F470527
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 264 | 622 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10063902|rootL2_100639022 |
| Length | 386 |
| Sequence | MDFQLPIQIDALPQPIGYPDKVMLTGSCFTEHIGNALRDWKFDTLQNPNGILFDPASVASSIIAYMEGRPYQEDDLVYFNELWQSWHHHSQFSHMDKGEALRGINGSLARAHAFLKEAKWLIITLGSAFSYRLAPDAPAQYWPESMSKGPIAADPTLLNIQSSTGALSSVANCHRAPGQTFRKHLMTIEEINTALDGCLYRLFQFNPSLQVIFTVSPVRHIRDGVVENNRSKARLIESVHHLVNKFSRLYYFPAYELVIDVLRDYRFYDIDMVHPNYPATQFVLEHFTRHYIDKGSQAIIEEVKRIVTARKHKPFQPSTQAHKRFLQDHLQRTEXXWRCVVLSSICGKSWRIFRRQGSNKNFFFYGSFISVTLQLLLTIPPIQVAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 4 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 5 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 190 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 226 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 227 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 228 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 230 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 232 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 233 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 241 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 248 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 250 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 251 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 252 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 254 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 255 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 256 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 257 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 258 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 259 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 260 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 262 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 263 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.2 |
| Metatranscriptomes | 0 |
| Isolates | 0.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.31 |
| Nodule | 0 |
| Rhizoplane | 0.48 |
| Rhizosphere | 90.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000673 | 3300002459 | Bacteria | 8529 |
| 2 | JGI25406J46586_10001920 | 3300003203 | Bacteria | 9796 |
| 3 | rootH1_10078605 | 3300003316 | Bacteria | 2311 |
| 4 | rootH2_10008117 | 3300003320 | Bacteria | 30213 |
| 5 | rootH2_10036959 | 3300003320 | Bacteria | 16537 |
| 6 | rootH2_10085841 | 3300003320 | Bacteria | 2695 |
| 7 | rootH2_10111981 | 3300003320 | Bacteria | 3402 |
| 8 | rootH2_10135059 | 3300003320 | Bacteria | 3112 |
| 9 | rootH2_10176815 | 3300003320 | Bacteria | 3475 |
| 10 | rootH2_10329777 | 3300003320 | Bacteria | 1346 |
| 11 | rootL2_10063902 | 3300003322 | Bacteria | 2716 |
| 12 | rootL2_10274444 | 3300003322 | Bacteria | 3344 |
| 13 | rootH1_10025575 | 3300003323 | Bacteria | 6892 |
| 14 | rootH1_10060970 | 3300003323 | Bacteria | 2830 |
| 15 | rootH1_10220108 | 3300003323 | Bacteria | 1752 |
| 16 | rootH1_10248611 | 3300003323 | Bacteria | 3879 |
| 17 | rootH1_10299774 | 3300003323 | Unclassified | 3278 |
| 18 | Ga0065704_10143018 | 3300005289 | Bacteria | 1499 |
| 19 | Ga0065712_10014358 | 3300005290 | Bacteria | 2443 |
| 20 | Ga0065712_10073956 | 3300005290 | Bacteria | 4223 |
| 21 | Ga0070658_10000438 | 3300005327 | Bacteria | 36124 |
| 22 | Ga0070676_10000997 | 3300005328 | Bacteria | 14074 |
| 23 | Ga0070676_10006732 | 3300005328 | Bacteria | 6155 |
| 24 | Ga0070683_100007365 | 3300005329 | Bacteria | 9297 |
| 25 | Ga0070670_100025151 | 3300005331 | Bacteria | 5123 |
| 26 | Ga0070670_100092053 | 3300005331 | Unclassified | 2607 |
| 27 | Ga0070677_10033659 | 3300005333 | Bacteria | 1975 |
| 28 | Ga0068869_100028262 | 3300005334 | Bacteria | 3918 |
| 29 | Ga0068869_100040799 | 3300005334 | Bacteria | 3320 |
| 30 | Ga0068869_100125533 | 3300005334 | Unclassified | 1967 |
| 31 | Ga0068869_100139840 | 3300005334 | Bacteria | 1868 |
| 32 | Ga0068869_100196651 | 3300005334 | Bacteria | 1588 |
| 33 | Ga0068869_100200978 | 3300005334 | Unclassified | 1571 |
