F470527

General Info

Members Datasets Scaffolds Average Seq Length
627 264 622 333

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10063902|rootL2_100639022
Length 386
Sequence MDFQLPIQIDALPQPIGYPDKVMLTGSCFTEHIGNALRDWKFDTLQNPNGILFDPASVASSIIAYMEGRPYQEDDLVYFNELWQSWHHHSQFSHMDKGEALRGINGSLARAHAFLKEAKWLIITLGSAFSYRLAPDAPAQYWPESMSKGPIAADPTLLNIQSSTGALSSVANCHRAPGQTFRKHLMTIEEINTALDGCLYRLFQFNPSLQVIFTVSPVRHIRDGVVENNRSKARLIESVHHLVNKFSRLYYFPAYELVIDVLRDYRFYDIDMVHPNYPATQFVLEHFTRHYIDKGSQAIIEEVKRIVTARKHKPFQPSTQAHKRFLQDHLQRTEXXWRCVVLSSICGKSWRIFRRQGSNKNFFFYGSFISVTLQLLLTIPPIQVAF

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
227 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
230 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
231 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
232 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.31
Nodule 0
Rhizoplane 0.48
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000673 3300002459 Bacteria 8529
2 JGI25406J46586_10001920 3300003203 Bacteria 9796
3 rootH1_10078605 3300003316 Bacteria 2311
4 rootH2_10008117 3300003320 Bacteria 30213
5 rootH2_10036959 3300003320 Bacteria 16537
6 rootH2_10085841 3300003320 Bacteria 2695
7 rootH2_10111981 3300003320 Bacteria 3402
8 rootH2_10135059 3300003320 Bacteria 3112
9 rootH2_10176815 3300003320 Bacteria 3475
10 rootH2_10329777 3300003320 Bacteria 1346
11 rootL2_10063902 3300003322 Bacteria 2716
12 rootL2_10274444 3300003322 Bacteria 3344
13 rootH1_10025575 3300003323 Bacteria 6892
14 rootH1_10060970 3300003323 Bacteria 2830
15 rootH1_10220108 3300003323 Bacteria 1752
16 rootH1_10248611 3300003323 Bacteria 3879
17 rootH1_10299774 3300003323 Unclassified 3278
18 Ga0065704_10143018 3300005289 Bacteria 1499
19 Ga0065712_10014358 3300005290 Bacteria 2443
20 Ga0065712_10073956 3300005290 Bacteria 4223
21 Ga0070658_10000438 3300005327 Bacteria 36124
22 Ga0070676_10000997 3300005328 Bacteria 14074
23 Ga0070676_10006732 3300005328 Bacteria 6155
24 Ga0070683_100007365 3300005329 Bacteria 9297
25 Ga0070670_100025151 3300005331 Bacteria 5123
26 Ga0070670_100092053 3300005331 Unclassified 2607
27 Ga0070677_10033659 3300005333 Bacteria 1975
28 Ga0068869_100028262 3300005334 Bacteria 3918
29 Ga0068869_100040799 3300005334 Bacteria 3320
30 Ga0068869_100125533 3300005334 Unclassified 1967
31 Ga0068869_100139840 3300005334 Bacteria 1868
32 Ga0068869_100196651 3300005334 Bacteria 1588
33 Ga0068869_100200978 3300005334 Unclassified 1571
34 Ga0070666_10000405 3300005335 Bacteria 27033
35 Ga0070666_10000456 3300005335 Bacteria 24899
36 Ga0070680_100422813 3300005336 Unclassified 1137
37 Ga0070682_100066390 3300005337 Bacteria 2295
38 Ga0070682_100233776 3300005337 Bacteria 1315
39 Ga0068868_100009246 3300005338 Bacteria 7084
40 Ga0068868_100102378 3300005338 Bacteria 2319
41 Ga0068868_100107167 3300005338 Bacteria 2267
42 Ga0070660_100156045 3300005339 Bacteria 1837
43 Ga0070689_100002169 3300005340 Bacteria 12712
44 Ga0070689_100002275 3300005340 Bacteria 12482
45 Ga0070689_100201778 3300005340 Unclassified 1624
46 Ga0070691_10007869 3300005341 Bacteria 4876
47 Ga0070691_10034522 3300005341 Unclassified 2381
48 Ga0070668_100000202 3300005347 Bacteria 39154
49 Ga0070668_100113840 3300005347 Unclassified 2155
50 Ga0070675_100037287 3300005354 Bacteria 3959
51 Ga0070675_100054206 3300005354 Unclassified 3299
52 Ga0070671_100017197 3300005355 Bacteria 5854
53 Ga0070671_100062625 3300005355 Bacteria 3097
54 Ga0070671_100175604 3300005355 Bacteria 1812
55 Ga0070674_100012087 3300005356 Bacteria 5290
56 Ga0070674_100021668 3300005356 Bacteria 4132
57 Ga0070674_100060611 3300005356 Bacteria 2638
58 Ga0070674_100065186 3300005356 Unclassified 2556
59 Ga0070674_100081456 3300005356 Unclassified 2313
60 Ga0070674_100121882 3300005356 Unclassified 1931
61 Ga0070673_100012679 3300005364 Bacteria 5797
62 Ga0070673_100015158 3300005364 Bacteria 5403
63 Ga0070673_100033648 3300005364 Bacteria 3873
64 Ga0070673_100077223 3300005364 Bacteria 2691
65 Ga0070673_100141987 3300005364 Unclassified 2026
66 Ga0070673_100195709 3300005364 Bacteria 1739
67 Ga0070659_100009938 3300005366 Bacteria 6998
68 Ga0070659_100046176 3300005366 Bacteria 3414
69 Ga0070667_100011370 3300005367 Bacteria 7359
70 Ga0070667_100013521 3300005367 Bacteria 6745
71 Ga0070667_100022399 3300005367 Bacteria 5240
72 Ga0070667_100062228 3300005367 Bacteria 3161
73 Ga0070667_100285391 3300005367 Unclassified 1483
74 Ga0070701_10085384 3300005438 Unclassified 1718
75 Ga0070700_100032359 3300005441 Bacteria 3142
76 Ga0070663_100029912 3300005455 Bacteria 3727
77 Ga0070663_100352807 3300005455 Bacteria 1191
78 Ga0070662_100003965 3300005457 Bacteria 9278
79 Ga0070662_100016841 3300005457 Bacteria 4913
80 Ga0070681_10032305 3300005458 Bacteria 5252
81 Ga0070681_10065931 3300005458 Bacteria 3590
82 Ga0070681_10150155 3300005458 Bacteria 2257
83 Ga0070681_10150342 3300005458 Bacteria 2255
84 Ga0068867_100005053 3300005459 Bacteria 9312
85 Ga0068867_100042570 3300005459 Bacteria 3323
86 Ga0068867_100082585 3300005459 Bacteria 2424
87 Ga0068867_100174164 3300005459 Bacteria 1706
88 Ga0068867_100227742 3300005459 Bacteria 1505
89 Ga0070685_10091216 3300005466 Bacteria 1844
90 Ga0070685_10238468 3300005466 Unclassified 1199
91 Ga0070685_10312000 3300005466 Bacteria 1063
92 Ga0070698_100040258 3300005471 Bacteria 4804
93 Ga0070679_100001217 3300005530 Bacteria 22656
94 Ga0070679_100076589 3300005530 Bacteria 3334
95 Ga0070684_100036422 3300005535 Bacteria 4216
96 Ga0070684_100154219 3300005535 Bacteria 2082
97 Ga0068853_100020367 3300005539 Bacteria 5516
98 Ga0068853_100022604 3300005539 Bacteria 5254
99 Ga0068853_100023126 3300005539 Bacteria 5202
100 Ga0068853_100094426 3300005539 Bacteria 2635
101 Ga0068853_100105862 3300005539 Bacteria 2492
102 Ga0070672_100001130 3300005543 Bacteria 16305
103 Ga0070672_100022329 3300005543 Bacteria 4647
104 Ga0070672_100080005 3300005543 Bacteria 2617
105 Ga0070672_100166508 3300005543 Bacteria 1831
106 Ga0070686_100086818 3300005544 Bacteria 2084
107 Ga0070693_100100748 3300005547 Bacteria 1759
108 Ga0070665_100000074 3300005548 Bacteria 192944
109 Ga0070665_100004519 3300005548 Bacteria 14580
110 Ga0070665_100019347 3300005548 Bacteria 6832
111 Ga0068855_100000454 3300005563 Bacteria 50341
112 Ga0068855_100022169 3300005563 Bacteria 7611
113 Ga0068855_100028168 3300005563 Bacteria 6720
114 Ga0068855_100029855 3300005563 Bacteria 6520
115 Ga0068855_100041388 3300005563 Bacteria 5461
116 Ga0068855_100365613 3300005563 Bacteria 1587
117 Ga0070664_100047357 3300005564 Unclassified 3632
118 Ga0070664_100140282 3300005564 Bacteria 2128
119 Ga0068857_100005191 3300005577 Bacteria 11081
120 Ga0068857_100058034 3300005577 Bacteria 3436
121 Ga0068857_100077874 3300005577 Bacteria 2959
122 Ga0068857_100105370 3300005577 Bacteria 2532
123 Ga0068857_100127189 3300005577 Bacteria 2297
124 Ga0068854_100071268 3300005578 Bacteria 2542
125 Ga0068856_100084463 3300005614 Unclassified 3154
126 Ga0068852_100001872 3300005616 Bacteria 14316
127 Ga0068852_100034055 3300005616 Bacteria 4236
128 Ga0068852_100046829 3300005616 Bacteria 3686
129 Ga0068852_100208529 3300005616 Bacteria 1852
130 Ga0068852_100257532 3300005616 Bacteria 1674
131 Ga0068852_100323052 3300005616 Bacteria 1499
132 Ga0068852_100380479 3300005616 Bacteria 1385
133 Ga0068859_100000066 3300005617 Bacteria 100640
134 Ga0068859_100006157 3300005617 Bacteria 12197
135 Ga0068859_100023655 3300005617 Bacteria 6167
136 Ga0068859_100073625 3300005617 Bacteria 3454
137 Ga0068859_100115010 3300005617 Bacteria 2755
138 Ga0068859_100343515 3300005617 Bacteria 1587
139 Ga0068864_100000772 3300005618 Bacteria 26853
140 Ga0068864_100026626 3300005618 Bacteria 4876
141 Ga0068864_100054843 3300005618 Bacteria 3440
142 Ga0068864_100226792 3300005618 Bacteria 1726
143 Ga0068861_100002110 3300005719 Bacteria 12883
144 Ga0068861_100014925 3300005719 Bacteria 5461
145 Ga0068851_10000581 3300005834 Bacteria 15903
146 Ga0068870_10030009 3300005840 Bacteria 2745
147 Ga0068863_100002306 3300005841 Bacteria 18971
148 Ga0068863_100003530 3300005841 Bacteria 15431
149 Ga0068863_100021215 3300005841 Bacteria 6201
150 Ga0068863_100067294 3300005841 Bacteria 3388
151 Ga0068863_100077385 3300005841 Unclassified 3148
152 Ga0068863_100116363 3300005841 Bacteria 2548
153 Ga0068863_100194998 3300005841 Bacteria 1947
154 Ga0068863_100214721 3300005841 Bacteria 1853
155 Ga0068863_100278630 3300005841 Bacteria 1620
156 Ga0068863_100510490 3300005841 Bacteria 1184
157 Ga0068858_100000805 3300005842 Bacteria 32800
158 Ga0068858_100005353 3300005842 Bacteria 12591
159 Ga0068858_100174583 3300005842 Bacteria 2027
160 Ga0068860_100000110 3300005843 Bacteria 131175
161 Ga0068860_100009960 3300005843 Bacteria 9419
162 Ga0068860_100010524 3300005843 Bacteria 9143
163 Ga0068860_100023578 3300005843 Bacteria 5948
164 Ga0068860_100191429 3300005843 Unclassified 1979
165 Ga0068860_100212937 3300005843 Unclassified 1875
166 Ga0081540_1003257 3300005983 Bacteria 12898
167 Ga0081539_10002362 3300005985 Bacteria 27082
168 Ga0075366_10019005 3300006195 Bacteria 3972
169 Ga0075366_10182641 3300006195 Bacteria 1274
170 Ga0097621_100000138 3300006237 Bacteria 43428
171 Ga0097621_100002282 3300006237 Bacteria 13139
172 Ga0097621_100014028 3300006237 Bacteria 5988
173 Ga0097621_100044926 3300006237 Unclassified 3566
174 Ga0068871_100000427 3300006358 Bacteria 29046
175 Ga0068871_100001816 3300006358 Bacteria 14405
176 Ga0068871_100006696 3300006358 Bacteria 8175
177 Ga0068871_100015060 3300006358 Bacteria 5780
178 Ga0068871_100033404 3300006358 Bacteria 4074
179 Ga0068871_100130943 3300006358 Unclassified 2127
180 Ga0068871_100133860 3300006358 Bacteria 2104
181 Ga0075428_100025432 3300006844 Bacteria 6552
182 Ga0075428_100263981 3300006844 Bacteria 1853
183 Ga0075430_100005928 3300006846 Bacteria 10322
184 Ga0075431_100115586 3300006847 Unclassified 2770
185 Ga0075429_100144472 3300006880 Unclassified 2082
186 Ga0075429_100173479 3300006880 Bacteria 1889
187 Ga0068865_100008579 3300006881 Bacteria 6319
188 Ga0068865_100012717 3300006881 Bacteria 5304
189 Ga0097620_100000066 3300006931 Bacteria 100640
190 Ga0097620_100006157 3300006931 Bacteria 12197
191 Ga0097620_100023655 3300006931 Bacteria 6167
192 Ga0097620_100073628 3300006931 Bacteria 3454
193 Ga0097620_100115012 3300006931 Bacteria 2755
194 Ga0097620_100343485 3300006931 Bacteria 1587
