 3300044842 Bacteria 2051
449 Ga0466959_0093414 3300045049 Bacteria 2159
450 Ga0451576_0000252 3300045051 Bacteria 132040
451 Ga0451576_0038003 3300045051 Bacteria 5097
452 Ga0466958_0058553 3300045836 Bacteria 2342
453 Ga0466967_0000149 3300045976 Bacteria 27415
454 Ga0466967_0039872 3300045976 Bacteria 4041
455 Ga0466967_0084707 3300045976 Bacteria 2869
456 Ga0495627_000172 3300046453 Bacteria 73650
457 Ga0495627_000834 3300046453 Bacteria 22232
458 Ga0495638_0000012 3300046460 Bacteria 435577
459 Ga0495650_0000015 3300046471 Bacteria 557595
460 Ga0495650_0006084 3300046471 Bacteria 7609
461 Ga0495605_0000063 3300046474 Bacteria 140789
462 Ga0495584_0000171 3300046491 Bacteria 45582
463 Ga0495584_0005986 3300046491 Bacteria 6407
464 Ga0495584_0014235 3300046491 Bacteria 4054
465 Ga0495594_0000164 3300046499 Bacteria 31802
466 Ga0495594_0086548 3300046499 Bacteria 1753
467 Ga0495596_0000341 3300046500 Bacteria 30274
468 Ga0495607_0011506 3300046501 Bacteria 5888
469 Ga0495607_0022644 3300046501 Bacteria 3941
470 Ga0495607_0049320 3300046501 Bacteria 2456
471 Ga0495583_0000180 3300046506 Bacteria 108471
472 Ga0495606_0003841 3300046507 Bacteria 15523
473 Ga0495606_0008461 3300046507 Bacteria 8932
474 Ga0495606_0064443 3300046507 Bacteria 2332
475 Ga0495610_0000020 3300046512 Bacteria 344007
476 Ga0495610_0000182 3300046512 Bacteria 70063
477 Ga0495616_0007305 3300046513 Bacteria 6613
478 Ga0495620_0016769 3300046515 Bacteria 3667
479 Ga0495631_0008883 3300046518 Bacteria 5042
480 Ga0495632_0000070 3300046519 Bacteria 107264
481 Ga0495632_0000248 3300046519 Bacteria 53538
482 Ga0495632_0000480 3300046519 Bacteria 37906
483 Ga0495637_0000307 3300046520 Bacteria 37985
484 Ga0495643_0000010 3300046522 Bacteria 341431
485 Ga0495643_0000110 3300046522 Bacteria 135600
486 Ga0495643_0001129 3300046522 Bacteria 26367
487 Ga0495648_0000151 3300046524 Bacteria 83011
488 Ga0495648_0008824 3300046524 Bacteria 7888
489 Ga0495648_0017791 3300046524 Bacteria 5067
490 Ga0495648_0034818 3300046524 Bacteria 3272
491 Ga0495663_0000004 3300046525 Bacteria 355166
492 Ga0495598_0007560 3300046537 Bacteria 2497
493 Ga0495597_0000841 3300046542 Bacteria 24132
494 Ga0495633_0000105 3300046558 Bacteria 113385
495 Ga0495633_0000910 3300046558 Bacteria 25099
496 Ga0495633_0020315 3300046558 Bacteria 3342
497 Ga0495668_0000015 3300046616 Bacteria 441932
498 Ga0495668_0057127 3300046616 Bacteria 2153
499 Ga0495611_0002595 3300046648 Bacteria 8177
500 Ga0495625_0000841 3300046660 Bacteria 42026
501 Ga0495661_0049252 3300046665 Bacteria 2555
502 Ga0495669_0000454 3300046684 Bacteria 19203
503 Ga0495669_0007971 3300046684 Bacteria 4444
504 Ga0495669_0032992 3300046684 Bacteria 2278
505 Ga0495670_0000033 3300046691 Bacteria 81716
506 Ga0495670_0004202 3300046691 Bacteria 7057
507 Ga0495671_0000014 3300046692 Bacteria 341431
508 Ga0495671_0000023 3300046692 Bacteria 252939
509 Ga0495671_0091790 3300046692 Bacteria 1486
510 Ga0495589_0000204 3300046794 Bacteria 51361
511 Ga0495660_0000349 3300046810 Bacteria 40937
512 Ga0495636_0003650 3300047318 Bacteria 5977
513 Ga0495687_000075 3300047443 Bacteria 152218
514 Ga0495687_000578 3300047443 Bacteria 43065
515 Ga0495677_0001651 3300047445 Bacteria 8962
516 Ga0495677_0003663 3300047445 Bacteria 5944
517 Ga0495673_0000054 3300047469 Bacteria 252207
518 Ga0495681_0000064 3300047470 Bacteria 99007
519 Ga0495681_0000322 3300047470 Bacteria 38088
520 Ga0495681_0031141 3300047470 Bacteria 2706
521 Ga0495686_0009434 3300047472 Bacteria 7030
522 Ga0495615_0000128 3300048090 Bacteria 19080
523 Ga0495626_0000618 3300048091 Bacteria 34677
524 Ga0495626_0008050 3300048091 Bacteria 5816
525 Ga0496101_0000325 3300048904 Bacteria 32628
526 Ga0496107_0001305 3300048910 Bacteria 15271
527 Ga0496107_0088270 3300048910 Bacteria 2264
528 Ga0496108_0004818 3300048911 Bacteria 10885
529 Ga0496109_0002536 3300048912 Bacteria 15301
530 Ga0496109_0113120 3300048912 Bacteria 2524
531 Ga0496109_0150260 3300048912 Bacteria 2181
532 Ga0496110_0000100 3300048913 Bacteria 46561
533 Ga0496110_0026788 3300048913 Bacteria 4937
534 Ga0496112_0000364 3300048915 Bacteria 29565
535 Ga0496113_0000086 3300048916 Bacteria 40370
536 Ga0496113_0155068 3300048916 Bacteria 1808
537 Ga0496114_0000006 3300048917 Bacteria 472921
538 Ga0496115_0000231 3300048918 Bacteria 50772
539 Ga0496115_0004662 3300048918 Bacteria 9933
540 Ga0496116_0000195 3300048919 Bacteria 120438
541 Ga0496117_0016813 3300048920 Bacteria 6147
542 Ga0496118_0039724 3300048921 Bacteria 3751
543 Ga0496119_0037310 3300048922 Bacteria 3159
544 Ga0496120_0021602 3300048923 Bacteria 4066
545 Ga0496121_0000413 3300048924 Bacteria 84919
546 Ga0496121_0009670 3300048924 Bacteria 11045
547 Ga0496122_0003997 3300048925 Bacteria 18802
548 Ga0496122_0010921 3300048925 Bacteria 9286
549 Ga0496122_0045752 3300048925 Bacteria 3397
550 Ga0496123_0002162 3300048926 Bacteria 25094
551 Ga0496123_0003021 3300048926 Bacteria 19404
552 Ga0496124_0000054 3300048927 Bacteria 252172
553 Ga0496124_0000623 3300048927 Bacteria 59105
554 Ga0496124_0000631 3300048927 Bacteria 58432
555 Ga0496124_0008281 3300048927 Bacteria 10893
556 Ga0496124_0058316 3300048927 Bacteria 3248
557 Ga0496125_0000024 3300048928 Bacteria 442149
558 Ga0496125_0024185 3300048928 Bacteria 5588
559 Ga0496126_0000136 3300048929 Bacteria 167497
560 Ga0501310_003040 3300049130 Bacteria 1626
561 Ga0501314_001441 3300049530 Bacteria 1722
562 Ga0501033_0001724 3300049570 Bacteria 19138
563 Ga0501034_0004606 3300049571 Bacteria 15279
564 Ga0501042_0026413 3300049578 Bacteria 4080
565 Ga0501238_000179 3300049671 Bacteria 9482
566 Ga0501249_000015 3300049679 Bacteria 124336