| 34 | Ga0070666_10000405 | 3300005335 | Bacteria | 27033 |
| 35 | Ga0070666_10000456 | 3300005335 | Bacteria | 24899 |
| 36 | Ga0070680_100422813 | 3300005336 | Unclassified | 1137 |
| 37 | Ga0070682_100066390 | 3300005337 | Bacteria | 2295 |
| 38 | Ga0070682_100233776 | 3300005337 | Bacteria | 1315 |
| 39 | Ga0068868_100009246 | 3300005338 | Bacteria | 7084 |
| 40 | Ga0068868_100102378 | 3300005338 | Bacteria | 2319 |
| 41 | Ga0068868_100107167 | 3300005338 | Bacteria | 2267 |
| 42 | Ga0070660_100156045 | 3300005339 | Bacteria | 1837 |
| 43 | Ga0070689_100002169 | 3300005340 | Bacteria | 12712 |
| 44 | Ga0070689_100002275 | 3300005340 | Bacteria | 12482 |
| 45 | Ga0070689_100201778 | 3300005340 | Unclassified | 1624 |
| 46 | Ga0070691_10007869 | 3300005341 | Bacteria | 4876 |
| 47 | Ga0070691_10034522 | 3300005341 | Unclassified | 2381 |
| 48 | Ga0070668_100000202 | 3300005347 | Bacteria | 39154 |
| 49 | Ga0070668_100113840 | 3300005347 | Unclassified | 2155 |
| 50 | Ga0070675_100037287 | 3300005354 | Bacteria | 3959 |
| 51 | Ga0070675_100054206 | 3300005354 | Unclassified | 3299 |
| 52 | Ga0070671_100017197 | 3300005355 | Bacteria | 5854 |
| 53 | Ga0070671_100062625 | 3300005355 | Bacteria | 3097 |
| 54 | Ga0070671_100175604 | 3300005355 | Bacteria | 1812 |
| 55 | Ga0070674_100012087 | 3300005356 | Bacteria | 5290 |
| 56 | Ga0070674_100021668 | 3300005356 | Bacteria | 4132 |
| 57 | Ga0070674_100060611 | 3300005356 | Bacteria | 2638 |
| 58 | Ga0070674_100065186 | 3300005356 | Unclassified | 2556 |
| 59 | Ga0070674_100081456 | 3300005356 | Unclassified | 2313 |
| 60 | Ga0070674_100121882 | 3300005356 | Unclassified | 1931 |
| 61 | Ga0070673_100012679 | 3300005364 | Bacteria | 5797 |
| 62 | Ga0070673_100015158 | 3300005364 | Bacteria | 5403 |
| 63 | Ga0070673_100033648 | 3300005364 | Bacteria | 3873 |
| 64 | Ga0070673_100077223 | 3300005364 | Bacteria | 2691 |
| 65 | Ga0070673_100141987 | 3300005364 | Unclassified | 2026 |
| 66 | Ga0070673_100195709 | 3300005364 | Bacteria | 1739 |
| 67 | Ga0070659_100009938 | 3300005366 | Bacteria | 6998 |
| 68 | Ga0070659_100046176 | 3300005366 | Bacteria | 3414 |
| 69 | Ga0070667_100011370 | 3300005367 | Bacteria | 7359 |
| 70 | Ga0070667_100013521 | 3300005367 | Bacteria | 6745 |
| 71 | Ga0070667_100022399 | 3300005367 | Bacteria | 5240 |
| 72 | Ga0070667_100062228 | 3300005367 | Bacteria | 3161 |
| 73 | Ga0070667_100285391 | 3300005367 | Unclassified | 1483 |
| 74 | Ga0070701_10085384 | 3300005438 | Unclassified | 1718 |
| 75 | Ga0070700_100032359 | 3300005441 | Bacteria | 3142 |
| 76 | Ga0070663_100029912 | 3300005455 | Bacteria | 3727 |
| 77 | Ga0070663_100352807 | 3300005455 | Bacteria | 1191 |
| 78 | Ga0070662_100003965 | 3300005457 | Bacteria | 9278 |
| 79 | Ga0070662_100016841 | 3300005457 | Bacteria | 4913 |
| 80 | Ga0070681_10032305 | 3300005458 | Bacteria | 5252 |
| 81 | Ga0070681_10065931 | 3300005458 | Bacteria | 3590 |
| 82 | Ga0070681_10150155 | 3300005458 | Bacteria | 2257 |
| 83 | Ga0070681_10150342 | 3300005458 | Bacteria | 2255 |
| 84 | Ga0068867_100005053 | 3300005459 | Bacteria | 9312 |
| 85 | Ga0068867_100042570 | 3300005459 | Bacteria | 3323 |
| 86 | Ga0068867_100082585 | 3300005459 | Bacteria | 2424 |
| 87 | Ga0068867_100174164 | 3300005459 | Bacteria | 1706 |
| 88 | Ga0068867_100227742 | 3300005459 | Bacteria | 1505 |
| 89 | Ga0070685_10091216 | 3300005466 | Bacteria | 1844 |
| 90 | Ga0070685_10238468 | 3300005466 | Unclassified | 1199 |
| 91 | Ga0070685_10312000 | 3300005466 | Bacteria | 1063 |
| 92 | Ga0070698_100040258 | 3300005471 | Bacteria | 4804 |
| 93 | Ga0070679_100001217 | 3300005530 | Bacteria | 22656 |
| 94 | Ga0070679_100076589 | 3300005530 | Bacteria | 3334 |
| 95 | Ga0070684_100036422 | 3300005535 | Bacteria | 4216 |
| 96 | Ga0070684_100154219 | 3300005535 | Bacteria | 2082 |
| 97 | Ga0068853_100020367 | 3300005539 | Bacteria | 5516 |
| 98 | Ga0068853_100022604 | 3300005539 | Bacteria | 5254 |
| 99 | Ga0068853_100023126 | 3300005539 | Bacteria | 5202 |
| 100 | Ga0068853_100094426 | 3300005539 | Bacteria | 2635 |
| 101 | Ga0068853_100105862 | 3300005539 | Bacteria | 2492 |