195 Ga0105240_10000011 3300009093 Bacteria 523646
196 Ga0105240_10000253 3300009093 Bacteria 106101
197 Ga0105240_10001160 3300009093 Bacteria 46165
198 Ga0105240_10001493 3300009093 Bacteria 39862
199 Ga0105240_10003903 3300009093 Bacteria 23022
200 Ga0105240_10005924 3300009093 Bacteria 18106
201 Ga0105240_10019282 3300009093 Bacteria 9117
202 Ga0105240_10032806 3300009093 Bacteria 6718
203 Ga0105240_10043036 3300009093 Bacteria 5750
204 Ga0105240_10062565 3300009093 Bacteria 4633
205 Ga0105240_10237462 3300009093 Bacteria 2115
206 Ga0111539_10008819 3300009094 Bacteria 12781
207 Ga0111539_10015160 3300009094 Bacteria 9603
208 Ga0111539_10480883 3300009094 Unclassified 1446
209 Ga0111539_10541210 3300009094 Unclassified 1356
210 Ga0105247_10001631 3300009101 Bacteria 15867
211 Ga0105247_10013430 3300009101 Unclassified 4911
212 Ga0114129_10020798 3300009147 Bacteria 9324
213 Ga0105241_10000921 3300009174 Bacteria 22269
214 Ga0105241_10001740 3300009174 Bacteria 16524
215 Ga0105241_10003754 3300009174 Bacteria 11266
216 Ga0105241_10032525 3300009174 Bacteria 3911
217 Ga0105241_10060412 3300009174 Bacteria 2916
218 Ga0105241_10117716 3300009174 Bacteria 2135
219 Ga0105241_10144158 3300009174 Bacteria 1943
220 Ga0105241_10189856 3300009174 Bacteria 1710
221 Ga0105242_10004602 3300009176 Bacteria 10693
222 Ga0105242_10012591 3300009176 Bacteria 6512
223 Ga0105242_10015317 3300009176 Bacteria 5955
224 Ga0105242_10046232 3300009176 Bacteria 3531
225 Ga0105242_10401590 3300009176 Unclassified 1279
226 Ga0105248_10007233 3300009177 Bacteria 12177
227 Ga0105248_10020667 3300009177 Bacteria 7296
228 Ga0105237_10000169 3300009545 Bacteria 92124
229 Ga0105237_10019647 3300009545 Bacteria 6976
230 Ga0105237_10040889 3300009545 Bacteria 4676
231 Ga0105237_10041931 3300009545 Bacteria 4615
232 Ga0105237_10076119 3300009545 Bacteria 3346
233 Ga0105237_10200501 3300009545 Unclassified 1995
234 Ga0105238_10000806 3300009551 Bacteria 32512
235 Ga0105238_10028558 3300009551 Bacteria 5683
236 Ga0105238_10036705 3300009551 Bacteria 4982
237 Ga0105238_10113786 3300009551 Unclassified 2685
238 Ga0105238_10146275 3300009551 Bacteria 2340
239 Ga0105249_10008000 3300009553 Bacteria 9215
240 Ga0105249_10010825 3300009553 Bacteria 8015
241 Ga0105249_10026614 3300009553 Bacteria 5215
242 Ga0105249_10038416 3300009553 Bacteria 4343
243 Ga0105249_10063605 3300009553 Bacteria 3390
244 Ga0105239_10000052 3300010375 Bacteria 164624
245 Ga0105239_10000754 3300010375 Bacteria 45868
246 Ga0105239_10002487 3300010375 Bacteria 23470
247 Ga0105239_10004525 3300010375 Bacteria 16578
248 Ga0105239_10005010 3300010375 Bacteria 15637
249 Ga0105239_10005357 3300010375 Bacteria 15059
250 Ga0105239_10008603 3300010375 Bacteria 11572
251 Ga0105239_10027112 3300010375 Bacteria 6307
252 Ga0105239_10032240 3300010375 Bacteria 5759
253 Ga0105239_10052253 3300010375 Bacteria 4481
254 Ga0105239_10162460 3300010375 Bacteria 2496
255 Ga0105239_10246516 3300010375 Unclassified 2006
256 Ga0157373_10056810 3300013100 Bacteria 2778
257 Ga0157373_10096532 3300013100 Bacteria 2081
258 Ga0157373_10112212 3300013100 Bacteria 1916
259 Ga0157373_10132151 3300013100 Bacteria 1755
260 Ga0157371_10012550 3300013102 Bacteria 6471
261 Ga0157370_10003352 3300013104 Bacteria 18863
262 Ga0157370_10008048 3300013104 Bacteria 11413
263 Ga0157370_10010246 3300013104 Bacteria 9898
264 Ga0157370_10011930 3300013104 Bacteria 9060
265 Ga0157369_10066016 3300013105 Bacteria 3893
266 Ga0157369_10091598 3300013105 Bacteria 3245
267 Ga0157369_10109167 3300013105 Unclassified 2942
268 Ga0157369_10126575 3300013105 Bacteria 2708
269 Ga0157369_10247999 3300013105 Bacteria 1859
270 Ga0157369_10309289 3300013105 Unclassified 1643
271 Ga0157374_10000003 3300013296 Bacteria 854471
272 Ga0157374_10001182 3300013296 Bacteria 22286
273 Ga0157374_10011352 3300013296 Bacteria 7709
274 Ga0157374_10014412 3300013296 Bacteria 6919
275 Ga0157374_10083438 3300013296 Bacteria 3036
276 Ga0157374_10174420 3300013296 Bacteria 2099
277 Ga0157378_10002641 3300013297 Bacteria 15976
278 Ga0157378_10004255 3300013297 Bacteria 12619
279 Ga0157378_10012471 3300013297 Bacteria 7442
280 Ga0157378_10014067 3300013297 Bacteria 7006
281 Ga0157378_10036965 3300013297 Bacteria 4323
282 Ga0157378_10059536 3300013297 Unclassified 3408
283 Ga0157378_10143486 3300013297 Unclassified 2219
284 Ga0157378_10198296 3300013297 Unclassified 1897
285 Ga0157378_10349068 3300013297 Bacteria 1445
286 Ga0163162_10000531 3300013306 Bacteria 35292
287 Ga0163162_10001109 3300013306 Bacteria 24984
288 Ga0163162_10001227 3300013306 Bacteria 23959
289 Ga0163162_10007084 3300013306 Bacteria 10882
290 Ga0163162_10015300 3300013306 Bacteria 7494
291 Ga0163162_10021924 3300013306 Bacteria 6292
292 Ga0163162_10029320 3300013306 Bacteria 5445
293 Ga0163162_10039867 3300013306 Unclassified 4694
294 Ga0163162_10052313 3300013306 Bacteria 4101
295 Ga0163162_10265357 3300013306 Bacteria 1849
296 Ga0163162_10382662 3300013306 Bacteria 1540
297 Ga0163162_10416434 3300013306 Bacteria 1476
298 Ga0157372_10002664 3300013307 Bacteria 19339
299 Ga0157372_10003000 3300013307 Bacteria 18202
300 Ga0157372_10008075 3300013307 Bacteria 11195
301 Ga0157372_10018402 3300013307 Bacteria 7508
302 Ga0157372_10023794 3300013307 Bacteria 6645
303 Ga0157372_10128787 3300013307 Unclassified 2911
304 Ga0157372_10144429 3300013307 Bacteria 2744
305 Ga0157372_10321777 3300013307 Bacteria 1801
306 Ga0157372_10613456 3300013307 Unclassified 1268
307 Ga0157372_10782263 3300013307 Bacteria 1109
308 Ga0157375_10000230 3300013308 Bacteria 52234
309 Ga0157375_10011512 3300013308 Bacteria 7811
310 Ga0157375_10080650 3300013308 Bacteria 3293
311 Ga0157375_10088979 3300013308 Bacteria 3143
312 Ga0157375_10139479 3300013308 Unclassified 2550
313 Ga0157375_10207895 3300013308 Bacteria 2114
314 Ga0157375_10327314 3300013308 Bacteria 1697
315 Ga0157375_10343914 3300013308 Bacteria 1657
316 Ga0163163_10000141 3300014325 Bacteria 74842
317 Ga0163163_10005606 3300014325 Bacteria 10874
318 Ga0163163_10014392 3300014325 Bacteria 7273
319 Ga0163163_10073305 3300014325 Bacteria 3414
320 Ga0157380_10001158 3300014326 Bacteria 17072
321 Ga0157380_10011554 3300014326 Bacteria 6381
322 Ga0157380_10106081 3300014326 Unclassified 2350
323 Ga0157380_10110525 3300014326 Bacteria 2308
324 Ga0157377_10001217 3300014745 Bacteria 10977
325 Ga0157377_10008432 3300014745 Bacteria 5027
326 Ga0157379_10003524 3300014968 Bacteria 13248
327 Ga0157379_10004457 3300014968 Bacteria 12010
328 Ga0157379_10051501 3300014968 Bacteria 3678
329 Ga0157376_10000472 3300014969 Bacteria 25927
330 Ga0157376_10000514 3300014969 Bacteria 24959
331 Ga0157376_10004908 3300014969 Bacteria 9323
332 Ga0157376_10034592 3300014969 Bacteria 4081
333 Ga0157376_10118277 3300014969 Bacteria 2344
334 Ga0157376_10240533 3300014969 Bacteria 1686
335 Ga0157376_10289569 3300014969 Unclassified 1546
336 Ga0213876_10008585 3300021384 Bacteria 5531
337 Ga0209646_1001651 3300025246 Bacteria 5719
338 Ga0207426_1000105 3300025302 Bacteria 247269
339 Ga0207656_10001031 3300025321 Bacteria 9097
340 Ga0207682_10003280 3300025893 Bacteria 7075
341 Ga0207688_10107352 3300025901 Unclassified 1618
342 Ga0207688_10170651 3300025901 Unclassified 1293
343 Ga0207680_10000143 3300025903 Bacteria 34125
344 Ga0207680_10000787 3300025903 Bacteria 14979
345 Ga0207680_10051997 3300025903 Bacteria 2452
346 Ga0207647_10000139 3300025904 Bacteria 57477
347 Ga0207647_10048330 3300025904 Bacteria 2642
348 Ga0207645_10000511 3300025907 Bacteria 32164
349 Ga0207645_10000769 3300025907 Bacteria 26709
350 Ga0207705_10018385 3300025909 Unclassified 4998
351 Ga0207654_10001605 3300025911 Bacteria 11858
352 Ga0207654_10043080 3300025911 Unclassified 2557
353 Ga0207654_10071506 3300025911 Bacteria 2062
354 Ga0207654_10080442 3300025911 Bacteria 1959
355 Ga0207707_10111459 3300025912 Unclassified 2392
356 Ga0207707_10234589 3300025912 Unclassified 1596
357 Ga0207695_10000010 3300025913 Bacteria 981919
358 Ga0207695_10000021 3300025913 Bacteria 679399
359 Ga0207695_10000039 3300025913 Bacteria 454801
360 Ga0207695_10000073 3300025913 Bacteria 312565
361 Ga0207695_10001248 3300025913 Bacteria 43473
362 Ga0207695_10028522 3300025913 Bacteria 6188
363 Ga0207695_10054406 3300025913 Bacteria 4180
364 Ga0207695_10085174 3300025913 Bacteria 3190
365 Ga0207695_10086049 3300025913 Bacteria 3171
366 Ga0207695_10182395 3300025913 Unclassified 2020
367 Ga0207695_10460267 3300025913 Unclassified 1155
368 Ga0207671_10000150 3300025914 Bacteria 107685
369 Ga0207671_10001328 3300025914 Bacteria 28918
370 Ga0207671_10001491 3300025914 Bacteria 27003
371 Ga0207671_10002003 3300025914 Bacteria 22450
372 Ga0207671_10012112 3300025914 Bacteria 6964
373 Ga0207671_10017094 3300025914 Bacteria 5607
374 Ga0207660_10014835 3300025917 Bacteria 5134
375 Ga0207657_10047383 3300025919 Bacteria 3759
376 Ga0207657_10178995 3300025919 Bacteria 1715
377 Ga0207652_10000310 3300025921 Bacteria 50166
378 Ga0207652_10000797 3300025921 Bacteria 30090
379 Ga0207652_10240563 3300025921 Unclassified 1632
380 Ga0207681_10020044 3300025923 Bacteria 4234
381 Ga0207694_10004674 3300025924 Bacteria 10660
382 Ga0207694_10046286 3300025924 Unclassified 3362
383 Ga0207650_10101272 3300025925 Bacteria 2217
384 Ga0207644_10286831 3300025931 Bacteria 1323
385 Ga0207690_10030568 3300025932 Bacteria 3437
386 Ga0207706_10005157 3300025933 Bacteria 12193
387 Ga0207706_10014900 3300025933 Bacteria 7040
388 Ga0207706_10030551 3300025933 Bacteria 4805
389 Ga0207686_10001248 3300025934 Bacteria 14703
390 Ga0207686_10028394 3300025934 Bacteria 3289
391 Ga0207670_10004881 3300025936 Bacteria 7291
392 Ga0207704_10004575 3300025938 Bacteria 6332
393 Ga0207691_10000010 3300025940 Bacteria 150194
394 Ga0207691_10006805 3300025940 Bacteria 11023
395 Ga0207691_10284335 3300025940 Bacteria 1423
396 Ga0207691_10370970 3300025940 Bacteria 1222
397 Ga0207711_10041755 3300025941 Bacteria 3907
398 Ga0207689_10002405 3300025942 Bacteria 17429
399 Ga0207689_10004391 3300025942 Bacteria 12818
400 Ga0207689_10015655 3300025942 Bacteria 6422
401 Ga0207689_10021194 3300025942 Bacteria 5463
402 Ga0207689_10024214 3300025942 Bacteria 5093
403 Ga0207689_10053787 3300025942 Bacteria 3317
404 Ga0207689_10240742 3300025942 Unclassified 1496
405 Ga0207689_10312361 3300025942 Bacteria 1304
406 Ga0207661_10003174 3300025944 Bacteria 11401