567 Ga0501249_005201 3300049679 Bacteria 2657
568 Ga0501080_0045116 3300049742 Bacteria 4103
569 Ga0501266_000001 3300049763 Bacteria 562004
570 Ga0501044_0221797 3300049823 Bacteria 1841
571 nmdc:mga08x19_13680_c1 3300050514 Bacteria 4910
572 nmdc:mga0a205_1958_c1 3300050515 Bacteria 17919
573 Ga0500566_0000258 3300053094 Bacteria 28578
574 Ga0500641_0000065 3300053096 Bacteria 42860
575 Ga0500641_0000328 3300053096 Bacteria 17563
576 Ga0500594_0014474 3300053118 Bacteria 1889
577 Ga0500594_0022516 3300053118 Bacteria 1590
578 Ga0500595_000624 3300053119 Bacteria 21192
579 Ga0500618_002294 3300053125 Bacteria 7367
580 Ga0500658_0000001 3300053134 Bacteria 592738
581 Ga0500568_0003022 3300053139 Bacteria 9625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0091790 Ga0495671_0091790_221_1411 373
2 3300005434 Ga0070709_10013162 Ga0070709_100131622 382
3 3300005444 Ga0070694_100001260 Ga0070694_1000012606 382
4 3300005545 Ga0070695_100001410 Ga0070695_1000014102 382
5 3300005439 Ga0070711_100000056 Ga0070711_10000005653 385
6 3300025916 Ga0207663_10001497 Ga0207663_100014975 385
7 3300006914 Ga0075436_100028723 Ga0075436_1000287232 409
8 3300050514 nmdc:mga08x19_13680_c1 nmdc:mga08x19_13680_c1_964_2277 409
9 3300037853 Ga0436364_0586215 Ga0436364_0586215_10650_11942 413
10 3300003322 rootL2_10127512 rootL2_101275123 414
11 3300037853 Ga0436364_1278270 Ga0436364_1278270_6870_8222 423
12 3300005518 Ga0070699_100017609 Ga0070699_1000176092 424
13 3300039437 Ga0436365_0426069 Ga0436365_0426069_1767_3128 424
14 3300039450 Ga0436363_0278312 Ga0436363_0278312_1374_2735 424
15 3300044712 Ga0453684_0002228 Ga0453684_0002228_25436_26755 424
16 3300045051 Ga0451576_0038003 Ga0451576_0038003_2593_3912 424
17 iso_pu_bacteria 2513020052 2513232885 424
18 iso_pu_bacteria 2519899754 2520880819 424
19 iso_pu_bacteria 2643221600 2644012335 424
20 iso_pu_bacteria 2643221667 2644371597 424
21 iso_pu_bacteria 2739367857 2740000017 424
22 iso_pu_bacteria 2739367858 2740004833 424
23 iso_pu_bacteria 2816332280 2817414466 424
24 iso_pu_bacteria 2857613821 2857615553 424
25 iso_pu_bacteria 2857618242 2857622030 424
26 iso_pu_bacteria 2881359912 2881360763 424
27 iso_pu_bacteria 2903895155 2903895548 424
28 iso_pu_bacteria 2904419702 2904424172 424
29 iso_pu_bacteria 2919683626 2919683873 424
30 iso_pu_bacteria 2929150217 2929151617 424
31 iso_pu_bacteria 2958458903 2958459901 424
32 iso_pu_bacteria 8054307821 8054309172 424
33 iso_pu_bacteria 8055592153 8055596030 424
34 iso_pu_bacteria 8056440228 8056442871 424
35 3300021388 Ga0213875_10015587 Ga0213875_100155873 425
36 3300021388 Ga0213875_10053052 Ga0213875_100530522 425
37 3300037853 Ga0436364_1037728 Ga0436364_1037728_875_2248 425
38 3300037853 Ga0436364_1316265 Ga0436364_1316265_1235_2569 425
39 3300039450 Ga0436363_0618120 Ga0436363_0618120_8481_9800 425
40 3300005435 Ga0070714_100042885 Ga0070714_1000428852 426
41 3300005614 Ga0068856_100006709 Ga0068856_1000067098 426
42 3300014326 Ga0157380_10073493 Ga0157380_100734932 426
43 3300021361 Ga0213872_10003961 Ga0213872_100039617 426
44 3300021384 Ga0213876_10004860 Ga0213876_100048607 426
45 3300021388 Ga0213875_10000005 Ga0213875_10000005264 426
46 3300021388 Ga0213875_10020953 Ga0213875_100209532 426
47 3300025929 Ga0207664_10193804 Ga0207664_101938042 426
48 3300037853 Ga0436364_0417080 Ga0436364_0417080_231_1568 426
49 3300037853 Ga0436364_1345932 Ga0436364_1345932_905_2251 426
50 3300039437 Ga0436365_1467160 Ga0436365_1467160_151_1491 426
51 3300039438 Ga0436360_0316468 Ga0436360_0316468_626_1963 426
52 3300039447 Ga0436361_0510126 Ga0436361_0510126_20573_21910 426
53 3300039453 Ga0436362_0024386 Ga0436362_0024386_3148_4485 426
54 3300031731 Ga0307405_10000004 Ga0307405_10000004142 427
55 3300044842 Ga0466957_0001368 Ga0466957_0001368_2402_3736 427
56 3300048918 Ga0496115_0004662 Ga0496115_0004662_3137_4495 427
57 3300048928 Ga0496125_0000024 Ga0496125_0000024_410677_412035 427
58 3300053096 Ga0500641_0000328 Ga0500641_0000328_2121_3473 427
59 iso_pu_bacteria 2738541276 2738716766 427
60 3300005293 Ga0065715_10017692 Ga0065715_100176922 428
61 3300006942 Ga0099824_1000030 Ga0099824_100003040 428
62 3300006946 Ga0079104_1000256 Ga0079104_100025659 428
63 3300006948 Ga0099826_10000148 Ga0099826_1000014820 428
64 3300013104 Ga0157370_10002213 Ga0157370_100022133 428
65 3300021388 Ga0213875_10000163 Ga0213875_1000016364 428
66 3300027111 Ga0209281_1000115 Ga0209281_100011514 428
67 3300027666 Ga0209282_1033149 Ga0209282_10331492 428
68 3300031548 Ga0307408_100001219 Ga0307408_1000012196 428
69 3300031824 Ga0307413_10000007 Ga0307413_1000000738 428
70 3300031852 Ga0307410_10000879 Ga0307410_100008794 428
71 3300031901 Ga0307406_10000044 Ga0307406_1000004413 428
72 3300031903 Ga0307407_10010751 Ga0307407_100107513 428
73 3300032004 Ga0307414_10000014 Ga0307414_10000014130 428
74 3300032004 Ga0307414_10073381 Ga0307414_100733812 428
75 3300032005 Ga0307411_10000002 Ga0307411_10000002452 428
76 3300033180 Ga0307510_10007193 Ga0307510_100071934 428
77 3300041407 Ga0439447_000094 Ga0439447_000094_8773_10125 428
78 3300041411 Ga0439466_0000154 Ga0439466_0000154_4400_5752 428
79 3300048924 Ga0496121_0009670 Ga0496121_0009670_6852_8204 428
80 3300049130 Ga0501310_003040 Ga0501310_003040_213_1565 428
81 3300049530 Ga0501314_001441 Ga0501314_001441_76_1428 428
82 3300049671 Ga0501238_000179 Ga0501238_000179_2851_4203 428
83 3300049679 Ga0501249_000015 Ga0501249_000015_32450_33802 428
84 3300049679 Ga0501249_005201 Ga0501249_005201_1158_2510 428
85 3300049763 Ga0501266_000001 Ga0501266_000001_133935_135287 428
86 3300053096 Ga0500641_0000065 Ga0500641_0000065_18906_20261 428