| 102 | Ga0070672_100001130 | 3300005543 | Bacteria | 16305 |
| 103 | Ga0070672_100022329 | 3300005543 | Bacteria | 4647 |
| 104 | Ga0070672_100080005 | 3300005543 | Bacteria | 2617 |
| 105 | Ga0070672_100166508 | 3300005543 | Bacteria | 1831 |
| 106 | Ga0070686_100086818 | 3300005544 | Bacteria | 2084 |
| 107 | Ga0070693_100100748 | 3300005547 | Bacteria | 1759 |
| 108 | Ga0070665_100000074 | 3300005548 | Bacteria | 192944 |
| 109 | Ga0070665_100004519 | 3300005548 | Bacteria | 14580 |
| 110 | Ga0070665_100019347 | 3300005548 | Bacteria | 6832 |
| 111 | Ga0068855_100000454 | 3300005563 | Bacteria | 50341 |
| 112 | Ga0068855_100022169 | 3300005563 | Bacteria | 7611 |
| 113 | Ga0068855_100028168 | 3300005563 | Bacteria | 6720 |
| 114 | Ga0068855_100029855 | 3300005563 | Bacteria | 6520 |
| 115 | Ga0068855_100041388 | 3300005563 | Bacteria | 5461 |
| 116 | Ga0068855_100365613 | 3300005563 | Bacteria | 1587 |
| 117 | Ga0070664_100047357 | 3300005564 | Unclassified | 3632 |
| 118 | Ga0070664_100140282 | 3300005564 | Bacteria | 2128 |
| 119 | Ga0068857_100005191 | 3300005577 | Bacteria | 11081 |
| 120 | Ga0068857_100058034 | 3300005577 | Bacteria | 3436 |
| 121 | Ga0068857_100077874 | 3300005577 | Bacteria | 2959 |
| 122 | Ga0068857_100105370 | 3300005577 | Bacteria | 2532 |
| 123 | Ga0068857_100127189 | 3300005577 | Bacteria | 2297 |
| 124 | Ga0068854_100071268 | 3300005578 | Bacteria | 2542 |
| 125 | Ga0068856_100084463 | 3300005614 | Unclassified | 3154 |
| 126 | Ga0068852_100001872 | 3300005616 | Bacteria | 14316 |
| 127 | Ga0068852_100034055 | 3300005616 | Bacteria | 4236 |
| 128 | Ga0068852_100046829 | 3300005616 | Bacteria | 3686 |
| 129 | Ga0068852_100208529 | 3300005616 | Bacteria | 1852 |
| 130 | Ga0068852_100257532 | 3300005616 | Bacteria | 1674 |
| 131 | Ga0068852_100323052 | 3300005616 | Bacteria | 1499 |
| 132 | Ga0068852_100380479 | 3300005616 | Bacteria | 1385 |
| 133 | Ga0068859_100000066 | 3300005617 | Bacteria | 100640 |
| 134 | Ga0068859_100006157 | 3300005617 | Bacteria | 12197 |
| 135 | Ga0068859_100023655 | 3300005617 | Bacteria | 6167 |
| 136 | Ga0068859_100073625 | 3300005617 | Bacteria | 3454 |
| 137 | Ga0068859_100115010 | 3300005617 | Bacteria | 2755 |
| 138 | Ga0068859_100343515 | 3300005617 | Bacteria | 1587 |
| 139 | Ga0068864_100000772 | 3300005618 | Bacteria | 26853 |
| 140 | Ga0068864_100026626 | 3300005618 | Bacteria | 4876 |
| 141 | Ga0068864_100054843 | 3300005618 | Bacteria | 3440 |
| 142 | Ga0068864_100226792 | 3300005618 | Bacteria | 1726 |
| 143 | Ga0068861_100002110 | 3300005719 | Bacteria | 12883 |
| 144 | Ga0068861_100014925 | 3300005719 | Bacteria | 5461 |
| 145 | Ga0068851_10000581 | 3300005834 | Bacteria | 15903 |
| 146 | Ga0068870_10030009 | 3300005840 | Bacteria | 2745 |
| 147 | Ga0068863_100002306 | 3300005841 | Bacteria | 18971 |
| 148 | Ga0068863_100003530 | 3300005841 | Bacteria | 15431 |
| 149 | Ga0068863_100021215 | 3300005841 | Bacteria | 6201 |
| 150 | Ga0068863_100067294 | 3300005841 | Bacteria | 3388 |
| 151 | Ga0068863_100077385 | 3300005841 | Unclassified | 3148 |
| 152 | Ga0068863_100116363 | 3300005841 | Bacteria | 2548 |
| 153 | Ga0068863_100194998 | 3300005841 | Bacteria | 1947 |
| 154 | Ga0068863_100214721 | 3300005841 | Bacteria | 1853 |
| 155 | Ga0068863_100278630 | 3300005841 | Bacteria | 1620 |
| 156 | Ga0068863_100510490 | 3300005841 | Bacteria | 1184 |
| 157 | Ga0068858_100000805 | 3300005842 | Bacteria | 32800 |
| 158 | Ga0068858_100005353 | 3300005842 | Bacteria | 12591 |
| 159 | Ga0068858_100174583 | 3300005842 | Bacteria | 2027 |
| 160 | Ga0068860_100000110 | 3300005843 | Bacteria | 131175 |
| 161 | Ga0068860_100009960 | 3300005843 | Bacteria | 9419 |
| 162 | Ga0068860_100010524 | 3300005843 | Bacteria | 9143 |
| 163 | Ga0068860_100023578 | 3300005843 | Bacteria | 5948 |
| 164 | Ga0068860_100191429 | 3300005843 | Unclassified | 1979 |
| 165 | Ga0068860_100212937 | 3300005843 | Unclassified | 1875 |
| 166 | Ga0081540_1003257 | 3300005983 | Bacteria | 12898 |
| 167 | Ga0081539_10002362 | 3300005985 | Bacteria | 27082 |