407 Ga0207679_10063691 3300025945 Bacteria 2753
408 Ga0207679_10085487 3300025945 Unclassified 2423
409 Ga0207667_10001687 3300025949 Bacteria 27830
410 Ga0207667_10008543 3300025949 Bacteria 12153
411 Ga0207667_10053640 3300025949 Unclassified 4242
412 Ga0207667_10256121 3300025949 Bacteria 1790
413 Ga0207651_10020255 3300025960 Bacteria 4010
414 Ga0207651_10033933 3300025960 Bacteria 3298
415 Ga0207651_10084259 3300025960 Bacteria 2302
416 Ga0207712_10009397 3300025961 Bacteria 6186
417 Ga0207712_10036731 3300025961 Bacteria 3339
418 Ga0207712_10037461 3300025961 Bacteria 3309
419 Ga0207712_10105168 3300025961 Bacteria 2106
420 Ga0207712_10132714 3300025961 Bacteria 1900
421 Ga0207668_10000734 3300025972 Bacteria 20079
422 Ga0207658_10004161 3300025986 Bacteria 10082
423 Ga0207677_10002453 3300026023 Bacteria 9745
424 Ga0207677_10027711 3300026023 Bacteria 3573
425 Ga0207677_10135086 3300026023 Bacteria 1879
426 Ga0207703_10001543 3300026035 Bacteria 20896
427 Ga0207703_10050136 3300026035 Bacteria 3377
428 Ga0207703_10220099 3300026035 Unclassified 1697
429 Ga0207639_10019304 3300026041 Bacteria 4860
430 Ga0207639_10020595 3300026041 Bacteria 4723
431 Ga0207639_10037592 3300026041 Bacteria 3596
432 Ga0207639_10063356 3300026041 Bacteria 2863
433 Ga0207678_10318808 3300026067 Bacteria 1337
434 Ga0207708_10321406 3300026075 Bacteria 1263
435 Ga0207702_10296827 3300026078 Bacteria 1532
436 Ga0207641_10000418 3300026088 Bacteria 49680
437 Ga0207641_10000828 3300026088 Bacteria 32919
438 Ga0207641_10003343 3300026088 Bacteria 14259
439 Ga0207641_10015130 3300026088 Bacteria 6322
440 Ga0207641_10023076 3300026088 Bacteria 5126
441 Ga0207641_10153109 3300026088 Bacteria 2090
442 Ga0207648_10019402 3300026089 Bacteria 6137
443 Ga0207648_10025237 3300026089 Bacteria 5295
444 Ga0207648_10030283 3300026089 Bacteria 4794
445 Ga0207648_10078650 3300026089 Bacteria 2877
446 Ga0207676_10002561 3300026095 Bacteria 12978
447 Ga0207676_10023138 3300026095 Bacteria 4579
448 Ga0207676_10065030 3300026095 Bacteria 2903
449 Ga0207676_10183991 3300026095 Bacteria 1832
450 Ga0207674_10006251 3300026116 Bacteria 14035
451 Ga0207674_10008311 3300026116 Bacteria 12012
452 Ga0207674_10067595 3300026116 Bacteria 3597
453 Ga0207675_100015799 3300026118 Bacteria 7040
454 Ga0207675_100017319 3300026118 Bacteria 6727
455 Ga0207683_10005675 3300026121 Bacteria 10702
456 Ga0207698_10061742 3300026142 Bacteria 2922
457 Ga0207698_10207945 3300026142 Bacteria 1758
458 Ga0207698_10246023 3300026142 Bacteria 1633
459 Ga0207698_10282656 3300026142 Bacteria 1536
460 Ga0207698_10522953 3300026142 Bacteria 1158
461 Ga0207428_10116255 3300027907 Bacteria 2054
462 Ga0268266_10000010 3300028379 Bacteria 1030233
463 Ga0268266_10022079 3300028379 Bacteria 5425
464 Ga0268266_10026105 3300028379 Bacteria 4970
465 Ga0268264_10000052 3300028381 Bacteria 321218
466 Ga0268264_10000866 3300028381 Bacteria 32068
467 Ga0268264_10012315 3300028381 Bacteria 7039
468 Ga0268264_10057305 3300028381 Bacteria 3259
469 Ga0268264_10428338 3300028381 Bacteria 1277
470 Ga0307515_10000251 3300028794 Bacteria 132970
471 Ga0265338_10038157 3300028800 Bacteria 4557
472 Ga0307511_10000362 3300030521 Bacteria 48275
473 Ga0265320_10105146 3300031240 Unclassified 1298
474 Ga0265327_10012487 3300031251 Bacteria 5724
475 Ga0265327_10028580 3300031251 Bacteria 3186
476 Ga0307513_10052945 3300031456 Bacteria 4366
477 Ga0307509_10174692 3300031507 Unclassified 2022
478 Ga0307408_100264281 3300031548 Unclassified 1426
479 Ga0265313_10045631 3300031595 Bacteria 2132
480 Ga0307508_10005225 3300031616 Bacteria 12417
481 Ga0307516_10001001 3300031730 Bacteria 39099
482 Ga0307410_10302334 3300031852 Bacteria 1263
483 Ga0307416_100031968 3300032002 Bacteria 3970
484 Ga0307414_10364548 3300032004 Unclassified 1244
485 Ga0307411_10178365 3300032005 Unclassified 1610
486 Ga0307415_100106878 3300032126 Bacteria 2067
487 Ga0307507_10039255 3300033179 Bacteria 4782
488 Ga0307510_10000058 3300033180 Bacteria 85118
489 Ga0373955_0056777 3300035172 Bacteria 2149
490 Ga0373927_0126402 3300035695 Bacteria 1669
491 Ga0373933_0206838 3300035724 Bacteria 1257
492 Ga0395900_0099014 3300037418 Bacteria 2995
493 Ga0395898_0283416 3300037466 Unclassified 1580
494 Ga0395905_0022702 3300037471 Bacteria 5932
495 Ga0395901_0091687 3300038443 Bacteria 3180
496 Ga0436365_0759450 3300039437 Bacteria 1433
497 Ga0436365_1285215 3300039437 Bacteria 11167
498 Ga0439436_0013792 3300041404 Bacteria 2444
499 Ga0439465_0011285 3300041413 Bacteria 2803
500 Ga0451791_0370370 3300041451 Bacteria 1367
501 Ga0451802_0078279 3300041460 Bacteria 1033
502 Ga0451853_3568257 3300041512 Bacteria 1854
503 Ga0439457_001548 3300042014 Bacteria 6898
504 Ga0439457_003006 3300042014 Bacteria 4686
505 Ga0439462_0003568 3300042015 Bacteria 3743
506 Ga0450894_001231 3300042131 Bacteria 3763
507 Ga0439434_0010291 3300042435 Bacteria 2758
508 Ga0451577_0054485 3300042876 Bacteria 3570
509 Ga0451577_0069257 3300042876 Bacteria 3146
510 Ga0451577_0144216 3300042876 Bacteria 2141
511 Ga0451577_0488022 3300042876 Unclassified 1119
512 Ga0466969_0000167 3300044656 Bacteria 35385
513 Ga0466972_0000064 3300044658 Bacteria 104558
514 Ga0466972_0000083 3300044658 Bacteria 87204
515 Ga0466972_0001783 3300044658 Bacteria 10538
516 Ga0453683_0126612 3300044673 Bacteria 1608
517 Ga0466965_0007953 3300044683 Bacteria 4889
518 Ga0466966_0000161 3300044684 Bacteria 43671
519 Ga0453684_0307987 3300044712 Unclassified 1798
520 Ga0466971_0035623 3300044719 Bacteria 2232
521 Ga0466970_0002805 3300044765 Bacteria 8410
522 Ga0466957_0000551 3300044842 Bacteria 18906
523 Ga0466957_0009998 3300044842 Bacteria 5429
524 Ga0466959_0000005 3300045049 Bacteria 213958
525 Ga0466959_0000420 3300045049 Bacteria 24757
526 Ga0466959_0236560 3300045049 Bacteria 1263
527 Ga0466958_0068923 3300045836 Bacteria 2163
528 Ga0466967_0608670 3300045976 Bacteria 1079
529 Ga0495629_0033164 3300046459 Bacteria 3654
530 Ga0495582_0113429 3300046473 Unclassified 1523
531 Ga0495606_0002264 3300046507 Bacteria 22818
532 Ga0495630_0078985 3300046517 Bacteria 2482
533 Ga0495648_0004081 3300046524 Bacteria 12598
534 Ga0495622_0049258 3300046557 Bacteria 1956
535 Ga0495656_0043876 3300046615 Bacteria 1880
536 Ga0495668_0001302 3300046616 Bacteria 24603
537 Ga0495668_0002880 3300046616 Bacteria 13634
538 Ga0495611_0000176 3300046648 Bacteria 46302
539 Ga0495658_0015221 3300046683 Bacteria 3944
540 Ga0495670_0065223 3300046691 Bacteria 1835
541 Ga0495636_0000004 3300047318 Bacteria 109175
542 Ga0495672_0008108 3300047320 Bacteria 7801
543 Ga0495672_0048595 3300047320 Bacteria 2515
544 Ga0495672_0062390 3300047320 Bacteria 2144
545 Ga0495676_0053899 3300047321 Bacteria 3201
546 Ga0495687_000039 3300047443 Bacteria 245077
547 Ga0496114_0000295 3300048917 Bacteria 36585
548 Ga0501034_0000043 3300049571 Bacteria 229049
549 Ga0501034_0002711 3300049571 Bacteria 20864
550 Ga0501034_0004134 3300049571 Bacteria 16252
551 Ga0501034_0495966 3300049571 Bacteria 1135
552 Ga0501036_0041144 3300049572 Bacteria 3911
553 Ga0501037_0002736 3300049573 Bacteria 12747
554 Ga0501038_0027763 3300049574 Bacteria 5031
555 Ga0501038_0099782 3300049574 Bacteria 2420
556 Ga0501043_0002356 3300049579 Bacteria 16018
557 Ga0501043_0098893 3300049579 Bacteria 2293
558 Ga0501046_0010797 3300049580 Bacteria 7830
559 Ga0501047_0002262 3300049581 Bacteria 18429
560 Ga0501047_0003566 3300049581 Bacteria 14690
561 Ga0501047_0048391 3300049581 Bacteria 4106
562 Ga0501070_0031283 3300049586 Bacteria 4459
563 Ga0501073_0000270 3300049589 Bacteria 34510
564 Ga0501073_0036657 3300049589 Bacteria 3484
565 Ga0501074_0001640 3300049590 Bacteria 15163
566 Ga0501202_004104 3300049652 Bacteria 2536
567 Ga0501202_004331 3300049652 Bacteria 2483
568 Ga0501217_014317 3300049661 Bacteria 1790
569 Ga0501222_002004 3300049662 Bacteria 2823
570 Ga0501223_030072 3300049663 Bacteria 1056
571 Ga0501253_026692 3300049683 Bacteria 1067
572 Ga0501259_000246 3300049688 Bacteria 8479
573 Ga0501261_003555 3300049690 Bacteria 1914
574 Ga0501221_001021 3300049704 Bacteria 4595
575 Ga0501225_0014361 3300049705 Bacteria 2212
576 Ga0501225_0029317 3300049705 Bacteria 1512
577 Ga0501234_001182 3300049707 Bacteria 4115
578 Ga0501080_0007763 3300049742 Bacteria 9696
579 Ga0501080_0243860 3300049742 Bacteria 1639
580 Ga0501083_0003740 3300049744 Bacteria 10687
581 Ga0501083_0056363 3300049744 Bacteria 2633
582 Ga0501241_011063 3300049758 Bacteria 1639
583 Ga0501035_0018543 3300049822 Bacteria 6411
584 Ga0501035_0089090 3300049822 Bacteria 2718
585 Ga0501035_0306920 3300049822 Bacteria 1336
586 Ga0501044_0008438 3300049823 Bacteria 11298
587 Ga0501044_0020228 3300049823 Bacteria 7104
588 Ga0501044_0027639 3300049823 Bacteria 5992
589 Ga0501284_00093 3300050005 Bacteria 19510
590 nmdc:mga0k408_28079_c1 3300050493 Bacteria 3198
591 nmdc:mga0k408_37783_c1 3300050493 Bacteria 2772
592 nmdc:mga05p37_31751_c1 3300050507 Bacteria 6454
593 nmdc:mga09592_116612_c1 3300050508 Unclassified 2292
594 nmdc:mga09592_175977_c1 3300050508 Bacteria 1851
595 nmdc:mga0qj67_7913_c1 3300050509 Bacteria 7856
596 nmdc:mga06r32_12289_c1 3300050510 Bacteria 7722
597 nmdc:mga06r32_17490_c1 3300050510 Bacteria 6544
598 nmdc:mga08y16_10827_c1 3300050511 Bacteria 9575
599 Ga0500578_0000066 3300053086 Bacteria 116854
600 Ga0500578_0004714 3300053086 Bacteria 9476
601 Ga0500644_0002143 3300053088 Bacteria 4995
602 Ga0500646_0003287 3300053090 Bacteria 4153
603 Ga0500646_0027581 3300053090 Bacteria 1546
604 Ga0500583_0000002 3300053092 Bacteria 232826
605 Ga0500583_0002413 3300053092 Bacteria 5611
606 Ga0500562_000040 3300053108 Bacteria 69393
607 Ga0500572_019936 3300053111 Bacteria 1758
608 Ga0500642_0056288 3300053130 Bacteria 1752
609 Ga0500559_0019833 3300053136 Bacteria 2841
610 Ga0500568_0000610 3300053139 Bacteria 25862
611 Ga0500589_037777 3300053147 Bacteria 2254
612 Ga0500604_0009447 3300053151 Unclassified 2599
613 Ga0500616_0005185 3300053153 Bacteria 8935
614 Ga0500622_0000432 3300053156 Bacteria 39841
615 Ga0500622_0019511 3300053156 Bacteria 3601
616 Ga0500622_0027780 3300053156 Unclassified 2982
617 Ga0500622_0198645 3300053156 Bacteria 914
618 Ga0500636_0090165 3300053177 Bacteria 1757
619 Ga0500611_000018 3300053727 Bacteria 111023
620 Ga0500645_043077 3300053730 Bacteria 1330
621 Ga0501084_0109441 3300054114 Bacteria 2321
622 Ga0466962_0032021 3300061719 Bacteria 2517