87 3300053118 Ga0500594_0014474 Ga0500594_0014474_165_1520 428
88 3300053134 Ga0500658_0000001 Ga0500658_0000001_313075_314430 428
89 3300003323 rootH1_10024342 rootH1_100243428 429
90 3300041456 Ga0451795_0814101 Ga0451795_0814101_40_1416 429
91 3300005327 Ga0070658_10155770 Ga0070658_101557702 430
92 3300037853 Ga0436364_0157811 Ga0436364_0157811_285868_287256 430
93 iso_pu_bacteria 2887630918 2887632527 430
94 3300003323 rootH1_10050362 rootH1_100503629 431
95 3300021361 Ga0213872_10000002 Ga0213872_10000002306 433
96 3300021361 Ga0213872_10002079 Ga0213872_100020799 433
97 3300039447 Ga0436361_0491527 Ga0436361_0491527_23826_25148 433
98 3300039447 Ga0436361_0770157 Ga0436361_0770157_4341_5663 433
99 iso_pu_bacteria 2690315857 2691332228 433
100 iso_pu_bacteria 2919534386 2919535194 433
101 3300003775 Ga0055524_1000721 Ga0055524_10007213 434
102 3300037466 Ga0395898_0253848 Ga0395898_0253848_298_1611 434
103 3300046491 Ga0495584_0005986 Ga0495584_0005986_4516_5835 434
104 3300046491 Ga0495584_0014235 Ga0495584_0014235_2201_3520 434
105 3300046499 Ga0495594_0000164 Ga0495594_0000164_10766_12085 434
106 3300046499 Ga0495594_0086548 Ga0495594_0086548_41_1360 434
107 3300046518 Ga0495631_0008883 Ga0495631_0008883_755_2074 434
108 3300046542 Ga0495597_0000841 Ga0495597_0000841_17630_18949 434
109 3300046558 Ga0495633_0020315 Ga0495633_0020315_941_2260 434
110 3300046648 Ga0495611_0002595 Ga0495611_0002595_3032_4351 434
111 3300046691 Ga0495670_0004202 Ga0495670_0004202_134_1453 434
112 3300047318 Ga0495636_0003650 Ga0495636_0003650_573_1892 434
113 3300047445 Ga0495677_0001651 Ga0495677_0001651_686_2005 434
114 3300047470 Ga0495681_0031141 Ga0495681_0031141_291_1610 434
115 3300048091 Ga0495626_0008050 Ga0495626_0008050_789_2108 434
116 3300002774 JGI25150J39212_1003968 JGI25150J39212_10039681 435
117 3300003771 Ga0055526_1002192 Ga0055526_10021923 435
118 3300004625 Ga0055543_1000603 Ga0055543_10006034 435
119 3300005366 Ga0070659_100094380 Ga0070659_1000943802 435
120 3300005563 Ga0068855_100170696 Ga0068855_1001706962 435
121 3300006881 Ga0068865_100131440 Ga0068865_1001314401 435
122 3300025295 Ga0209564_1007245 Ga0209564_10072452 435
123 3300046471 Ga0495650_0000015 Ga0495650_0000015_357033_358370 435
124 3300046474 Ga0495605_0000063 Ga0495605_0000063_24558_25886 435
125 3300046491 Ga0495584_0000171 Ga0495584_0000171_35182_36516 435
126 3300046501 Ga0495607_0022644 Ga0495607_0022644_1877_3205 435
127 3300046507 Ga0495606_0003841 Ga0495606_0003841_5667_7001 435
128 3300046507 Ga0495606_0008461 Ga0495606_0008461_6505_7842 435
129 3300046513 Ga0495616_0007305 Ga0495616_0007305_4484_5818 435
130 3300046522 Ga0495643_0001129 Ga0495643_0001129_15627_16955 435
131 3300046524 Ga0495648_0017791 Ga0495648_0017791_2238_3572 435
132 3300046665 Ga0495661_0049252 Ga0495661_0049252_39_1373 435
133 3300046794 Ga0495589_0000204 Ga0495589_0000204_39774_41102 435
134 3300046810 Ga0495660_0000349 Ga0495660_0000349_21791_23119 435
135 3300047443 Ga0495687_000075 Ga0495687_000075_102882_104216 435
136 3300047443 Ga0495687_000578 Ga0495687_000578_17180_18508 435
137 3300047445 Ga0495677_0003663 Ga0495677_0003663_32_1360 435
138 3300048091 Ga0495626_0000618 Ga0495626_0000618_24565_25893 435
139 3300048916 Ga0496113_0155068 Ga0496113_0155068_411_1739 435
140 3300046507 Ga0495606_0064443 Ga0495606_0064443_158_1678 451
141 3300046500 Ga0495596_0000341 Ga0495596_0000341_11397_12914 457
142 3300046512 Ga0495610_0000020 Ga0495610_0000020_213889_215403 457
143 3300046512 Ga0495610_0000182 Ga0495610_0000182_9125_10642 457
144 3300031728 Ga0316578_10052930 Ga0316578_100529301 460
145 3300032137 Ga0316585_10015382 Ga0316585_100153822 460
146 3300042006 Ga0439432_029021 Ga0439432_029021_20_1420 463
147 3300044694 Ga0466963_0176573 Ga0466963_0176573_37_1446 464
148 3300046519 Ga0495632_0000480 Ga0495632_0000480_32079_33593 466
149 3300028558 Ga0265326_10025541 Ga0265326_100255411 467
150 3300003794 Ga0055531_10000223 Ga0055531_1000022336 473
151 3300025304 Ga0209257_1000005 Ga0209257_10000051308 473
152 3300003771 Ga0055526_1000850 Ga0055526_10008506 474
153 3300025295 Ga0209564_1001282 Ga0209564_100128212 474
154 3300031728 Ga0316578_10031811 Ga0316578_100318112 474
155 3300036712 Ga0316584_0000657 Ga0316584_0000657_10404_11897 474
156 3300005339 Ga0070660_100005855 Ga0070660_1000058555 476
157 3300025919 Ga0207657_10014174 Ga0207657_100141747 476
158 3300025932 Ga0207690_10019305 Ga0207690_100193052 476
159 3300025933 Ga0207706_10017239 Ga0207706_100172393 476
160 3300026067 Ga0207678_10046937 Ga0207678_100469373 476
161 3300042876 Ga0451577_0000410 Ga0451577_0000410_75532_77046 476
162 3300044712 Ga0453684_0002290 Ga0453684_0002290_32260_33774 476
163 3300044712 Ga0453684_0009510 Ga0453684_0009510_9811_11289 476
164 3300045051 Ga0451576_0000252 Ga0451576_0000252_13300_14814 476
165 3300025941 Ga0207711_10000496 Ga0207711_1000049639 477
166 3300036712 Ga0316584_0068139 Ga0316584_0068139_143_1804 478
167 3300009147 Ga0114129_10069408 Ga0114129_100694082 479
168 3300009147 Ga0114129_10164486 Ga0114129_101644862 479
169 3300025298 Ga0209050_1005941 Ga0209050_10059414 479
170 3300031731 Ga0307405_10009917 Ga0307405_100099172 480
171 3300031852 Ga0307410_10041853 Ga0307410_100418532 480
172 3300031911 Ga0307412_10008175 Ga0307412_100081752 480
173 iso_pu_bacteria 2928027323 2928028979 481
174 iso_pu_bacteria 2984555340 2984557789 481
175 iso_pu_bacteria 2984564862 2984567845 481
176 iso_pu_bacteria 2993356040 2993358896 481
177 3300046501 Ga0495607_0011506 Ga0495607_0011506_239_1759 482
178 3300031995 Ga0307409_100120519 Ga0307409_1001205191 483
179 3300044656 Ga0466969_0002291 Ga0466969_0002291_1054_2580 483