| 168 | Ga0075366_10019005 | 3300006195 | Bacteria | 3972 |
| 169 | Ga0075366_10182641 | 3300006195 | Bacteria | 1274 |
| 170 | Ga0097621_100000138 | 3300006237 | Bacteria | 43428 |
| 171 | Ga0097621_100002282 | 3300006237 | Bacteria | 13139 |
| 172 | Ga0097621_100014028 | 3300006237 | Bacteria | 5988 |
| 173 | Ga0097621_100044926 | 3300006237 | Unclassified | 3566 |
| 174 | Ga0068871_100000427 | 3300006358 | Bacteria | 29046 |
| 175 | Ga0068871_100001816 | 3300006358 | Bacteria | 14405 |
| 176 | Ga0068871_100006696 | 3300006358 | Bacteria | 8175 |
| 177 | Ga0068871_100015060 | 3300006358 | Bacteria | 5780 |
| 178 | Ga0068871_100033404 | 3300006358 | Bacteria | 4074 |
| 179 | Ga0068871_100130943 | 3300006358 | Unclassified | 2127 |
| 180 | Ga0068871_100133860 | 3300006358 | Bacteria | 2104 |
| 181 | Ga0075428_100025432 | 3300006844 | Bacteria | 6552 |
| 182 | Ga0075428_100263981 | 3300006844 | Bacteria | 1853 |
| 183 | Ga0075430_100005928 | 3300006846 | Bacteria | 10322 |
| 184 | Ga0075431_100115586 | 3300006847 | Unclassified | 2770 |
| 185 | Ga0075429_100144472 | 3300006880 | Unclassified | 2082 |
| 186 | Ga0075429_100173479 | 3300006880 | Bacteria | 1889 |
| 187 | Ga0068865_100008579 | 3300006881 | Bacteria | 6319 |
| 188 | Ga0068865_100012717 | 3300006881 | Bacteria | 5304 |
| 189 | Ga0097620_100000066 | 3300006931 | Bacteria | 100640 |
| 190 | Ga0097620_100006157 | 3300006931 | Bacteria | 12197 |
| 191 | Ga0097620_100023655 | 3300006931 | Bacteria | 6167 |
| 192 | Ga0097620_100073628 | 3300006931 | Bacteria | 3454 |
| 193 | Ga0097620_100115012 | 3300006931 | Bacteria | 2755 |
| 194 | Ga0097620_100343485 | 3300006931 | Bacteria | 1587 |
| 195 | Ga0105240_10000011 | 3300009093 | Bacteria | 523646 |
| 196 | Ga0105240_10000253 | 3300009093 | Bacteria | 106101 |
| 197 | Ga0105240_10001160 | 3300009093 | Bacteria | 46165 |
| 198 | Ga0105240_10001493 | 3300009093 | Bacteria | 39862 |
| 199 | Ga0105240_10003903 | 3300009093 | Bacteria | 23022 |
| 200 | Ga0105240_10005924 | 3300009093 | Bacteria | 18106 |
| 201 | Ga0105240_10019282 | 3300009093 | Bacteria | 9117 |
| 202 | Ga0105240_10032806 | 3300009093 | Bacteria | 6718 |
| 203 | Ga0105240_10043036 | 3300009093 | Bacteria | 5750 |
| 204 | Ga0105240_10062565 | 3300009093 | Bacteria | 4633 |
| 205 | Ga0105240_10237462 | 3300009093 | Bacteria | 2115 |
| 206 | Ga0111539_10008819 | 3300009094 | Bacteria | 12781 |
| 207 | Ga0111539_10015160 | 3300009094 | Bacteria | 9603 |
| 208 | Ga0111539_10480883 | 3300009094 | Unclassified | 1446 |
| 209 | Ga0111539_10541210 | 3300009094 | Unclassified | 1356 |
| 210 | Ga0105247_10001631 | 3300009101 | Bacteria | 15867 |
| 211 | Ga0105247_10013430 | 3300009101 | Unclassified | 4911 |
| 212 | Ga0114129_10020798 | 3300009147 | Bacteria | 9324 |
| 213 | Ga0105241_10000921 | 3300009174 | Bacteria | 22269 |
| 214 | Ga0105241_10001740 | 3300009174 | Bacteria | 16524 |
| 215 | Ga0105241_10003754 | 3300009174 | Bacteria | 11266 |
| 216 | Ga0105241_10032525 | 3300009174 | Bacteria | 3911 |
| 217 | Ga0105241_10060412 | 3300009174 | Bacteria | 2916 |
| 218 | Ga0105241_10117716 | 3300009174 | Bacteria | 2135 |
| 219 | Ga0105241_10144158 | 3300009174 | Bacteria | 1943 |
| 220 | Ga0105241_10189856 | 3300009174 | Bacteria | 1710 |
| 221 | Ga0105242_10004602 | 3300009176 | Bacteria | 10693 |
| 222 | Ga0105242_10012591 | 3300009176 | Bacteria | 6512 |
| 223 | Ga0105242_10015317 | 3300009176 | Bacteria | 5955 |
| 224 | Ga0105242_10046232 | 3300009176 | Bacteria | 3531 |
| 225 | Ga0105242_10401590 | 3300009176 | Unclassified | 1279 |
| 226 | Ga0105248_10007233 | 3300009177 | Bacteria | 12177 |
| 227 | Ga0105248_10020667 | 3300009177 | Bacteria | 7296 |
| 228 | Ga0105237_10000169 | 3300009545 | Bacteria | 92124 |
| 229 | Ga0105237_10019647 | 3300009545 | Bacteria | 6976 |
| 230 | Ga0105237_10040889 | 3300009545 | Bacteria | 4676 |
| 231 | Ga0105237_10041931 | 3300009545 | Bacteria | 4615 |
| 232 | Ga0105237_10076119 | 3300009545 | Bacteria | 3346 |
| 233 | Ga0105237_10200501 | 3300009545 | Unclassified | 1995 |
| 234 | Ga0105238_10000806 | 3300009551 | Bacteria | 32512 |