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049663 Ga0501223_030072 Ga0501223_030072_68_871 248
2 3300049683 Ga0501253_026692 Ga0501253_026692_84_887 248
3 3300035724 Ga0373933_0206838 Ga0373933_0206838_31_843 266
4 3300045049 Ga0466959_0236560 Ga0466959_0236560_73_903 270
5 3300005455 Ga0070663_100029912 Ga0070663_1000299121 273
6 3300026067 Ga0207678_10318808 Ga0207678_103188082 273
7 3300026089 Ga0207648_10078650 Ga0207648_100786504 282
8 3300005530 Ga0070679_100001217 Ga0070679_10000121711 284
9 3300025921 Ga0207652_10000310 Ga0207652_1000031011 284
10 3300039437 Ga0436365_0759450 Ga0436365_0759450_494_1378 284
11 3300053156 Ga0500622_0198645 Ga0500622_0198645_16_900 289
12 3300053730 Ga0500645_043077 Ga0500645_043077_60_944 289
13 3300053153 Ga0500616_0005185 Ga0500616_0005185_6640_7542 296
14 3300014325 Ga0163163_10000141 Ga0163163_1000014140 297
15 3300009093 Ga0105240_10062565 Ga0105240_100625652 301
16 3300025913 Ga0207695_10085174 Ga0207695_100851743 301
17 3300013307 Ga0157372_10782263 Ga0157372_107822631 302
18 3300035695 Ga0373927_0126402 Ga0373927_0126402_259_1191 302
19 3300044658 Ga0466972_0000083 Ga0466972_0000083_39545_40477 302
20 3300044684 Ga0466966_0000161 Ga0466966_0000161_32775_33707 302
21 3300044842 Ga0466957_0009998 Ga0466957_0009998_2589_3521 302
22 3300045049 Ga0466959_0000005 Ga0466959_0000005_55223_56155 302
23 3300050493 nmdc:mga0k408_28079_c1 nmdc:mga0k408_28079_c1_1522_2454 302
24 3300053086 Ga0500578_0004714 Ga0500578_0004714_696_1628 302
25 3300053111 Ga0500572_019936 Ga0500572_019936_435_1367 302
26 3300053177 Ga0500636_0090165 Ga0500636_0090165_622_1554 302
27 3300003316 rootH1_10078605 rootH1_100786052 304
28 3300003323 rootH1_10220108 rootH1_102201081 304
29 3300005367 Ga0070667_100285391 Ga0070667_1002853912 304
30 3300005438 Ga0070701_10085384 Ga0070701_100853842 304
31 3300005441 Ga0070700_100032359 Ga0070700_1000323592 304
32 3300010375 Ga0105239_10008603 Ga0105239_1000860311 304
33 3300041460 Ga0451802_0078279 Ga0451802_0078279_32_970 304
34 3300044842 Ga0466957_0000551 Ga0466957_0000551_14113_15051 304
35 3300049581 Ga0501047_0048391 Ga0501047_0048391_746_1684 304
36 3300049705 Ga0501225_0029317 Ga0501225_0029317_538_1476 304
37 3300053092 Ga0500583_0002413 Ga0500583_0002413_54_992 304
38 3300053130 Ga0500642_0056288 Ga0500642_0056288_232_1170 304
39 3300033179 Ga0307507_10039255 Ga0307507_100392556 306
40 3300041451 Ga0451791_0370370 Ga0451791_0370370_306_1253 307
41 3300031456 Ga0307513_10052945 Ga0307513_100529452 309
42 3300005563 Ga0068855_100000454 Ga0068855_10000045430 312
43 3300025913 Ga0207695_10000073 Ga0207695_10000073234 312
44 3300046615 Ga0495656_0043876 Ga0495656_0043876_884_1861 313
45 3300047318 Ga0495636_0000004 Ga0495636_0000004_45899_46876 313
46 3300021384 Ga0213876_10008585 Ga0213876_100085857 314
47 3300031595 Ga0265313_10045631 Ga0265313_100456312 314
48 3300039437 Ga0436365_1285215 Ga0436365_1285215_2376_3365 314
49 iso_pu_bacteria 2818991444 2819588729 315
50 iso_pu_bacteria 2929154850 2929157459 315
51 3300013297 Ga0157378_10036965 Ga0157378_100369654 316
52 iso_pu_bacteria 2881955468 2881957071 316
53 3300005466 Ga0070685_10312000 Ga0070685_103120001 317
54 3300013307 Ga0157372_10144429 Ga0157372_101444293 318
55 3300003320 rootH2_10135059 rootH2_101350593 319
56 3300005356 Ga0070674_100065186 Ga0070674_1000651862 319
57 3300009551 Ga0105238_10113786 Ga0105238_101137863 319
58 3300010375 Ga0105239_10000754 Ga0105239_1000075412 319
59 3300013105 Ga0157369_10247999 Ga0157369_102479992 319
60 3300013307 Ga0157372_10003000 Ga0157372_1000300011 319
61 3300014326 Ga0157380_10106081 Ga0157380_101060812 319
62 3300044719 Ga0466971_0035623 Ga0466971_0035623_253_1230 319
63 3300045049 Ga0466959_0000420 Ga0466959_0000420_18625_19602 319
64 3300045836 Ga0466958_0068923 Ga0466958_0068923_57_1034 319
65 3300049571 Ga0501034_0004134 Ga0501034_0004134_10926_11912 319
66 3300049573 Ga0501037_0002736 Ga0501037_0002736_10561_11547 319
67 3300049574 Ga0501038_0099782 Ga0501038_0099782_36_1022 319
68 3300049579 Ga0501043_0098893 Ga0501043_0098893_718_1698 319
69 3300049581 Ga0501047_0003566 Ga0501047_0003566_2224_3210 319
70 3300049822 Ga0501035_0306920 Ga0501035_0306920_69_1055 319
71 3300049823 Ga0501044_0020228 Ga0501044_0020228_5145_6131 319
72 3300053088 Ga0500644_0002143 Ga0500644_0002143_2955_3944 319
73 3300053108 Ga0500562_000040 Ga0500562_000040_42958_43947 319
74 3300053156 Ga0500622_0000432 Ga0500622_0000432_1845_2819 319
75 3300061719 Ga0466962_0032021 Ga0466962_0032021_754_1731 319
76 iso_pu_bacteria 2914759650 2914760345 319
77 3300003320 rootH2_10008117 rootH2_1000811719 320
78 3300003320 rootH2_10036959 rootH2_100369599 320
79 3300005290 Ga0065712_10014358 Ga0065712_100143582 320
80 3300005329 Ga0070683_100007365 Ga0070683_1000073654 320
81 3300005333 Ga0070677_10033659 Ga0070677_100336592 320
82 3300005336 Ga0070680_100422813 Ga0070680_1004228131 320
83 3300005341 Ga0070691_10034522 Ga0070691_100345223 320
84 3300005354 Ga0070675_100054206 Ga0070675_1000542062 320
85 3300005356 Ga0070674_100060611 Ga0070674_1000606113 320
86 3300005455 Ga0070663_100352807 Ga0070663_1003528071 320
87 3300005458 Ga0070681_10065931 Ga0070681_100659312 320
88 3300005458 Ga0070681_10150342 Ga0070681_101503422 320
89 3300005459 Ga0068867_100227742 Ga0068867_1002277421 320
90 3300005466 Ga0070685_10091216 Ga0070685_100912162 320
91 3300005535 Ga0070684_100154219 Ga0070684_1001542191 320
92 3300005614 Ga0068856_100084463 Ga0068856_1000844633 320
93 3300005616 Ga0068852_100034055 Ga0068852_1000340556 320
94 3300005983 Ga0081540_1003257 Ga0081540_10032575 320
95 3300006237 Ga0097621_100000138 Ga0097621_10000013814 320
96 3300006358 Ga0068871_100000427 Ga0068871_1000004276 320
97 3300006847 Ga0075431_100115586 Ga0075431_1001155862 320
98 3300006880 Ga0075429_100144472 Ga0075429_1001444722 320
99 3300009093 Ga0105240_10005924 Ga0105240_100059247 320
100 3300009094 Ga0111539_10015160 Ga0111539_100151605 320
101 3300009147 Ga0114129_10020798 Ga0114129_100207986 320
102 3300009176 Ga0105242_10401590 Ga0105242_104015901 320
103 3300009177 Ga0105248_10007233 Ga0105248_100072334 320
104 3300009553 Ga0105249_10026614 Ga0105249_100266143 320
105 3300010375 Ga0105239_10005357 Ga0105239_1000535714 320
106 3300013100 Ga0157373_10096532 Ga0157373_100965322 320
107 3300013102 Ga0157371_10012550 Ga0157371_100125503 320
108 3300013105 Ga0157369_10126575 Ga0157369_101265753 320
109 3300013296 Ga0157374_10000003 Ga0157374_10000003622 320
110 3300013306 Ga0163162_10000531 Ga0163162_1000053114 320
111 3300013306 Ga0163162_10039867 Ga0163162_100398673 320
112 3300013307 Ga0157372_10008075 Ga0157372_100080754 320
113 3300013308 Ga0157375_10000230 Ga0157375_1000023018 320
114 3300013308 Ga0157375_10080650 Ga0157375_100806503 320
115 3300014326 Ga0157380_10011554 Ga0157380_100115545 320
116 3300014326 Ga0157380_10110525 Ga0157380_101105252 320
117 3300014968 Ga0157379_10004457 Ga0157379_1000445710 320
118 3300014969 Ga0157376_10000514 Ga0157376_100005148 320
119 3300014969 Ga0157376_10034592 Ga0157376_100345922 320
120 3300014969 Ga0157376_10240533 Ga0157376_102405332 320
121 3300025893 Ga0207682_10003280 Ga0207682_100032803 320
122 3300025912 Ga0207707_10234589 Ga0207707_102345892 320
123 3300025921 Ga0207652_10240563 Ga0207652_102405632 320
124 3300025940 Ga0207691_10006805 Ga0207691_100068057 320
125 3300025940 Ga0207691_10370970 Ga0207691_103709702 320
126 3300025941 Ga0207711_10041755 Ga0207711_100417553 320
127 3300025944 Ga0207661_10003174 Ga0207661_1000317412 320
128 3300025961 Ga0207712_10132714 Ga0207712_101327141 320
129 3300026142 Ga0207698_10061742 Ga0207698_100617421 320
130 3300031616 Ga0307508_10005225 Ga0307508_100052252 320
131 3300032004 Ga0307414_10364548 Ga0307414_103645481 320
132 3300037418 Ga0395900_0099014 Ga0395900_0099014_1050_2033 320
133 3300037466 Ga0395898_0283416 Ga0395898_0283416_309_1292 320
134 3300037471 Ga0395905_0022702 Ga0395905_0022702_4754_5737 320
135 3300038443 Ga0395901_0091687 Ga0395901_0091687_924_1907 320
136 3300042876 Ga0451577_0144216 Ga0451577_0144216_1023_1997 320
137 3300044673 Ga0453683_0126612 Ga0453683_0126612_545_1519 320
138 3300046557 Ga0495622_0049258 Ga0495622_0049258_615_1595 320
139 3300050507 nmdc:mga05p37_31751_c1 nmdc:mga05p37_31751_c1_3478_4461 320
140 3300050508 nmdc:mga09592_116612_c1 nmdc:mga09592_116612_c1_874_1857 320
141 3300050510 nmdc:mga06r32_17490_c1 nmdc:mga06r32_17490_c1_4480_5463 320
142 3300050511 nmdc:mga08y16_10827_c1 nmdc:mga08y16_10827_c1_6121_7104 320
143 3300053090 Ga0500646_0003287 Ga0500646_0003287_2925_3905 320
144 3300003320 rootH2_10176815 rootH2_101768152 321
145 3300005539 Ga0068853_100105862 Ga0068853_1001058622 321
146 3300005548 Ga0070665_100004519 Ga0070665_1000045196 321
147 3300005616 Ga0068852_100257532 Ga0068852_1002575322 321
148 3300009093 Ga0105240_10000011 Ga0105240_10000011150 321
149 3300009093 Ga0105240_10000253 Ga0105240_1000025372 321
150 3300009094 Ga0111539_10480883 Ga0111539_104808831 321
151 3300009174 Ga0105241_10000921 Ga0105241_100009215 321
152 3300009545 Ga0105237_10019647 Ga0105237_100196472 321
153 3300009545 Ga0105237_10040889 Ga0105237_100408895 321
154 3300009545 Ga0105237_10041931 Ga0105237_100419312 321
155 3300009551 Ga0105238_10000806 Ga0105238_1000080612 321
156 3300009551 Ga0105238_10146275 Ga0105238_101462753 321
157 3300010375 Ga0105239_10000052 Ga0105239_10000052164 321