180 3300027876 Ga0209974_10005841 Ga0209974_100058413 484
181 3300046460 Ga0495638_0000012 Ga0495638_0000012_410443_411948 484
182 3300046506 Ga0495583_0000180 Ga0495583_0000180_43221_44726 484
183 3300046524 Ga0495648_0000151 Ga0495648_0000151_57872_59377 484
184 3300046692 Ga0495671_0000023 Ga0495671_0000023_186957_188462 484
185 3300047469 Ga0495673_0000054 Ga0495673_0000054_186942_188447 484
186 3300025929 Ga0207664_10056599 Ga0207664_100565992 485
187 3300032004 Ga0307414_10032471 Ga0307414_100324711 485
188 3300032126 Ga0307415_100007658 Ga0307415_1000076583 485
189 3300002774 JGI25150J39212_1000324 JGI25150J39212_100032413 486
190 3300003215 JGI25153J46596_10000093 JGI25153J46596_1000009320 486
191 3300025245 Ga0207425_1000047 Ga0207425_10000471 486
192 3300025258 Ga0209129_1002125 Ga0209129_10021259 486
193 3300025292 Ga0209676_1012243 Ga0209676_10122432 486
194 3300025294 Ga0209025_1001194 Ga0209025_10011949 486
195 3300025297 Ga0209758_1000009 Ga0209758_1000009728 486
196 3300025298 Ga0209050_1000005 Ga0209050_1000005440 486
197 3300025298 Ga0209050_1000195 Ga0209050_100019544 486
198 3300025298 Ga0209050_1012320 Ga0209050_10123204 486
199 3300025303 Ga0209051_1000414 Ga0209051_100041443 486
200 3300025304 Ga0209257_1001608 Ga0209257_10016086 486
201 3300025304 Ga0209257_1001633 Ga0209257_10016336 486
202 3300031852 Ga0307410_10074262 Ga0307410_100742622 486
203 3300032004 Ga0307414_10044387 Ga0307414_100443872 486
204 iso_pu_bacteria 2919138771 2919142899 486
205 3300001990 JGI24737J22298_10005866 JGI24737J22298_100058663 487
206 3300002077 JGI24744J21845_10000092 JGI24744J21845_100000925 487
207 3300005338 Ga0068868_100101971 Ga0068868_1001019712 487
208 3300005355 Ga0070671_100019561 Ga0070671_1000195614 487
209 3300005356 Ga0070674_100017587 Ga0070674_1000175872 487
210 3300005564 Ga0070664_100040150 Ga0070664_1000401502 487
211 3300005578 Ga0068854_100039463 Ga0068854_1000394632 487
212 3300005618 Ga0068864_100022152 Ga0068864_1000221524 487
213 3300009098 Ga0105245_10063340 Ga0105245_100633401 487
214 3300013297 Ga0157378_10072940 Ga0157378_100729402 487
215 3300021358 Ga0213873_10000006 Ga0213873_10000006149 487
216 3300021384 Ga0213876_10000004 Ga0213876_10000004655 487
217 3300025263 Ga0209565_1000177 Ga0209565_100017744 487
218 3300025295 Ga0209564_1006875 Ga0209564_10068756 487
219 3300025315 Ga0207697_10002878 Ga0207697_100028782 487
220 3300025893 Ga0207682_10029510 Ga0207682_100295101 487
221 3300025901 Ga0207688_10008875 Ga0207688_100088752 487
222 3300025908 Ga0207643_10011785 Ga0207643_100117852 487
223 3300025919 Ga0207657_10026326 Ga0207657_100263263 487
224 3300025931 Ga0207644_10010689 Ga0207644_100106893 487
225 3300025933 Ga0207706_10007565 Ga0207706_100075655 487
226 3300025937 Ga0207669_10057417 Ga0207669_100574171 487
227 3300025940 Ga0207691_10031057 Ga0207691_100310573 487
228 3300025942 Ga0207689_10015713 Ga0207689_100157135 487
229 3300025981 Ga0207640_10035326 Ga0207640_100353262 487
230 3300026089 Ga0207648_10009201 Ga0207648_100092013 487
231 3300026121 Ga0207683_10012421 Ga0207683_100124214 487
232 3300037418 Ga0395900_0026110 Ga0395900_0026110_3908_5428 487
233 3300037471 Ga0395905_0012268 Ga0395905_0012268_5644_7164 487
234 3300039437 Ga0436365_0862833 Ga0436365_0862833_53600_55102 487
235 3300039453 Ga0436362_0949954 Ga0436362_0949954_48762_50264 487
236 3300048910 Ga0496107_0088270 Ga0496107_0088270_350_1870 487
237 3300048913 Ga0496110_0026788 Ga0496110_0026788_811_2316 487
238 3300048922 Ga0496119_0037310 Ga0496119_0037310_603_2078 487
239 3300049823 Ga0501044_0221797 Ga0501044_0221797_248_1723 487
240 3300005457 Ga0070662_100045811 Ga0070662_1000458112 488
241 3300005539 Ga0068853_100054738 Ga0068853_1000547382 488
242 3300005985 Ga0081539_10009077 Ga0081539_100090776 488
243 3300025932 Ga0207690_10002251 Ga0207690_100022515 488
244 3300025933 Ga0207706_10054124 Ga0207706_100541242 488
245 3300026041 Ga0207639_10184445 Ga0207639_101844452 488
246 3300037471 Ga0395905_0001817 Ga0395905_0001817_6846_8354 488
247 3300042157 Ga0439458_0000155 Ga0439458_0000155_5861_7372 488
248 3300046453 Ga0495627_000834 Ga0495627_000834_4411_5886 488
249 3300046519 Ga0495632_0000070 Ga0495632_0000070_78056_79528 488
250 3300046520 Ga0495637_0000307 Ga0495637_0000307_27834_29306 488
251 3300046522 Ga0495643_0000010 Ga0495643_0000010_109365_110837 488
252 3300046522 Ga0495643_0000110 Ga0495643_0000110_98780_100297 488
253 3300046524 Ga0495648_0008824 Ga0495648_0008824_2616_4088 488
254 3300046524 Ga0495648_0034818 Ga0495648_0034818_712_2187 488
255 3300046525 Ga0495663_0000004 Ga0495663_0000004_78065_79537 488
256 3300046537 Ga0495598_0007560 Ga0495598_0007560_958_2481 488
257 3300046558 Ga0495633_0000105 Ga0495633_0000105_3366_4838 488
258 3300046558 Ga0495633_0000910 Ga0495633_0000910_12119_13591 488
259 3300046692 Ga0495671_0000014 Ga0495671_0000014_109365_110837 488
260 3300047470 Ga0495681_0000322 Ga0495681_0000322_27800_29272 488
261 3300047472 Ga0495686_0009434 Ga0495686_0009434_3528_5000 488
262 3300048917 Ga0496114_0000006 Ga0496114_0000006_430624_432144 488
263 3300048918 Ga0496115_0000231 Ga0496115_0000231_7236_8708 488
264 3300048919 Ga0496116_0000195 Ga0496116_0000195_25442_26950 488
265 3300048925 Ga0496122_0003997 Ga0496122_0003997_16040_17548 488
266 3300048926 Ga0496123_0002162 Ga0496123_0002162_12478_13986 488
267 3300048927 Ga0496124_0000623 Ga0496124_0000623_25330_26838 488
268 3300048928 Ga0496125_0024185 Ga0496125_0024185_834_2342 488
269 3300048929 Ga0496126_0000136 Ga0496126_0000136_1264_2772 488
270 iso_pu_bacteria 2990265787 2990268742 488
271 iso_pu_bacteria 2993693658 2993694551 488