| 235 | Ga0105238_10028558 | 3300009551 | Bacteria | 5683 |
| 236 | Ga0105238_10036705 | 3300009551 | Bacteria | 4982 |
| 237 | Ga0105238_10113786 | 3300009551 | Unclassified | 2685 |
| 238 | Ga0105238_10146275 | 3300009551 | Bacteria | 2340 |
| 239 | Ga0105249_10008000 | 3300009553 | Bacteria | 9215 |
| 240 | Ga0105249_10010825 | 3300009553 | Bacteria | 8015 |
| 241 | Ga0105249_10026614 | 3300009553 | Bacteria | 5215 |
| 242 | Ga0105249_10038416 | 3300009553 | Bacteria | 4343 |
| 243 | Ga0105249_10063605 | 3300009553 | Bacteria | 3390 |
| 244 | Ga0105239_10000052 | 3300010375 | Bacteria | 164624 |
| 245 | Ga0105239_10000754 | 3300010375 | Bacteria | 45868 |
| 246 | Ga0105239_10002487 | 3300010375 | Bacteria | 23470 |
| 247 | Ga0105239_10004525 | 3300010375 | Bacteria | 16578 |
| 248 | Ga0105239_10005010 | 3300010375 | Bacteria | 15637 |
| 249 | Ga0105239_10005357 | 3300010375 | Bacteria | 15059 |
| 250 | Ga0105239_10008603 | 3300010375 | Bacteria | 11572 |
| 251 | Ga0105239_10027112 | 3300010375 | Bacteria | 6307 |
| 252 | Ga0105239_10032240 | 3300010375 | Bacteria | 5759 |
| 253 | Ga0105239_10052253 | 3300010375 | Bacteria | 4481 |
| 254 | Ga0105239_10162460 | 3300010375 | Bacteria | 2496 |
| 255 | Ga0105239_10246516 | 3300010375 | Unclassified | 2006 |
| 256 | Ga0157373_10056810 | 3300013100 | Bacteria | 2778 |
| 257 | Ga0157373_10096532 | 3300013100 | Bacteria | 2081 |
| 258 | Ga0157373_10112212 | 3300013100 | Bacteria | 1916 |
| 259 | Ga0157373_10132151 | 3300013100 | Bacteria | 1755 |
| 260 | Ga0157371_10012550 | 3300013102 | Bacteria | 6471 |
| 261 | Ga0157370_10003352 | 3300013104 | Bacteria | 18863 |
| 262 | Ga0157370_10008048 | 3300013104 | Bacteria | 11413 |
| 263 | Ga0157370_10010246 | 3300013104 | Bacteria | 9898 |
| 264 | Ga0157370_10011930 | 3300013104 | Bacteria | 9060 |
| 265 | Ga0157369_10066016 | 3300013105 | Bacteria | 3893 |
| 266 | Ga0157369_10091598 | 3300013105 | Bacteria | 3245 |
| 267 | Ga0157369_10109167 | 3300013105 | Unclassified | 2942 |
| 268 | Ga0157369_10126575 | 3300013105 | Bacteria | 2708 |
| 269 | Ga0157369_10247999 | 3300013105 | Bacteria | 1859 |
| 270 | Ga0157369_10309289 | 3300013105 | Unclassified | 1643 |
| 271 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 272 | Ga0157374_10001182 | 3300013296 | Bacteria | 22286 |
| 273 | Ga0157374_10011352 | 3300013296 | Bacteria | 7709 |
| 274 | Ga0157374_10014412 | 3300013296 | Bacteria | 6919 |
| 275 | Ga0157374_10083438 | 3300013296 | Bacteria | 3036 |
| 276 | Ga0157374_10174420 | 3300013296 | Bacteria | 2099 |
| 277 | Ga0157378_10002641 | 3300013297 | Bacteria | 15976 |
| 278 | Ga0157378_10004255 | 3300013297 | Bacteria | 12619 |
| 279 | Ga0157378_10012471 | 3300013297 | Bacteria | 7442 |
| 280 | Ga0157378_10014067 | 3300013297 | Bacteria | 7006 |
| 281 | Ga0157378_10036965 | 3300013297 | Bacteria | 4323 |
| 282 | Ga0157378_10059536 | 3300013297 | Unclassified | 3408 |
| 283 | Ga0157378_10143486 | 3300013297 | Unclassified | 2219 |
| 284 | Ga0157378_10198296 | 3300013297 | Unclassified | 1897 |
| 285 | Ga0157378_10349068 | 3300013297 | Bacteria | 1445 |
| 286 | Ga0163162_10000531 | 3300013306 | Bacteria | 35292 |
| 287 | Ga0163162_10001109 | 3300013306 | Bacteria | 24984 |
| 288 | Ga0163162_10001227 | 3300013306 | Bacteria | 23959 |
| 289 | Ga0163162_10007084 | 3300013306 | Bacteria | 10882 |
| 290 | Ga0163162_10015300 | 3300013306 | Bacteria | 7494 |
| 291 | Ga0163162_10021924 | 3300013306 | Bacteria | 6292 |
| 292 | Ga0163162_10029320 | 3300013306 | Bacteria | 5445 |
| 293 | Ga0163162_10039867 | 3300013306 | Unclassified | 4694 |
| 294 | Ga0163162_10052313 | 3300013306 | Bacteria | 4101 |
| 295 | Ga0163162_10265357 | 3300013306 | Bacteria | 1849 |
| 296 | Ga0163162_10382662 | 3300013306 | Bacteria | 1540 |
| 297 | Ga0163162_10416434 | 3300013306 | Bacteria | 1476 |
| 298 | Ga0157372_10002664 | 3300013307 | Bacteria | 19339 |
| 299 | Ga0157372_10003000 | 3300013307 | Bacteria | 18202 |
| 300 | Ga0157372_10008075 | 3300013307 | Bacteria | 11195 |
| 301 | Ga0157372_10018402 | 3300013307 | Bacteria | 7508 |