158 3300010375 Ga0105239_10004525 Ga0105239_100045259 321
159 3300010375 Ga0105239_10005010 Ga0105239_100050106 321
160 3300010375 Ga0105239_10052253 Ga0105239_100522533 321
161 3300013104 Ga0157370_10008048 Ga0157370_1000804811 321
162 3300013105 Ga0157369_10109167 Ga0157369_101091672 321
163 3300013307 Ga0157372_10018402 Ga0157372_100184022 321
164 3300025904 Ga0207647_10000139 Ga0207647_1000013920 321
165 3300025911 Ga0207654_10043080 Ga0207654_100430802 321
166 3300025913 Ga0207695_10000010 Ga0207695_10000010538 321
167 3300025913 Ga0207695_10001248 Ga0207695_100012488 321
168 3300025913 Ga0207695_10054406 Ga0207695_100544062 321
169 3300025914 Ga0207671_10000150 Ga0207671_1000015050 321
170 3300025914 Ga0207671_10002003 Ga0207671_1000200311 321
171 3300025914 Ga0207671_10012112 Ga0207671_100121122 321
172 3300025914 Ga0207671_10017094 Ga0207671_100170946 321
173 3300025924 Ga0207694_10004674 Ga0207694_1000467411 321
174 3300026078 Ga0207702_10296827 Ga0207702_102968272 321
175 3300026142 Ga0207698_10522953 Ga0207698_105229531 321
176 3300028379 Ga0268266_10026105 Ga0268266_100261055 321
177 3300028800 Ga0265338_10038157 Ga0265338_100381575 321
178 3300031240 Ga0265320_10105146 Ga0265320_101051462 321
179 3300031251 Ga0265327_10028580 Ga0265327_100285802 321
180 3300046524 Ga0495648_0004081 Ga0495648_0004081_10657_11637 321
181 3300046648 Ga0495611_0000176 Ga0495611_0000176_9649_10668 321
182 3300049822 Ga0501035_0018543 Ga0501035_0018543_3526_4539 321
183 3300053136 Ga0500559_0019833 Ga0500559_0019833_1371_2351 321
184 3300053156 Ga0500622_0027780 Ga0500622_0027780_716_1696 321
185 3300003320 rootH2_10329777 rootH2_103297772 322
186 3300003323 rootH1_10060970 rootH1_100609702 322
187 3300005459 Ga0068867_100174164 Ga0068867_1001741641 322
188 3300005530 Ga0070679_100076589 Ga0070679_1000765892 322
189 3300005577 Ga0068857_100077874 Ga0068857_1000778744 322
190 3300009093 Ga0105240_10001160 Ga0105240_100011606 322
191 3300009093 Ga0105240_10003903 Ga0105240_100039036 322
192 3300009551 Ga0105238_10028558 Ga0105238_100285583 322
193 3300010375 Ga0105239_10002487 Ga0105239_100024879 322
194 3300010375 Ga0105239_10027112 Ga0105239_100271122 322
195 3300013100 Ga0157373_10112212 Ga0157373_101122122 322
196 3300013296 Ga0157374_10014412 Ga0157374_100144128 322
197 3300013296 Ga0157374_10083438 Ga0157374_100834382 322
198 3300013306 Ga0163162_10416434 Ga0163162_104164342 322
199 3300013307 Ga0157372_10023794 Ga0157372_100237942 322
200 3300013307 Ga0157372_10613456 Ga0157372_106134562 322
201 3300025913 Ga0207695_10000021 Ga0207695_10000021482 322
202 3300025913 Ga0207695_10000039 Ga0207695_1000003925 322
203 3300025913 Ga0207695_10028522 Ga0207695_100285223 322
204 3300026041 Ga0207639_10019304 Ga0207639_100193045 322
205 3300031548 Ga0307408_100264281 Ga0307408_1002642812 322
206 3300032002 Ga0307416_100031968 Ga0307416_1000319682 322
207 3300032005 Ga0307411_10178365 Ga0307411_101783652 322
208 3300032126 Ga0307415_100106878 Ga0307415_1001068782 322
209 3300042876 Ga0451577_0069257 Ga0451577_0069257_1453_2478 322
210 3300044683 Ga0466965_0007953 Ga0466965_0007953_317_1288 322
211 3300046616 Ga0495668_0001302 Ga0495668_0001302_12365_13357 322
212 3300046616 Ga0495668_0002880 Ga0495668_0002880_5799_6779 322
213 3300049652 Ga0501202_004104 Ga0501202_004104_1041_2024 322
214 3300053151 Ga0500604_0009447 Ga0500604_0009447_94_1074 322
215 iso_pu_bacteria 2738541278 2738728228 322
216 3300003320 rootH2_10111981 rootH2_101119813 323
217 3300005327 Ga0070658_10000438 Ga0070658_1000043812 323
218 3300005328 Ga0070676_10000997 Ga0070676_100009973 323
219 3300005334 Ga0068869_100028262 Ga0068869_1000282622 323
220 3300005335 Ga0070666_10000456 Ga0070666_1000045613 323
221 3300005337 Ga0070682_100233776 Ga0070682_1002337762 323
222 3300005338 Ga0068868_100009246 Ga0068868_1000092464 323
223 3300005338 Ga0068868_100107167 Ga0068868_1001071672 323
224 3300005339 Ga0070660_100156045 Ga0070660_1001560452 323
225 3300005340 Ga0070689_100201778 Ga0070689_1002017782 323
226 3300005341 Ga0070691_10007869 Ga0070691_100078691 323
227 3300005347 Ga0070668_100000202 Ga0070668_10000020228 323
228 3300005355 Ga0070671_100062625 Ga0070671_1000626253 323
229 3300005364 Ga0070673_100077223 Ga0070673_1000772232 323
230 3300005366 Ga0070659_100009938 Ga0070659_1000099384 323
231 3300005366 Ga0070659_100046176 Ga0070659_1000461762 323
232 3300005367 Ga0070667_100013521 Ga0070667_1000135213 323
233 3300005457 Ga0070662_100003965 Ga0070662_1000039654 323
234 3300005458 Ga0070681_10150155 Ga0070681_101501552 323
235 3300005459 Ga0068867_100005053 Ga0068867_1000050534 323
236 3300005539 Ga0068853_100020367 Ga0068853_1000203675 323
237 3300005539 Ga0068853_100022604 Ga0068853_1000226042 323
238 3300005543 Ga0070672_100001130 Ga0070672_1000011307 323
239 3300005547 Ga0070693_100100748 Ga0070693_1001007482 323
240 3300005548 Ga0070665_100019347 Ga0070665_1000193476 323
241 3300005563 Ga0068855_100028168 Ga0068855_1000281682 323
242 3300005563 Ga0068855_100041388 Ga0068855_1000413882 323
243 3300005563 Ga0068855_100365613 Ga0068855_1003656132 323
244 3300005577 Ga0068857_100127189 Ga0068857_1001271892 323
245 3300005616 Ga0068852_100208529 Ga0068852_1002085292 323
246 3300005616 Ga0068852_100380479 Ga0068852_1003804791 323
247 3300005618 Ga0068864_100000772 Ga0068864_10000077221 323
248 3300005618 Ga0068864_100226792 Ga0068864_1002267922 323
249 3300005719 Ga0068861_100014925 Ga0068861_1000149253 323
250 3300005834 Ga0068851_10000581 Ga0068851_100005815 323
251 3300005841 Ga0068863_100003530 Ga0068863_1000035309 323
252 3300005842 Ga0068858_100000805 Ga0068858_10000080524 323
253 3300005843 Ga0068860_100023578 Ga0068860_1000235785 323
254 3300006237 Ga0097621_100014028 Ga0097621_1000140283 323
255 3300006358 Ga0068871_100001816 Ga0068871_1000018169 323
256 3300006358 Ga0068871_100006696 Ga0068871_1000066966 323
257 3300006358 Ga0068871_100015060 Ga0068871_1000150604 323
258 3300006881 Ga0068865_100008579 Ga0068865_1000085793 323
259 3300009093 Ga0105240_10001493 Ga0105240_1000149310 323
260 3300009093 Ga0105240_10032806 Ga0105240_100328064 323
261 3300009101 Ga0105247_10013430 Ga0105247_100134304 323
262 3300009174 Ga0105241_10003754 Ga0105241_100037547 323
263 3300009174 Ga0105241_10144158 Ga0105241_101441582 323
264 3300009176 Ga0105242_10012591 Ga0105242_100125916 323
265 3300009177 Ga0105248_10020667 Ga0105248_100206674 323
266 3300009545 Ga0105237_10076119 Ga0105237_100761193 323
267 3300009553 Ga0105249_10008000 Ga0105249_100080003 323
268 3300010375 Ga0105239_10162460 Ga0105239_101624604 323
269 3300013100 Ga0157373_10056810 Ga0157373_100568101 323
270 3300013104 Ga0157370_10003352 Ga0157370_100033525 323
271 3300013105 Ga0157369_10091598 Ga0157369_100915982 323
272 3300013105 Ga0157369_10309289 Ga0157369_103092892 323
273 3300013296 Ga0157374_10001182 Ga0157374_100011823 323
274 3300013297 Ga0157378_10014067 Ga0157378_100140671 323
275 3300013306 Ga0163162_10007084 Ga0163162_100070848 323
276 3300013306 Ga0163162_10021924 Ga0163162_100219245 323
277 3300013306 Ga0163162_10052313 Ga0163162_100523133 323
278 3300013307 Ga0157372_10321777 Ga0157372_103217772 323
279 3300013308 Ga0157375_10011512 Ga0157375_100115126 323
280 3300013308 Ga0157375_10088979 Ga0157375_100889792 323
281 3300013308 Ga0157375_10343914 Ga0157375_103439142 323
282 3300014325 Ga0163163_10005606 Ga0163163_100056066 323
283 3300014968 Ga0157379_10003524 Ga0157379_100035246 323
284 3300014968 Ga0157379_10051501 Ga0157379_100515014 323
285 3300014969 Ga0157376_10000472 Ga0157376_100004726 323
286 3300014969 Ga0157376_10118277 Ga0157376_101182772 323
287 3300025321 Ga0207656_10001031 Ga0207656_100010313 323
288 3300025903 Ga0207680_10000787 Ga0207680_100007874 323
289 3300025907 Ga0207645_10000769 Ga0207645_1000076916 323
290 3300025909 Ga0207705_10018385 Ga0207705_100183852 323
291 3300025911 Ga0207654_10001605 Ga0207654_100016052 323
292 3300025911 Ga0207654_10071506 Ga0207654_100715062 323
293 3300025913 Ga0207695_10086049 Ga0207695_100860493 323
294 3300025917 Ga0207660_10014835 Ga0207660_100148352 323
295 3300025919 Ga0207657_10047383 Ga0207657_100473832 323
296 3300025919 Ga0207657_10178995 Ga0207657_101789952 323
297 3300025921 Ga0207652_10000797 Ga0207652_100007977 323
298 3300025931 Ga0207644_10286831 Ga0207644_102868312 323
299 3300025932 Ga0207690_10030568 Ga0207690_100305683 323
300 3300025933 Ga0207706_10005157 Ga0207706_100051576 323
301 3300025933 Ga0207706_10014900 Ga0207706_100149003 323
302 3300025938 Ga0207704_10004575 Ga0207704_100045753 323
303 3300025940 Ga0207691_10000010 Ga0207691_10000010112 323
304 3300025942 Ga0207689_10053787 Ga0207689_100537873 323
305 3300025949 Ga0207667_10053640 Ga0207667_100536402 323
306 3300025949 Ga0207667_10256121 Ga0207667_102561212 323
307 3300025960 Ga0207651_10020255 Ga0207651_100202552 323
308 3300025972 Ga0207668_10000734 Ga0207668_100007349 323
309 3300025986 Ga0207658_10004161 Ga0207658_100041614 323
310 3300026023 Ga0207677_10027711 Ga0207677_100277114 323
311 3300026035 Ga0207703_10001543 Ga0207703_100015435 323
312 3300026041 Ga0207639_10020595 Ga0207639_100205955 323
313 3300026041 Ga0207639_10063356 Ga0207639_100633562 323
314 3300026088 Ga0207641_10003343 Ga0207641_100033436 323
315 3300026089 Ga0207648_10025237 Ga0207648_100252375 323
316 3300026095 Ga0207676_10002561 Ga0207676_100025612 323