272 3300005356 Ga0070674_100004248 Ga0070674_1000042485 489
273 3300005366 Ga0070659_100052832 Ga0070659_1000528323 489
274 3300005434 Ga0070709_10025804 Ga0070709_100258042 489
275 3300005435 Ga0070714_100032886 Ga0070714_1000328862 489
276 3300005436 Ga0070713_100031712 Ga0070713_1000317124 489
277 3300005457 Ga0070662_100036920 Ga0070662_1000369202 489
278 3300005459 Ga0068867_100031850 Ga0068867_1000318503 489
279 3300005614 Ga0068856_100149059 Ga0068856_1001490592 489
280 3300005718 Ga0068866_10050927 Ga0068866_100509272 489
281 3300005841 Ga0068863_100004152 Ga0068863_1000041527 489
282 3300006028 Ga0070717_10004265 Ga0070717_100042659 489
283 3300006175 Ga0070712_100004917 Ga0070712_1000049173 489
284 3300006358 Ga0068871_100005301 Ga0068871_1000053015 489
285 3300009176 Ga0105242_10082761 Ga0105242_100827612 489
286 3300010375 Ga0105239_10231107 Ga0105239_102311072 489
287 3300013102 Ga0157371_10085492 Ga0157371_100854922 489
288 3300013105 Ga0157369_10086621 Ga0157369_100866212 489
289 3300013105 Ga0157369_10119780 Ga0157369_101197802 489
290 3300013306 Ga0163162_10106995 Ga0163162_101069952 489
291 3300014325 Ga0163163_10124150 Ga0163163_101241502 489
292 3300025904 Ga0207647_10006949 Ga0207647_100069494 489
293 3300025906 Ga0207699_10019924 Ga0207699_100199242 489
294 3300025909 Ga0207705_10012713 Ga0207705_100127135 489
295 3300025915 Ga0207693_10018850 Ga0207693_100188504 489
296 3300025928 Ga0207700_10034947 Ga0207700_100349472 489
297 3300025929 Ga0207664_10069933 Ga0207664_100699332 489
298 3300025933 Ga0207706_10020890 Ga0207706_100208902 489
299 3300025935 Ga0207709_10017316 Ga0207709_100173163 489
300 3300025940 Ga0207691_10010917 Ga0207691_100109172 489
301 3300025941 Ga0207711_10010559 Ga0207711_100105594 489
302 3300025960 Ga0207651_10000990 Ga0207651_100009907 489
303 3300025986 Ga0207658_10144181 Ga0207658_101441811 489
304 3300026078 Ga0207702_10053077 Ga0207702_100530773 489
305 3300026088 Ga0207641_10022509 Ga0207641_100225093 489
306 3300026089 Ga0207648_10021959 Ga0207648_100219593 489
307 3300026142 Ga0207698_10006283 Ga0207698_100062832 489
308 3300037471 Ga0395905_0049448 Ga0395905_0049448_2072_3655 489
309 3300046453 Ga0495627_000172 Ga0495627_000172_41412_42941 489
310 3300046471 Ga0495650_0006084 Ga0495650_0006084_4386_5915 489
311 3300046519 Ga0495632_0000248 Ga0495632_0000248_11899_13404 489
312 3300047470 Ga0495681_0000064 Ga0495681_0000064_56004_57533 489
313 3300048904 Ga0496101_0000325 Ga0496101_0000325_21574_23097 489
314 3300048910 Ga0496107_0001305 Ga0496107_0001305_12520_14043 489
315 3300048911 Ga0496108_0004818 Ga0496108_0004818_349_1872 489
316 3300048912 Ga0496109_0002536 Ga0496109_0002536_8728_10251 489
317 3300048913 Ga0496110_0000100 Ga0496110_0000100_21107_22630 489
318 3300048915 Ga0496112_0000364 Ga0496112_0000364_18470_19993 489
319 3300048916 Ga0496113_0000086 Ga0496113_0000086_8300_9823 489
320 3300048920 Ga0496117_0016813 Ga0496117_0016813_4432_5925 489
321 3300048921 Ga0496118_0039724 Ga0496118_0039724_409_1902 489
322 iso_pu_bacteria 2643221563 2643836408 489
323 iso_pu_bacteria 2643221608 2644052884 489
324 iso_pu_bacteria 2852653556 2852657257 489
325 iso_pu_bacteria 2896253425 2896253604 489
326 3300025229 Ga0209147_100288 Ga0209147_10028820 490
327 3300044712 Ga0453684_0053642 Ga0453684_0053642_3164_4675 490
328 3300053094 Ga0500566_0000258 Ga0500566_0000258_22677_24170 490
329 iso_pu_bacteria 2599185354 2600201437 490
330 iso_pu_bacteria 2852680915 2852683389 490
331 iso_pu_bacteria 2879163058 2879165562 490
332 iso_pu_bacteria 2946787523 2946790828 490
333 3300005262 Ga0065165_1001948 Ga0065165_10019482 491
334 3300031344 Ga0265316_10004231 Ga0265316_100042316 491
335 3300031344 Ga0265316_10023635 Ga0265316_100236352 491
336 3300037418 Ga0395900_0005369 Ga0395900_0005369_8001_9581 491
337 3300044673 Ga0453683_0004670 Ga0453683_0004670_5388_6905 491
338 3300048924 Ga0496121_0000413 Ga0496121_0000413_71060_72544 491
339 iso_pu_bacteria 2830075706 2830078904 491
340 iso_pu_bacteria 8054302542 8054307043 491
341 3300013105 Ga0157369_10051485 Ga0157369_100514854 492
342 3300013105 Ga0157369_10153672 Ga0157369_101536722 492
343 3300037418 Ga0395900_0017277 Ga0395900_0017277_5264_6775 492
344 3300037466 Ga0395898_0073080 Ga0395898_0073080_847_2358 492
345 3300037471 Ga0395905_0003401 Ga0395905_0003401_8945_10456 492
346 3300038443 Ga0395901_0006115 Ga0395901_0006115_7476_8987 492
347 3300046660 Ga0495625_0000841 Ga0495625_0000841_16399_17907 492
348 3300048912 Ga0496109_0113120 Ga0496109_0113120_657_2171 492
349 3300053118 Ga0500594_0022516 Ga0500594_0022516_50_1576 492
350 3300053119 Ga0500595_000624 Ga0500595_000624_6269_7768 492
351 iso_pu_bacteria 2599185359 2600225137 492
352 iso_pu_bacteria 2643221622 2644125179 492
353 iso_pu_bacteria 2818991466 2819713418 492
354 iso_pu_bacteria 2928526807 2928530337 492
355 iso_pu_bacteria 2928968154 2928971830 492
356 3300003781 Ga0055536_1000717 Ga0055536_10007173 493
357 3300003781 Ga0055536_1002872 Ga0055536_10028724 493
358 3300003791 Ga0055530_10000092 Ga0055530_1000009216 493
359 3300003794 Ga0055531_10000609 Ga0055531_100006095 493
360 3300025291 Ga0209675_1000366 Ga0209675_100036612 493
361 3300025292 Ga0209676_1000045 Ga0209676_1000045123 493
362 3300025292 Ga0209676_1000133 Ga0209676_1000133180 493
363 3300025298 Ga0209050_1000067 Ga0209050_1000067174 493
364 3300025304 Ga0209257_1000132 Ga0209257_10001327 493
365 3300031616 Ga0307508_10036606 Ga0307508_100366063 493
366 3300031731 Ga0307405_10080589 Ga0307405_100805891 493
367 3300035170 Ga0373943_0047327 Ga0373943_0047327_382_1911 493