| 302 | Ga0157372_10023794 | 3300013307 | Bacteria | 6645 |
| 303 | Ga0157372_10128787 | 3300013307 | Unclassified | 2911 |
| 304 | Ga0157372_10144429 | 3300013307 | Bacteria | 2744 |
| 305 | Ga0157372_10321777 | 3300013307 | Bacteria | 1801 |
| 306 | Ga0157372_10613456 | 3300013307 | Unclassified | 1268 |
| 307 | Ga0157372_10782263 | 3300013307 | Bacteria | 1109 |
| 308 | Ga0157375_10000230 | 3300013308 | Bacteria | 52234 |
| 309 | Ga0157375_10011512 | 3300013308 | Bacteria | 7811 |
| 310 | Ga0157375_10080650 | 3300013308 | Bacteria | 3293 |
| 311 | Ga0157375_10088979 | 3300013308 | Bacteria | 3143 |
| 312 | Ga0157375_10139479 | 3300013308 | Unclassified | 2550 |
| 313 | Ga0157375_10207895 | 3300013308 | Bacteria | 2114 |
| 314 | Ga0157375_10327314 | 3300013308 | Bacteria | 1697 |
| 315 | Ga0157375_10343914 | 3300013308 | Bacteria | 1657 |
| 316 | Ga0163163_10000141 | 3300014325 | Bacteria | 74842 |
| 317 | Ga0163163_10005606 | 3300014325 | Bacteria | 10874 |
| 318 | Ga0163163_10014392 | 3300014325 | Bacteria | 7273 |
| 319 | Ga0163163_10073305 | 3300014325 | Bacteria | 3414 |
| 320 | Ga0157380_10001158 | 3300014326 | Bacteria | 17072 |
| 321 | Ga0157380_10011554 | 3300014326 | Bacteria | 6381 |
| 322 | Ga0157380_10106081 | 3300014326 | Unclassified | 2350 |
| 323 | Ga0157380_10110525 | 3300014326 | Bacteria | 2308 |
| 324 | Ga0157377_10001217 | 3300014745 | Bacteria | 10977 |
| 325 | Ga0157377_10008432 | 3300014745 | Bacteria | 5027 |
| 326 | Ga0157379_10003524 | 3300014968 | Bacteria | 13248 |
| 327 | Ga0157379_10004457 | 3300014968 | Bacteria | 12010 |
| 328 | Ga0157379_10051501 | 3300014968 | Bacteria | 3678 |
| 329 | Ga0157376_10000472 | 3300014969 | Bacteria | 25927 |
| 330 | Ga0157376_10000514 | 3300014969 | Bacteria | 24959 |
| 331 | Ga0157376_10004908 | 3300014969 | Bacteria | 9323 |
| 332 | Ga0157376_10034592 | 3300014969 | Bacteria | 4081 |
| 333 | Ga0157376_10118277 | 3300014969 | Bacteria | 2344 |
| 334 | Ga0157376_10240533 | 3300014969 | Bacteria | 1686 |
| 335 | Ga0157376_10289569 | 3300014969 | Unclassified | 1546 |
| 336 | Ga0213876_10008585 | 3300021384 | Bacteria | 5531 |
| 337 | Ga0209646_1001651 | 3300025246 | Bacteria | 5719 |
| 338 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 339 | Ga0207656_10001031 | 3300025321 | Bacteria | 9097 |
| 340 | Ga0207682_10003280 | 3300025893 | Bacteria | 7075 |
| 341 | Ga0207688_10107352 | 3300025901 | Unclassified | 1618 |
| 342 | Ga0207688_10170651 | 3300025901 | Unclassified | 1293 |
| 343 | Ga0207680_10000143 | 3300025903 | Bacteria | 34125 |
| 344 | Ga0207680_10000787 | 3300025903 | Bacteria | 14979 |
| 345 | Ga0207680_10051997 | 3300025903 | Bacteria | 2452 |
| 346 | Ga0207647_10000139 | 3300025904 | Bacteria | 57477 |
| 347 | Ga0207647_10048330 | 3300025904 | Bacteria | 2642 |
| 348 | Ga0207645_10000511 | 3300025907 | Bacteria | 32164 |
| 349 | Ga0207645_10000769 | 3300025907 | Bacteria | 26709 |
| 350 | Ga0207705_10018385 | 3300025909 | Unclassified | 4998 |
| 351 | Ga0207654_10001605 | 3300025911 | Bacteria | 11858 |
| 352 | Ga0207654_10043080 | 3300025911 | Unclassified | 2557 |
| 353 | Ga0207654_10071506 | 3300025911 | Bacteria | 2062 |
| 354 | Ga0207654_10080442 | 3300025911 | Bacteria | 1959 |
| 355 | Ga0207707_10111459 | 3300025912 | Unclassified | 2392 |
| 356 | Ga0207707_10234589 | 3300025912 | Unclassified | 1596 |
| 357 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 358 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 359 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 360 | Ga0207695_10000073 | 3300025913 | Bacteria | 312565 |
| 361 | Ga0207695_10001248 | 3300025913 | Bacteria | 43473 |
| 362 | Ga0207695_10028522 | 3300025913 | Bacteria | 6188 |
| 363 | Ga0207695_10054406 | 3300025913 | Bacteria | 4180 |
| 364 | Ga0207695_10085174 | 3300025913 | Bacteria | 3190 |
| 365 | Ga0207695_10086049 | 3300025913 | Bacteria | 3171 |
| 366 | Ga0207695_10182395 | 3300025913 | Unclassified | 2020 |
| 367 | Ga0207695_10460267 | 3300025913 | Unclassified | 1155 |
| 368 | Ga0207671_10000150 | 3300025914 | Bacteria | 107685 |