317 3300026095 Ga0207676_10183991 Ga0207676_101839912 323
318 3300026118 Ga0207675_100017319 Ga0207675_1000173194 323
319 3300026142 Ga0207698_10282656 Ga0207698_102826561 323
320 3300028379 Ga0268266_10022079 Ga0268266_100220795 323
321 3300028381 Ga0268264_10057305 Ga0268264_100573053 323
322 3300031852 Ga0307410_10302334 Ga0307410_103023342 323
323 3300033180 Ga0307510_10000058 Ga0307510_100000585 323
324 3300035172 Ga0373955_0056777 Ga0373955_0056777_1119_2099 323
325 3300045976 Ga0466967_0608670 Ga0466967_0608670_85_1065 323
326 3300046459 Ga0495629_0033164 Ga0495629_0033164_2124_3104 323
327 3300046473 Ga0495582_0113429 Ga0495582_0113429_500_1480 323
328 3300046507 Ga0495606_0002264 Ga0495606_0002264_17811_18794 323
329 3300046517 Ga0495630_0078985 Ga0495630_0078985_65_1045 323
330 3300046683 Ga0495658_0015221 Ga0495658_0015221_1536_2516 323
331 3300046691 Ga0495670_0065223 Ga0495670_0065223_703_1689 323
332 3300049571 Ga0501034_0000043 Ga0501034_0000043_136028_137017 323
333 3300049571 Ga0501034_0495966 Ga0501034_0495966_67_1050 323
334 3300049589 Ga0501073_0036657 Ga0501073_0036657_1141_2124 323
335 3300049742 Ga0501080_0243860 Ga0501080_0243860_405_1388 323
336 3300049744 Ga0501083_0056363 Ga0501083_0056363_223_1206 323
337 3300054114 Ga0501084_0109441 Ga0501084_0109441_471_1454 323
338 3300005337 Ga0070682_100066390 Ga0070682_1000663902 324
339 3300005543 Ga0070672_100166508 Ga0070672_1001665082 324
340 3300005616 Ga0068852_100323052 Ga0068852_1003230522 324
341 3300013306 Ga0163162_10015300 Ga0163162_100153005 324
342 3300028381 Ga0268264_10000866 Ga0268264_1000086612 324
343 3300031251 Ga0265327_10012487 Ga0265327_100124877 324
344 3300041413 Ga0439465_0011285 Ga0439465_0011285_763_1755 324
345 3300042131 Ga0450894_001231 Ga0450894_001231_250_1230 324
346 3300042435 Ga0439434_0010291 Ga0439434_0010291_1004_1984 324
347 3300042876 Ga0451577_0054485 Ga0451577_0054485_94_1092 324
348 3300044712 Ga0453684_0307987 Ga0453684_0307987_81_1079 324
349 3300049661 Ga0501217_014317 Ga0501217_014317_200_1192 324
350 3300005356 Ga0070674_100021668 Ga0070674_1000216683 325
351 3300030521 Ga0307511_10000362 Ga0307511_1000036217 325
352 3300042876 Ga0451577_0488022 Ga0451577_0488022_14_1042 325
353 3300049571 Ga0501034_0002711 Ga0501034_0002711_13850_14842 325
354 3300049572 Ga0501036_0041144 Ga0501036_0041144_2148_3140 325
355 3300049574 Ga0501038_0027763 Ga0501038_0027763_2443_3435 325
356 3300049579 Ga0501043_0002356 Ga0501043_0002356_9049_10041 325
357 3300049580 Ga0501046_0010797 Ga0501046_0010797_5824_6816 325
358 3300049581 Ga0501047_0002262 Ga0501047_0002262_9225_10217 325
359 3300049586 Ga0501070_0031283 Ga0501070_0031283_3121_4113 325
360 3300049589 Ga0501073_0000270 Ga0501073_0000270_5113_6105 325
361 3300049590 Ga0501074_0001640 Ga0501074_0001640_5827_6819 325
362 3300049742 Ga0501080_0007763 Ga0501080_0007763_5419_6411 325
363 3300049744 Ga0501083_0003740 Ga0501083_0003740_323_1315 325
364 3300049822 Ga0501035_0089090 Ga0501035_0089090_433_1425 325
365 3300049823 Ga0501044_0027639 Ga0501044_0027639_2579_3571 325
366 3300003323 rootH1_10025575 rootH1_100255759 326
367 3300005331 Ga0070670_100092053 Ga0070670_1000920532 326
368 3300005334 Ga0068869_100125533 Ga0068869_1001255332 326
369 3300005335 Ga0070666_10000405 Ga0070666_1000040519 326
370 3300005338 Ga0068868_100102378 Ga0068868_1001023783 326
371 3300005355 Ga0070671_100017197 Ga0070671_1000171975 326
372 3300005356 Ga0070674_100012087 Ga0070674_1000120873 326
373 3300005364 Ga0070673_100012679 Ga0070673_1000126794 326
374 3300005364 Ga0070673_100015158 Ga0070673_1000151582 326
375 3300005364 Ga0070673_100195709 Ga0070673_1001957093 326
376 3300005367 Ga0070667_100011370 Ga0070667_1000113704 326
377 3300005539 Ga0068853_100023126 Ga0068853_1000231266 326
378 3300005539 Ga0068853_100094426 Ga0068853_1000944262 326
379 3300005543 Ga0070672_100022329 Ga0070672_1000223294 326
380 3300005544 Ga0070686_100086818 Ga0070686_1000868181 326
381 3300005563 Ga0068855_100022169 Ga0068855_1000221692 326
382 3300005564 Ga0070664_100047357 Ga0070664_1000473572 326
383 3300005577 Ga0068857_100105370 Ga0068857_1001053703 326
384 3300005578 Ga0068854_100071268 Ga0068854_1000712683 326
385 3300005617 Ga0068859_100000066 Ga0068859_10000006634 326
386 3300005617 Ga0068859_100023655 Ga0068859_1000236556 326
387 3300005617 Ga0068859_100343515 Ga0068859_1003435152 326
388 3300005618 Ga0068864_100026626 Ga0068864_1000266262 326
389 3300005841 Ga0068863_100002306 Ga0068863_10000230621 326
390 3300005841 Ga0068863_100067294 Ga0068863_1000672943 326
391 3300005841 Ga0068863_100116363 Ga0068863_1001163632 326
392 3300005842 Ga0068858_100005353 Ga0068858_1000053537 326
393 3300005843 Ga0068860_100009960 Ga0068860_1000099603 326
394 3300005843 Ga0068860_100010524 Ga0068860_1000105243 326
395 3300006195 Ga0075366_10019005 Ga0075366_100190053 326
396 3300006195 Ga0075366_10182641 Ga0075366_101826411 326
397 3300006237 Ga0097621_100002282 Ga0097621_1000022821 326
398 3300006358 Ga0068871_100033404 Ga0068871_1000334043 326
399 3300006358 Ga0068871_100130943 Ga0068871_1001309432 326
400 3300006931 Ga0097620_100000066 Ga0097620_10000006634 326
401 3300006931 Ga0097620_100023655 Ga0097620_1000236556 326
402 3300006931 Ga0097620_100343485 Ga0097620_1003434852 326
403 3300009093 Ga0105240_10237462 Ga0105240_102374622 326
404 3300009094 Ga0111539_10541210 Ga0111539_105412102 326
405 3300009174 Ga0105241_10001740 Ga0105241_1000174016 326
406 3300009174 Ga0105241_10032525 Ga0105241_100325253 326
407 3300009553 Ga0105249_10038416 Ga0105249_100384161 326
408 3300010375 Ga0105239_10032240 Ga0105239_100322404 326
409 3300013104 Ga0157370_10011930 Ga0157370_100119304 326
410 3300013296 Ga0157374_10011352 Ga0157374_100113524 326
411 3300013297 Ga0157378_10002641 Ga0157378_100026414 326
412 3300013297 Ga0157378_10004255 Ga0157378_100042558 326
413 3300013297 Ga0157378_10012471 Ga0157378_100124716 326
414 3300013297 Ga0157378_10143486 Ga0157378_101434862 326
415 3300013297 Ga0157378_10198296 Ga0157378_101982963 326
416 3300013306 Ga0163162_10001227 Ga0163162_100012279 326
417 3300013306 Ga0163162_10029320 Ga0163162_100293203 326
418 3300013308 Ga0157375_10139479 Ga0157375_101394792 326
419 3300013308 Ga0157375_10207895 Ga0157375_102078952 326
420 3300014745 Ga0157377_10008432 Ga0157377_100084323 326
421 3300014969 Ga0157376_10289569 Ga0157376_102895692 326
422 3300025246 Ga0209646_1001651 Ga0209646_10016514 326
423 3300025901 Ga0207688_10107352 Ga0207688_101073522 326
424 3300025903 Ga0207680_10000143 Ga0207680_100001433 326
425 3300025914 Ga0207671_10001491 Ga0207671_1000149125 326
426 3300025942 Ga0207689_10004391 Ga0207689_100043915 326
427 3300025942 Ga0207689_10240742 Ga0207689_102407422 326
428 3300025945 Ga0207679_10085487 Ga0207679_100854872 326
429 3300025949 Ga0207667_10008543 Ga0207667_100085437 326
430 3300025960 Ga0207651_10084259 Ga0207651_100842592 326
431 3300025961 Ga0207712_10036731 Ga0207712_100367312 326
432 3300026023 Ga0207677_10002453 Ga0207677_100024536 326
433 3300026023 Ga0207677_10135086 Ga0207677_101350862 326
434 3300026035 Ga0207703_10050136 Ga0207703_100501362 326
435 3300026035 Ga0207703_10220099 Ga0207703_102200992 326
436 3300026088 Ga0207641_10000828 Ga0207641_1000082826 326
437 3300026088 Ga0207641_10015130 Ga0207641_100151302 326
438 3300026095 Ga0207676_10023138 Ga0207676_100231383 326
439 3300026116 Ga0207674_10067595 Ga0207674_100675952 326
440 3300028381 Ga0268264_10012315 Ga0268264_100123156 326
441 3300028794 Ga0307515_10000251 Ga0307515_10000251106 326
442 3300031507 Ga0307509_10174692 Ga0307509_101746921 326
443 3300041404 Ga0439436_0013792 Ga0439436_0013792_94_1098 326
444 3300041512 Ga0451853_3568257 Ga0451853_3568257_185_1189 326
445 3300042014 Ga0439457_001548 Ga0439457_001548_1348_2352 326
446 3300042014 Ga0439457_003006 Ga0439457_003006_3558_4574 326
447 3300042015 Ga0439462_0003568 Ga0439462_0003568_1320_2324 326
448 3300044656 Ga0466969_0000167 Ga0466969_0000167_26934_27938 326
449 3300044658 Ga0466972_0000064 Ga0466972_0000064_43200_44213 326
450 3300044765 Ga0466970_0002805 Ga0466970_0002805_4694_5707 326
451 3300047320 Ga0495672_0008108 Ga0495672_0008108_2514_3509 326
452 3300047320 Ga0495672_0048595 Ga0495672_0048595_108_1136 326
453 3300049758 Ga0501241_011063 Ga0501241_011063_60_1073 326
454 3300049823 Ga0501044_0008438 Ga0501044_0008438_970_1974 326
455 3300050005 Ga0501284_00093 Ga0501284_00093_11608_12621 326
456 3300050493 nmdc:mga0k408_37783_c1 nmdc:mga0k408_37783_c1_715_1719 326
457 3300053086 Ga0500578_0000066 Ga0500578_0000066_14253_15257 326
458 3300053090 Ga0500646_0027581 Ga0500646_0027581_243_1247 326
459 3300053092 Ga0500583_0000002 Ga0500583_0000002_72340_73344 326
460 3300053147 Ga0500589_037777 Ga0500589_037777_39_1043 326
461 3300053156 Ga0500622_0019511 Ga0500622_0019511_982_1986 326
462 3300053727 Ga0500611_000018 Ga0500611_000018_16132_17142 326
463 3300003320 rootH2_10085841 rootH2_100858412 327
464 3300003323 rootH1_10248611 rootH1_102486112 327
465 3300005289 Ga0065704_10143018 Ga0065704_101430182 327
466 3300005290 Ga0065712_10073956 Ga0065712_100739562 327
467 3300005334 Ga0068869_100196651 Ga0068869_1001966511 327
468 3300005340 Ga0070689_100002169 Ga0070689_1000021692 327
469 3300005354 Ga0070675_100037287 Ga0070675_1000372872 327
470 3300005364 Ga0070673_100033648 Ga0070673_1000336482 327