368 3300053125 Ga0500618_002294 Ga0500618_002294_1331_2827 493
369 3300053139 Ga0500568_0003022 Ga0500568_0003022_6816_8321 493
370 iso_pu_bacteria 2896429255 2896429593 493
371 3300046616 Ga0495668_0000015 Ga0495668_0000015_381212_382720 494
372 3300048090 Ga0495615_0000128 Ga0495615_0000128_7504_9015 494
373 3300048923 Ga0496120_0021602 Ga0496120_0021602_2210_3700 494
374 3300048925 Ga0496122_0010921 Ga0496122_0010921_87_1598 494
375 3300048925 Ga0496122_0045752 Ga0496122_0045752_739_2229 494
376 3300048926 Ga0496123_0003021 Ga0496123_0003021_7659_9170 494
377 3300048927 Ga0496124_0000054 Ga0496124_0000054_147322_148812 494
378 3300048927 Ga0496124_0000631 Ga0496124_0000631_6901_8391 494
379 3300048927 Ga0496124_0058316 Ga0496124_0058316_1574_3085 494
380 iso_pu_bacteria 2818991438 2819555063 494
381 3300025304 Ga0209257_1006878 Ga0209257_10068785 495
382 3300045049 Ga0466959_0093414 Ga0466959_0093414_393_1895 495
383 3300046691 Ga0495670_0000033 Ga0495670_0000033_18504_20009 495
384 3300003215 JGI25153J46596_10015682 JGI25153J46596_100156822 496
385 3300003773 Ga0055537_1000357 Ga0055537_100035730 496
386 3300003775 Ga0055524_1000361 Ga0055524_100036126 496
387 3300003794 Ga0055531_10000100 Ga0055531_1000010093 496
388 3300003794 Ga0055531_10006181 Ga0055531_100061812 496
389 3300005327 Ga0070658_10000126 Ga0070658_1000012636 496
390 3300005339 Ga0070660_100000921 Ga0070660_1000009218 496
391 3300005355 Ga0070671_100012166 Ga0070671_1000121663 496
392 3300005366 Ga0070659_100003530 Ga0070659_1000035306 496
393 3300009177 Ga0105248_10200737 Ga0105248_102007372 496
394 3300015690 Ga0183363_1001 Ga0183363_1001431 496
395 3300021384 Ga0213876_10000138 Ga0213876_1000013815 496
396 3300021388 Ga0213875_10007605 Ga0213875_100076053 496
397 3300025263 Ga0209565_1000011 Ga0209565_100001132 496
398 3300025273 Ga0209673_1002201 Ga0209673_100220110 496
399 3300025291 Ga0209675_1005715 Ga0209675_10057153 496
400 3300025297 Ga0209758_1002209 Ga0209758_10022093 496
401 3300025298 Ga0209050_1000071 Ga0209050_1000071117 496
402 3300025298 Ga0209050_1001014 Ga0209050_100101431 496
403 3300025299 Ga0209256_1000016 Ga0209256_1000016567 496
404 3300025304 Ga0209257_1000027 Ga0209257_1000027186 496
405 3300025304 Ga0209257_1004785 Ga0209257_10047855 496
406 3300025909 Ga0207705_10000002 Ga0207705_10000002930 496
407 3300025914 Ga0207671_10096496 Ga0207671_100964962 496
408 3300025919 Ga0207657_10004995 Ga0207657_100049952 496
409 3300025941 Ga0207711_10136940 Ga0207711_101369402 496
410 3300037418 Ga0395900_0134602 Ga0395900_0134602_470_1975 496
411 3300037466 Ga0395898_0058424 Ga0395898_0058424_706_2211 496
412 3300037471 Ga0395905_0005643 Ga0395905_0005643_213_1718 496
413 3300037853 Ga0436364_0373695 Ga0436364_0373695_5082_6608 496
414 3300039437 Ga0436365_0798724 Ga0436365_0798724_21708_23204 496
415 3300039450 Ga0436363_0706963 Ga0436363_0706963_1696_3192 496
416 3300041410 Ga0439461_0004314 Ga0439461_0004314_208_1701 496
417 3300041413 Ga0439465_0000779 Ga0439465_0000779_4658_6154 496
418 3300041997 Ga0439431_0000238 Ga0439431_0000238_3757_5253 496
419 3300042002 Ga0439442_001068 Ga0439442_001068_2753_4249 496
420 3300042004 Ga0439445_0000152 Ga0439445_0000152_3461_4957 496
421 3300042006 Ga0439432_000314 Ga0439432_000314_7126_8622 496
422 3300042015 Ga0439462_0000557 Ga0439462_0000557_606_2102 496
423 3300042435 Ga0439434_0000358 Ga0439434_0000358_10904_12400 496
424 3300045976 Ga0466967_0039872 Ga0466967_0039872_519_2024 496
425 3300045976 Ga0466967_0084707 Ga0466967_0084707_104_1618 496
426 3300046515 Ga0495620_0016769 Ga0495620_0016769_493_1992 496
427 3300046616 Ga0495668_0057127 Ga0495668_0057127_491_2056 496
428 3300046684 Ga0495669_0000454 Ga0495669_0000454_9569_11134 496
429 3300046684 Ga0495669_0007971 Ga0495669_0007971_1249_2814 496
430 3300048912 Ga0496109_0150260 Ga0496109_0150260_439_1944 496
431 3300048927 Ga0496124_0008281 Ga0496124_0008281_1718_3214 496
432 3300049570 Ga0501033_0001724 Ga0501033_0001724_8861_10384 496
433 3300049571 Ga0501034_0004606 Ga0501034_0004606_328_1851 496
434 3300005333 Ga0070677_10000776 Ga0070677_1000077610 497
435 3300005347 Ga0070668_100034769 Ga0070668_1000347693 497
436 3300005353 Ga0070669_100005619 Ga0070669_1000056194 497
437 3300005354 Ga0070675_100003209 Ga0070675_1000032093 497
438 3300005548 Ga0070665_100071880 Ga0070665_1000718803 497
439 3300005985 Ga0081539_10014271 Ga0081539_100142716 497
440 3300014326 Ga0157380_10002530 Ga0157380_100025304 497
441 3300025893 Ga0207682_10002044 Ga0207682_100020446 497
442 3300025923 Ga0207681_10029467 Ga0207681_100294671 497
443 3300025925 Ga0207650_10009190 Ga0207650_100091903 497
444 3300025933 Ga0207706_10050328 Ga0207706_100503283 497
445 3300025933 Ga0207706_10076453 Ga0207706_100764533 497
446 3300025940 Ga0207691_10187079 Ga0207691_101870792 497
447 3300026121 Ga0207683_10146835 Ga0207683_101468352 497
448 3300028379 Ga0268266_10008869 Ga0268266_100088698 497
449 3300031731 Ga0307405_10032401 Ga0307405_100324013 497
450 3300031852 Ga0307410_10007304 Ga0307410_100073043 497
451 3300031852 Ga0307410_10089479 Ga0307410_100894792 497
452 3300031901 Ga0307406_10126904 Ga0307406_101269041 497
453 3300031911 Ga0307412_10004709 Ga0307412_100047095 497
454 3300031995 Ga0307409_100000126 Ga0307409_10000012619 497
455 3300032002 Ga0307416_100039255 Ga0307416_1000392553 497
456 3300032002 Ga0307416_100092270 Ga0307416_1000922702 497
457 3300032002 Ga0307416_100162193 Ga0307416_1001621931 497
458 3300032002 Ga0307416_100245032 Ga0307416_1002450322 497
459 3300032004 Ga0307414_10005163 Ga0307414_100051632 497
460 3300032005 Ga0307411_10000168 Ga0307411_100001685 497
461 3300032005 Ga0307411_10051596 Ga0307411_100515962 497