| 369 | Ga0207671_10001328 | 3300025914 | Bacteria | 28918 |
| 370 | Ga0207671_10001491 | 3300025914 | Bacteria | 27003 |
| 371 | Ga0207671_10002003 | 3300025914 | Bacteria | 22450 |
| 372 | Ga0207671_10012112 | 3300025914 | Bacteria | 6964 |
| 373 | Ga0207671_10017094 | 3300025914 | Bacteria | 5607 |
| 374 | Ga0207660_10014835 | 3300025917 | Bacteria | 5134 |
| 375 | Ga0207657_10047383 | 3300025919 | Bacteria | 3759 |
| 376 | Ga0207657_10178995 | 3300025919 | Bacteria | 1715 |
| 377 | Ga0207652_10000310 | 3300025921 | Bacteria | 50166 |
| 378 | Ga0207652_10000797 | 3300025921 | Bacteria | 30090 |
| 379 | Ga0207652_10240563 | 3300025921 | Unclassified | 1632 |
| 380 | Ga0207681_10020044 | 3300025923 | Bacteria | 4234 |
| 381 | Ga0207694_10004674 | 3300025924 | Bacteria | 10660 |
| 382 | Ga0207694_10046286 | 3300025924 | Unclassified | 3362 |
| 383 | Ga0207650_10101272 | 3300025925 | Bacteria | 2217 |
| 384 | Ga0207644_10286831 | 3300025931 | Bacteria | 1323 |
| 385 | Ga0207690_10030568 | 3300025932 | Bacteria | 3437 |
| 386 | Ga0207706_10005157 | 3300025933 | Bacteria | 12193 |
| 387 | Ga0207706_10014900 | 3300025933 | Bacteria | 7040 |
| 388 | Ga0207706_10030551 | 3300025933 | Bacteria | 4805 |
| 389 | Ga0207686_10001248 | 3300025934 | Bacteria | 14703 |
| 390 | Ga0207686_10028394 | 3300025934 | Bacteria | 3289 |
| 391 | Ga0207670_10004881 | 3300025936 | Bacteria | 7291 |
| 392 | Ga0207704_10004575 | 3300025938 | Bacteria | 6332 |
| 393 | Ga0207691_10000010 | 3300025940 | Bacteria | 150194 |
| 394 | Ga0207691_10006805 | 3300025940 | Bacteria | 11023 |
| 395 | Ga0207691_10284335 | 3300025940 | Bacteria | 1423 |
| 396 | Ga0207691_10370970 | 3300025940 | Bacteria | 1222 |
| 397 | Ga0207711_10041755 | 3300025941 | Bacteria | 3907 |
| 398 | Ga0207689_10002405 | 3300025942 | Bacteria | 17429 |
| 399 | Ga0207689_10004391 | 3300025942 | Bacteria | 12818 |
| 400 | Ga0207689_10015655 | 3300025942 | Bacteria | 6422 |
| 401 | Ga0207689_10021194 | 3300025942 | Bacteria | 5463 |
| 402 | Ga0207689_10024214 | 3300025942 | Bacteria | 5093 |
| 403 | Ga0207689_10053787 | 3300025942 | Bacteria | 3317 |
| 404 | Ga0207689_10240742 | 3300025942 | Unclassified | 1496 |
| 405 | Ga0207689_10312361 | 3300025942 | Bacteria | 1304 |
| 406 | Ga0207661_10003174 | 3300025944 | Bacteria | 11401 |
| 407 | Ga0207679_10063691 | 3300025945 | Bacteria | 2753 |
| 408 | Ga0207679_10085487 | 3300025945 | Unclassified | 2423 |
| 409 | Ga0207667_10001687 | 3300025949 | Bacteria | 27830 |
| 410 | Ga0207667_10008543 | 3300025949 | Bacteria | 12153 |
| 411 | Ga0207667_10053640 | 3300025949 | Unclassified | 4242 |
| 412 | Ga0207667_10256121 | 3300025949 | Bacteria | 1790 |
| 413 | Ga0207651_10020255 | 3300025960 | Bacteria | 4010 |
| 414 | Ga0207651_10033933 | 3300025960 | Bacteria | 3298 |
| 415 | Ga0207651_10084259 | 3300025960 | Bacteria | 2302 |
| 416 | Ga0207712_10009397 | 3300025961 | Bacteria | 6186 |
| 417 | Ga0207712_10036731 | 3300025961 | Bacteria | 3339 |
| 418 | Ga0207712_10037461 | 3300025961 | Bacteria | 3309 |
| 419 | Ga0207712_10105168 | 3300025961 | Bacteria | 2106 |
| 420 | Ga0207712_10132714 | 3300025961 | Bacteria | 1900 |
| 421 | Ga0207668_10000734 | 3300025972 | Bacteria | 20079 |
| 422 | Ga0207658_10004161 | 3300025986 | Bacteria | 10082 |
| 423 | Ga0207677_10002453 | 3300026023 | Bacteria | 9745 |
| 424 | Ga0207677_10027711 | 3300026023 | Bacteria | 3573 |
| 425 | Ga0207677_10135086 | 3300026023 | Bacteria | 1879 |
| 426 | Ga0207703_10001543 | 3300026035 | Bacteria | 20896 |
| 427 | Ga0207703_10050136 | 3300026035 | Bacteria | 3377 |
| 428 | Ga0207703_10220099 | 3300026035 | Unclassified | 1697 |
| 429 | Ga0207639_10019304 | 3300026041 | Bacteria | 4860 |
| 430 | Ga0207639_10020595 | 3300026041 | Bacteria | 4723 |
| 431 | Ga0207639_10037592 | 3300026041 | Bacteria | 3596 |
| 432 | Ga0207639_10063356 | 3300026041 | Bacteria | 2863 |
| 433 | Ga0207678_10318808 | 3300026067 | Bacteria | 1337 |
| 434 | Ga0207708_10321406 | 3300026075 | Bacteria | 1263 |
| 435 | Ga0207702_10296827 | 3300026078 | Bacteria | 1532 |
| 436 | Ga0207641_10000418 | 3300026088 | Bacteria | 49680 |