471 3300005458 Ga0070681_10032305 Ga0070681_100323055 327
472 3300005459 Ga0068867_100042570 Ga0068867_1000425702 327
473 3300005577 Ga0068857_100058034 Ga0068857_1000580343 327
474 3300005617 Ga0068859_100006157 Ga0068859_10000615711 327
475 3300005719 Ga0068861_100002110 Ga0068861_1000021104 327
476 3300005841 Ga0068863_100510490 Ga0068863_1005104901 327
477 3300006931 Ga0097620_100006157 Ga0097620_10000615711 327
478 3300009094 Ga0111539_10008819 Ga0111539_100088193 327
479 3300009174 Ga0105241_10117716 Ga0105241_101177162 327
480 3300009545 Ga0105237_10000169 Ga0105237_1000016933 327
481 3300009545 Ga0105237_10200501 Ga0105237_102005011 327
482 3300010375 Ga0105239_10246516 Ga0105239_102465162 327
483 3300013306 Ga0163162_10382662 Ga0163162_103826621 327
484 3300013307 Ga0157372_10128787 Ga0157372_101287872 327
485 3300013308 Ga0157375_10327314 Ga0157375_103273142 327
486 3300014326 Ga0157380_10001158 Ga0157380_100011585 327
487 3300014745 Ga0157377_10001217 Ga0157377_1000121710 327
488 3300025302 Ga0207426_1000105 Ga0207426_1000105124 327
489 3300025911 Ga0207654_10080442 Ga0207654_100804422 327
490 3300025912 Ga0207707_10111459 Ga0207707_101114593 327
491 3300025914 Ga0207671_10001328 Ga0207671_1000132818 327
492 3300025923 Ga0207681_10020044 Ga0207681_100200442 327
493 3300025942 Ga0207689_10312361 Ga0207689_103123612 327
494 3300025960 Ga0207651_10033933 Ga0207651_100339332 327
495 3300026089 Ga0207648_10030283 Ga0207648_100302833 327
496 3300026116 Ga0207674_10008311 Ga0207674_100083112 327
497 3300026118 Ga0207675_100015799 Ga0207675_1000157992 327
498 3300027907 Ga0207428_10116255 Ga0207428_101162552 327
499 3300047320 Ga0495672_0062390 Ga0495672_0062390_797_1813 327
500 3300003203 JGI25406J46586_10001920 JGI25406J46586_100019206 328
501 3300003322 rootL2_10063902 rootL2_100639022 328
502 3300003322 rootL2_10274444 rootL2_102744443 328
503 3300005334 Ga0068869_100040799 Ga0068869_1000407994 328
504 3300005985 Ga0081539_10002362 Ga0081539_1000236220 328
505 3300009176 Ga0105242_10004602 Ga0105242_100046023 328
506 3300013297 Ga0157378_10059536 Ga0157378_100595362 328
507 3300025925 Ga0207650_10101272 Ga0207650_101012723 328
508 3300025934 Ga0207686_10028394 Ga0207686_100283943 328
509 3300025940 Ga0207691_10284335 Ga0207691_102843351 328
510 3300025942 Ga0207689_10021194 Ga0207689_100211943 328
511 3300025961 Ga0207712_10105168 Ga0207712_101051682 328
512 3300028381 Ga0268264_10428338 Ga0268264_104283382 328
513 3300031730 Ga0307516_10001001 Ga0307516_1000100121 328
514 3300005340 Ga0070689_100002275 Ga0070689_1000022755 329
515 3300005355 Ga0070671_100175604 Ga0070671_1001756042 329
516 3300005367 Ga0070667_100022399 Ga0070667_1000223993 329
517 3300005457 Ga0070662_100016841 Ga0070662_1000168414 329
518 3300005535 Ga0070684_100036422 Ga0070684_1000364223 329
519 3300005548 Ga0070665_100000074 Ga0070665_100000074102 329
520 3300005563 Ga0068855_100029855 Ga0068855_1000298557 329
521 3300005564 Ga0070664_100140282 Ga0070664_1001402823 329
522 3300005577 Ga0068857_100005191 Ga0068857_10000519110 329
523 3300005616 Ga0068852_100001872 Ga0068852_1000018722 329
524 3300005616 Ga0068852_100046829 Ga0068852_1000468293 329
525 3300005841 Ga0068863_100214721 Ga0068863_1002147212 329
526 3300005841 Ga0068863_100278630 Ga0068863_1002786302 329
527 3300005842 Ga0068858_100174583 Ga0068858_1001745832 329
528 3300005843 Ga0068860_100000110 Ga0068860_10000011058 329
529 3300009093 Ga0105240_10019282 Ga0105240_100192826 329
530 3300009093 Ga0105240_10043036 Ga0105240_100430366 329
531 3300009174 Ga0105241_10060412 Ga0105241_100604122 329
532 3300009174 Ga0105241_10189856 Ga0105241_101898562 329
533 3300009176 Ga0105242_10046232 Ga0105242_100462321 329
534 3300009551 Ga0105238_10036705 Ga0105238_100367051 329
535 3300009553 Ga0105249_10010825 Ga0105249_100108253 329
536 3300013100 Ga0157373_10132151 Ga0157373_101321513 329
537 3300013104 Ga0157370_10010246 Ga0157370_100102467 329
538 3300013105 Ga0157369_10066016 Ga0157369_100660164 329
539 3300013297 Ga0157378_10349068 Ga0157378_103490681 329
540 3300013306 Ga0163162_10001109 Ga0163162_1000110927 329
541 3300013307 Ga0157372_10002664 Ga0157372_100026649 329
542 3300025904 Ga0207647_10048330 Ga0207647_100483302 329
543 3300025913 Ga0207695_10182395 Ga0207695_101823953 329
544 3300025913 Ga0207695_10460267 Ga0207695_104602671 329
545 3300025924 Ga0207694_10046286 Ga0207694_100462863 329
546 3300025933 Ga0207706_10030551 Ga0207706_100305513 329
547 3300025936 Ga0207670_10004881 Ga0207670_100048817 329
548 3300025942 Ga0207689_10024214 Ga0207689_100242144 329
549 3300025945 Ga0207679_10063691 Ga0207679_100636912 329
550 3300025949 Ga0207667_10001687 Ga0207667_1000168714 329
551 3300025961 Ga0207712_10009397 Ga0207712_100093977 329
552 3300026089 Ga0207648_10019402 Ga0207648_100194023 329
553 3300026116 Ga0207674_10006251 Ga0207674_100062512 329
554 3300026142 Ga0207698_10207945 Ga0207698_102079452 329
555 3300026142 Ga0207698_10246023 Ga0207698_102460232 329
556 3300028379 Ga0268266_10000010 Ga0268266_10000010726 329
557 3300028381 Ga0268264_10000052 Ga0268264_1000005260 329
558 3300044658 Ga0466972_0001783 Ga0466972_0001783_873_1910 329
559 3300047443 Ga0495687_000039 Ga0495687_000039_76435_77463 329
560 3300048917 Ga0496114_0000295 Ga0496114_0000295_7242_8294 329
561 3300049652 Ga0501202_004331 Ga0501202_004331_188_1234 329
562 3300049662 Ga0501222_002004 Ga0501222_002004_1249_2295 329
563 3300049688 Ga0501259_000246 Ga0501259_000246_3594_4640 329
564 3300049690 Ga0501261_003555 Ga0501261_003555_281_1327 329
565 3300049704 Ga0501221_001021 Ga0501221_001021_1844_2890 329
566 3300049705 Ga0501225_0014361 Ga0501225_0014361_541_1587 329
567 3300049707 Ga0501234_001182 Ga0501234_001182_2383_3429 329
568 3300005334 Ga0068869_100139840 Ga0068869_1001398402 330
569 3300005356 Ga0070674_100081456 Ga0070674_1000814562 330
570 3300005367 Ga0070667_100062228 Ga0070667_1000622282 330
571 3300005466 Ga0070685_10238468 Ga0070685_102384681 330
572 3300005617 Ga0068859_100073625 Ga0068859_1000736252 330
573 3300005843 Ga0068860_100191429 Ga0068860_1001914292 330
574 3300006844 Ga0075428_100025432 Ga0075428_1000254327 330
575 3300006844 Ga0075428_100263981 Ga0075428_1002639812 330
576 3300006846 Ga0075430_100005928 Ga0075430_10000592811 330
577 3300006931 Ga0097620_100073628 Ga0097620_1000736284 330
578 3300009101 Ga0105247_10001631 Ga0105247_100016316 330
579 3300009553 Ga0105249_10063605 Ga0105249_100636052 330
580 3300014325 Ga0163163_10073305 Ga0163163_100733054 330
581 3300025942 Ga0207689_10002405 Ga0207689_100024057 330
582 3300025961 Ga0207712_10037461 Ga0207712_100374612 330
583 3300050508 nmdc:mga09592_175977_c1 nmdc:mga09592_175977_c1_522_1532 330
584 3300050509 nmdc:mga0qj67_7913_c1 nmdc:mga0qj67_7913_c1_4703_5716 330
585 3300050510 nmdc:mga06r32_12289_c1 nmdc:mga06r32_12289_c1_6551_7564 330
586 3300053139 Ga0500568_0000610 Ga0500568_0000610_5014_6039 331
587 3300002459 JGI24751J29686_10000673 JGI24751J29686_100006732 332
588 3300003323 rootH1_10299774 rootH1_102997742 332
589 3300005328 Ga0070676_10006732 Ga0070676_100067323 332
590 3300005331 Ga0070670_100025151 Ga0070670_1000251513 332
591 3300005334 Ga0068869_100200978 Ga0068869_1002009782 332
592 3300005347 Ga0070668_100113840 Ga0070668_1001138402 332
593 3300005356 Ga0070674_100121882 Ga0070674_1001218822 332
594 3300005364 Ga0070673_100141987 Ga0070673_1001419872 332
595 3300005459 Ga0068867_100082585 Ga0068867_1000825852 332
596 3300005471 Ga0070698_100040258 Ga0070698_1000402582 332
597 3300005543 Ga0070672_100080005 Ga0070672_1000800052 332
598 3300005617 Ga0068859_100115010 Ga0068859_1001150103 332
599 3300005618 Ga0068864_100054843 Ga0068864_1000548433 332
600 3300005840 Ga0068870_10030009 Ga0068870_100300092 332
601 3300005841 Ga0068863_100021215 Ga0068863_1000212154 332
602 3300005841 Ga0068863_100077385 Ga0068863_1000773854 332
603 3300005841 Ga0068863_100194998 Ga0068863_1001949982 332
604 3300005843 Ga0068860_100212937 Ga0068860_1002129372 332
605 3300006237 Ga0097621_100044926 Ga0097621_1000449262 332
606 3300006358 Ga0068871_100133860 Ga0068871_1001338602 332
607 3300006880 Ga0075429_100173479 Ga0075429_1001734792 332
608 3300006881 Ga0068865_100012717 Ga0068865_1000127172 332
609 3300006931 Ga0097620_100115012 Ga0097620_1001150123 332
610 3300009176 Ga0105242_10015317 Ga0105242_100153176 332
611 3300013296 Ga0157374_10174420 Ga0157374_101744202 332
612 3300013306 Ga0163162_10265357 Ga0163162_102653572 332
613 3300014325 Ga0163163_10014392 Ga0163163_100143922 332
614 3300014969 Ga0157376_10004908 Ga0157376_100049082 332
615 3300025901 Ga0207688_10170651 Ga0207688_101706512 332
616 3300025903 Ga0207680_10051997 Ga0207680_100519972 332
617 3300025907 Ga0207645_10000511 Ga0207645_1000051116 332
618 3300025934 Ga0207686_10001248 Ga0207686_100012486 332
619 3300025942 Ga0207689_10015655 Ga0207689_100156557 332
620 3300026041 Ga0207639_10037592 Ga0207639_100375922 332
621 3300026075 Ga0207708_10321406 Ga0207708_103214062 332
622 3300026088 Ga0207641_10000418 Ga0207641_1000041836 332
623 3300026088 Ga0207641_10023076 Ga0207641_100230764 332
624 3300026088 Ga0207641_10153109 Ga0207641_101531092 332
625 3300026095 Ga0207676_10065030 Ga0207676_100650303 332
626 3300026121 Ga0207683_10005675 Ga0207683_100056755 332
627 3300047321 Ga0495676_0053899 Ga0495676_0053899_233_1246 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08885