462 3300032126 Ga0307415_100007831 Ga0307415_1000078313 497
463 3300037466 Ga0395898_0093601 Ga0395898_0093601_705_2198 497
464 3300037471 Ga0395905_0001690 Ga0395905_0001690_14524_16032 497
465 3300038443 Ga0395901_0015133 Ga0395901_0015133_2814_4322 497
466 3300042007 Ga0439449_0018359 Ga0439449_0018359_425_1927 497
467 3300049578 Ga0501042_0026413 Ga0501042_0026413_1829_3442 497
468 3300049742 Ga0501080_0045116 Ga0501080_0045116_1039_2595 497
469 3300001990 JGI24737J22298_10002017 JGI24737J22298_100020172 498
470 3300005327 Ga0070658_10006493 Ga0070658_100064935 498
471 3300005328 Ga0070676_10002591 Ga0070676_100025916 498
472 3300005328 Ga0070676_10012477 Ga0070676_100124773 498
473 3300005331 Ga0070670_100003903 Ga0070670_1000039033 498
474 3300005334 Ga0068869_100000448 Ga0068869_10000044810 498
475 3300005335 Ga0070666_10010617 Ga0070666_100106174 498
476 3300005338 Ga0068868_100001969 Ga0068868_1000019696 498
477 3300005339 Ga0070660_100014704 Ga0070660_1000147041 498
478 3300005339 Ga0070660_100023827 Ga0070660_1000238272 498
479 3300005345 Ga0070692_10004884 Ga0070692_100048846 498
480 3300005345 Ga0070692_10020068 Ga0070692_100200682 498
481 3300005347 Ga0070668_100004822 Ga0070668_1000048224 498
482 3300005347 Ga0070668_100052128 Ga0070668_1000521282 498
483 3300005353 Ga0070669_100006160 Ga0070669_1000061602 498
484 3300005355 Ga0070671_100038689 Ga0070671_1000386893 498
485 3300005356 Ga0070674_100042674 Ga0070674_1000426742 498
486 3300005364 Ga0070673_100009404 Ga0070673_1000094046 498
487 3300005364 Ga0070673_100087221 Ga0070673_1000872212 498
488 3300005366 Ga0070659_100004141 Ga0070659_1000041414 498
489 3300005367 Ga0070667_100010506 Ga0070667_1000105062 498
490 3300005367 Ga0070667_100016087 Ga0070667_1000160874 498
491 3300005456 Ga0070678_100029833 Ga0070678_1000298333 498
492 3300005457 Ga0070662_100001271 Ga0070662_1000012712 498
493 3300005459 Ga0068867_100003211 Ga0068867_1000032118 498
494 3300005459 Ga0068867_100019298 Ga0068867_1000192982 498
495 3300005543 Ga0070672_100022246 Ga0070672_1000222463 498
496 3300005548 Ga0070665_100000905 Ga0070665_1000009054 498
497 3300005548 Ga0070665_100007805 Ga0070665_1000078052 498
498 3300005563 Ga0068855_100002466 Ga0068855_10000246611 498
499 3300005563 Ga0068855_100185406 Ga0068855_1001854062 498
500 3300005564 Ga0070664_100056833 Ga0070664_1000568332 498
501 3300005578 Ga0068854_100006975 Ga0068854_1000069758 498
502 3300005614 Ga0068856_100201311 Ga0068856_1002013112 498
503 3300005616 Ga0068852_100001133 Ga0068852_1000011336 498
504 3300005616 Ga0068852_100024888 Ga0068852_1000248883 498
505 3300005617 Ga0068859_100001175 Ga0068859_1000011756 498
506 3300005618 Ga0068864_100005277 Ga0068864_1000052772 498
507 3300005834 Ga0068851_10014247 Ga0068851_100142472 498
508 3300005842 Ga0068858_100004433 Ga0068858_1000044338 498
509 3300005842 Ga0068858_100029916 Ga0068858_1000299161 498
510 3300005843 Ga0068860_100007652 Ga0068860_10000765210 498
511 3300005843 Ga0068860_100009218 Ga0068860_1000092187 498
512 3300005844 Ga0068862_100094392 Ga0068862_1000943922 498
513 3300005844 Ga0068862_100149173 Ga0068862_1001491731 498
514 3300006852 Ga0075433_10003773 Ga0075433_100037739 498
515 3300006931 Ga0097620_100001175 Ga0097620_1000011756 498
516 3300009093 Ga0105240_10166068 Ga0105240_101660682 498
517 3300009098 Ga0105245_10003165 Ga0105245_100031654 498
518 3300009174 Ga0105241_10094491 Ga0105241_100944911 498
519 3300009177 Ga0105248_10000960 Ga0105248_1000096024 498
520 3300009553 Ga0105249_10001260 Ga0105249_100012604 498
521 3300010375 Ga0105239_10050417 Ga0105239_100504172 498
522 3300011119 Ga0105246_10005729 Ga0105246_100057294 498
523 3300011119 Ga0105246_10036060 Ga0105246_100360602 498
524 3300013100 Ga0157373_10005567 Ga0157373_100055676 498
525 3300013102 Ga0157371_10003227 Ga0157371_100032273 498
526 3300013297 Ga0157378_10008051 Ga0157378_100080513 498
527 3300025315 Ga0207697_10000038 Ga0207697_1000003840 498
528 3300025321 Ga0207656_10000684 Ga0207656_100006847 498
529 3300025903 Ga0207680_10041105 Ga0207680_100411052 498
530 3300025903 Ga0207680_10083205 Ga0207680_100832051 498
531 3300025904 Ga0207647_10000047 Ga0207647_1000004795 498
532 3300025904 Ga0207647_10000509 Ga0207647_1000050911 498
533 3300025907 Ga0207645_10035294 Ga0207645_100352942 498
534 3300025909 Ga0207705_10099653 Ga0207705_100996531 498
535 3300025911 Ga0207654_10066566 Ga0207654_100665662 498
536 3300025919 Ga0207657_10031889 Ga0207657_100318891 498
537 3300025923 Ga0207681_10001354 Ga0207681_100013543 498
538 3300025931 Ga0207644_10027059 Ga0207644_100270592 498
539 3300025932 Ga0207690_10004693 Ga0207690_100046932 498
540 3300025933 Ga0207706_10000857 Ga0207706_1000085718 498
541 3300025933 Ga0207706_10052387 Ga0207706_100523871 498
542 3300025936 Ga0207670_10022046 Ga0207670_100220461 498
543 3300025938 Ga0207704_10143228 Ga0207704_101432281 498
544 3300025940 Ga0207691_10000672 Ga0207691_100006728 498
545 3300025940 Ga0207691_10002554 Ga0207691_100025543 498
546 3300025941 Ga0207711_10021022 Ga0207711_100210223 498
547 3300025942 Ga0207689_10000190 Ga0207689_1000019041 498
548 3300025949 Ga0207667_10031142 Ga0207667_100311424 498
549 3300025960 Ga0207651_10000287 Ga0207651_1000028711 498
550 3300025960 Ga0207651_10031604 Ga0207651_100316042 498
551 3300025960 Ga0207651_10124119 Ga0207651_101241191 498
552 3300025961 Ga0207712_10000280 Ga0207712_1000028023 498
553 3300025986 Ga0207658_10027128 Ga0207658_100271284 498
554 3300026023 Ga0207677_10003280 Ga0207677_100032804 498
555 3300026035 Ga0207703_10004007 Ga0207703_100040077 498
556 3300026035 Ga0207703_10008076 Ga0207703_100080762 498