GSCFA

GSCFA family

160

287

0.98

PF08885

GSCFA

GSCFA family

21

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tts-assembly1.cif.gz_A crystal structure of beta-galactosidase from bacillus circulans sp. alkalophilus 0.7634 164 191
4ucf-assembly1.cif.gz_B crystal structure of bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose 0.6968 164 201
5e9a-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6842 164 191
2hsj-assembly1.cif.gz_D the structure of a putative platelet activating factor from streptococcus pneumonia. 0.6645 20 265
3dt9-assembly1.cif.gz_A crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by soman 0.657 18 265
ID Description Score Start End Superfamily
3ii1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9094 162 188 3.20.20.80
af_Q9W2H8_565_770_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8546 167 192 3.20.20.80
4uoqB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8018 164 191 3.20.20.80
1bs9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7903 164 191 3.40.50.1820
af_Q4V7D9_65_396_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6952 162 193 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1J5SXE8-F1-model_v4 GSCFA family protein 0.982 1 326
AF-A0A3D6CBX4-F1-model_v4 GSCFA domain-containing protein 0.9802 1 289
AF-A0A3C0IUB8-F1-model_v4 GSCFA domain-containing protein 0.9792 23 296
AF-X1UA47-F1-model_v4 GSCFA domain-containing protein 0.9782 24 257
AF-A0A4V2AXL4-F1-model_v4 GSCFA domain-containing protein 0.9779 1 328

Feature Viewer

pLDDT pTM Quality
94.77 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map