557 3300026088 Ga0207641_10020578 Ga0207641_100205782 498
558 3300026089 Ga0207648_10008175 Ga0207648_100081754 498
559 3300026089 Ga0207648_10015911 Ga0207648_100159117 498
560 3300026095 Ga0207676_10003827 Ga0207676_100038275 498
561 3300026116 Ga0207674_10020538 Ga0207674_100205385 498
562 3300026116 Ga0207674_10075707 Ga0207674_100757073 498
563 3300026118 Ga0207675_100135922 Ga0207675_1001359222 498
564 3300026142 Ga0207698_10011190 Ga0207698_100111903 498
565 3300028379 Ga0268266_10000423 Ga0268266_1000042318 498
566 3300028379 Ga0268266_10006759 Ga0268266_100067595 498
567 3300028380 Ga0268265_10003997 Ga0268265_1000399710 498
568 3300028380 Ga0268265_10007583 Ga0268265_100075832 498
569 3300028381 Ga0268264_10003154 Ga0268264_100031549 498
570 3300028381 Ga0268264_10007972 Ga0268264_100079728 498
571 3300028381 Ga0268264_10018910 Ga0268264_100189102 498
572 3300031824 Ga0307413_10011708 Ga0307413_100117082 498
573 3300031995 Ga0307409_100233516 Ga0307409_1002335161 498
574 3300037312 Ga0395899_0015906 Ga0395899_0015906_485_1996 498
575 3300037312 Ga0395899_0073235 Ga0395899_0073235_826_2337 498
576 3300037418 Ga0395900_0008230 Ga0395900_0008230_7049_8566 498
577 3300037418 Ga0395900_0047646 Ga0395900_0047646_1313_2833 498
578 3300037418 Ga0395900_0070727 Ga0395900_0070727_380_1891 498
579 3300037418 Ga0395900_0077265 Ga0395900_0077265_1166_2677 498
580 3300037471 Ga0395905_0056782 Ga0395905_0056782_698_2209 498
581 3300037471 Ga0395905_0199636 Ga0395905_0199636_294_1826 498
582 3300038443 Ga0395901_0057940 Ga0395901_0057940_1492_3003 498
583 3300038443 Ga0395901_0126021 Ga0395901_0126021_1138_2661 498
584 3300046501 Ga0495607_0049320 Ga0495607_0049320_860_2446 498
585 3300046684 Ga0495669_0032992 Ga0495669_0032992_333_1847 498
586 3300050515 nmdc:mga0a205_1958_c1 nmdc:mga0a205_1958_c1_15448_16962 498
587 3300001989 JGI24739J22299_10002025 JGI24739J22299_100020252 499
588 3300005329 Ga0070683_100015689 Ga0070683_1000156892 499
589 3300005331 Ga0070670_100026650 Ga0070670_1000266503 499
590 3300005335 Ga0070666_10013961 Ga0070666_100139611 499
591 3300005338 Ga0068868_100159793 Ga0068868_1001597931 499
592 3300005344 Ga0070661_100004370 Ga0070661_1000043705 499
593 3300005355 Ga0070671_100001233 Ga0070671_1000012339 499
594 3300005364 Ga0070673_100004233 Ga0070673_1000042334 499
595 3300005367 Ga0070667_100007904 Ga0070667_1000079044 499
596 3300005455 Ga0070663_100036273 Ga0070663_1000362733 499
597 3300005455 Ga0070663_100041855 Ga0070663_1000418552 499
598 3300005457 Ga0070662_100031608 Ga0070662_1000316082 499
599 3300005548 Ga0070665_100021722 Ga0070665_1000217224 499
600 3300005564 Ga0070664_100000197 Ga0070664_1000001977 499
601 3300005578 Ga0068854_100043706 Ga0068854_1000437063 499
602 3300005614 Ga0068856_100011902 Ga0068856_1000119026 499
603 3300005616 Ga0068852_100026985 Ga0068852_1000269851 499
604 3300005985 Ga0081539_10009122 Ga0081539_100091222 499
605 3300013102 Ga0157371_10031261 Ga0157371_100312612 499
606 3300025903 Ga0207680_10058330 Ga0207680_100583302 499
607 3300025919 Ga0207657_10017906 Ga0207657_100179065 499
608 3300025925 Ga0207650_10004732 Ga0207650_100047324 499
609 3300025925 Ga0207650_10090567 Ga0207650_100905672 499
610 3300025931 Ga0207644_10000699 Ga0207644_100006999 499
611 3300025933 Ga0207706_10047188 Ga0207706_100471883 499
612 3300025933 Ga0207706_10074372 Ga0207706_100743723 499
613 3300025937 Ga0207669_10031408 Ga0207669_100314082 499
614 3300025945 Ga0207679_10005414 Ga0207679_100054147 499
615 3300026067 Ga0207678_10012762 Ga0207678_100127623 499
616 3300026078 Ga0207702_10006625 Ga0207702_100066258 499
617 3300026095 Ga0207676_10002566 Ga0207676_100025663 499
618 3300026116 Ga0207674_10001422 Ga0207674_1000142222 499
619 3300026121 Ga0207683_10058239 Ga0207683_100582392 499
620 3300044684 Ga0466966_0045470 Ga0466966_0045470_355_1938 499
621 3300044693 Ga0466961_0022950 Ga0466961_0022950_916_2499 499
622 3300044694 Ga0466963_0000326 Ga0466963_0000326_10031_11557 499
623 3300044765 Ga0466970_0054679 Ga0466970_0054679_474_2057 499
624 3300044842 Ga0466957_0006842 Ga0466957_0006842_1148_2674 499
625 3300044842 Ga0466957_0078620 Ga0466957_0078620_168_1751 499
626 3300045836 Ga0466958_0058553 Ga0466958_0058553_213_1796 499
627 3300045976 Ga0466967_0000149 Ga0466967_0000149_5552_7078 499

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

17

341

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.7922 17 494
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.7893 13 487
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.7891 14 488
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.7877 8 490
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.7871 17 494
ID Description Score Start End Superfamily
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8831 15 205 1.20.1250.20
af_A4HTX4_43_271_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8818 21 205 1.20.1250.20
af_F1Q8H2_217_537_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8814 299 496 1.20.1250.20
af_P9WLG3_19_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.881 13 202 1.20.1250.20
af_Q9W509_423_624_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8808 10 204 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A520EI61-F1-model_v4 deleted 0.9947 308 494
AF-A0A2W4YSZ6-F1-model_v4 MFS transporter 0.9863 6 499 GO:0016020
GO:0022857
AF-A0A2N5Z552-F1-model_v4 MFS transporter 0.9847 6 203 GO:0016020
GO:0022857
AF-A0A7C1DYW7-F1-model_v4 MFS transporter 0.9817 7 218 GO:0016020
GO:0022857
AF-A0A7V8A7L8-F1-model_v4 MFS transporter 0.9812 294 499 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map