| 437 | Ga0207641_10000828 | 3300026088 | Bacteria | 32919 |
| 438 | Ga0207641_10003343 | 3300026088 | Bacteria | 14259 |
| 439 | Ga0207641_10015130 | 3300026088 | Bacteria | 6322 |
| 440 | Ga0207641_10023076 | 3300026088 | Bacteria | 5126 |
| 441 | Ga0207641_10153109 | 3300026088 | Bacteria | 2090 |
| 442 | Ga0207648_10019402 | 3300026089 | Bacteria | 6137 |
| 443 | Ga0207648_10025237 | 3300026089 | Bacteria | 5295 |
| 444 | Ga0207648_10030283 | 3300026089 | Bacteria | 4794 |
| 445 | Ga0207648_10078650 | 3300026089 | Bacteria | 2877 |
| 446 | Ga0207676_10002561 | 3300026095 | Bacteria | 12978 |
| 447 | Ga0207676_10023138 | 3300026095 | Bacteria | 4579 |
| 448 | Ga0207676_10065030 | 3300026095 | Bacteria | 2903 |
| 449 | Ga0207676_10183991 | 3300026095 | Bacteria | 1832 |
| 450 | Ga0207674_10006251 | 3300026116 | Bacteria | 14035 |
| 451 | Ga0207674_10008311 | 3300026116 | Bacteria | 12012 |
| 452 | Ga0207674_10067595 | 3300026116 | Bacteria | 3597 |
| 453 | Ga0207675_100015799 | 3300026118 | Bacteria | 7040 |
| 454 | Ga0207675_100017319 | 3300026118 | Bacteria | 6727 |
| 455 | Ga0207683_10005675 | 3300026121 | Bacteria | 10702 |
| 456 | Ga0207698_10061742 | 3300026142 | Bacteria | 2922 |
| 457 | Ga0207698_10207945 | 3300026142 | Bacteria | 1758 |
| 458 | Ga0207698_10246023 | 3300026142 | Bacteria | 1633 |
| 459 | Ga0207698_10282656 | 3300026142 | Bacteria | 1536 |
| 460 | Ga0207698_10522953 | 3300026142 | Bacteria | 1158 |
| 461 | Ga0207428_10116255 | 3300027907 | Bacteria | 2054 |
| 462 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 463 | Ga0268266_10022079 | 3300028379 | Bacteria | 5425 |
| 464 | Ga0268266_10026105 | 3300028379 | Bacteria | 4970 |
| 465 | Ga0268264_10000052 | 3300028381 | Bacteria | 321218 |
| 466 | Ga0268264_10000866 | 3300028381 | Bacteria | 32068 |
| 467 | Ga0268264_10012315 | 3300028381 | Bacteria | 7039 |
| 468 | Ga0268264_10057305 | 3300028381 | Bacteria | 3259 |
| 469 | Ga0268264_10428338 | 3300028381 | Bacteria | 1277 |
| 470 | Ga0307515_10000251 | 3300028794 | Bacteria | 132970 |
| 471 | Ga0265338_10038157 | 3300028800 | Bacteria | 4557 |
| 472 | Ga0307511_10000362 | 3300030521 | Bacteria | 48275 |
| 473 | Ga0265320_10105146 | 3300031240 | Unclassified | 1298 |
| 474 | Ga0265327_10012487 | 3300031251 | Bacteria | 5724 |
| 475 | Ga0265327_10028580 | 3300031251 | Bacteria | 3186 |
| 476 | Ga0307513_10052945 | 3300031456 | Bacteria | 4366 |
| 477 | Ga0307509_10174692 | 3300031507 | Unclassified | 2022 |
| 478 | Ga0307408_100264281 | 3300031548 | Unclassified | 1426 |
| 479 | Ga0265313_10045631 | 3300031595 | Bacteria | 2132 |
| 480 | Ga0307508_10005225 | 3300031616 | Bacteria | 12417 |
| 481 | Ga0307516_10001001 | 3300031730 | Bacteria | 39099 |
| 482 | Ga0307410_10302334 | 3300031852 | Bacteria | 1263 |
| 483 | Ga0307416_100031968 | 3300032002 | Bacteria | 3970 |
| 484 | Ga0307414_10364548 | 3300032004 | Unclassified | 1244 |
| 485 | Ga0307411_10178365 | 3300032005 | Unclassified | 1610 |
| 486 | Ga0307415_100106878 | 3300032126 | Bacteria | 2067 |
| 487 | Ga0307507_10039255 | 3300033179 | Bacteria | 4782 |
| 488 | Ga0307510_10000058 | 3300033180 | Bacteria | 85118 |
| 489 | Ga0373955_0056777 | 3300035172 | Bacteria | 2149 |
| 490 | Ga0373927_0126402 | 3300035695 | Bacteria | 1669 |
| 491 | Ga0373933_0206838 | 3300035724 | Bacteria | 1257 |
| 492 | Ga0395900_0099014 | 3300037418 | Bacteria | 2995 |
| 493 | Ga0395898_0283416 | 3300037466 | Unclassified | 1580 |
| 494 | Ga0395905_0022702 | 3300037471 | Bacteria | 5932 |
| 495 | Ga0395901_0091687 | 3300038443 | Bacteria | 3180 |
| 496 | Ga0436365_0759450 | 3300039437 | Bacteria | 1433 |
| 497 | Ga0436365_1285215 | 3300039437 | Bacteria | 11167 |
| 498 | Ga0439436_0013792 | 3300041404 | Bacteria | 2444 |
| 499 | Ga0439465_0011285 | 3300041413 | Bacteria | 2803 |
| 500 | Ga0451791_0370370 | 3300041451 | Bacteria | 1367 |
| 501 | Ga0451802_0078279 | 3300041460 | Bacteria | 1033 |
| 502 | Ga0451853_3568257 | 3300041512 | Bacteria | 1854 |
| 503 | Ga0439457_001548 | 3300042014 | Bacteria | 6898 |
| 504 | Ga0439457_003006 | 3300042014 | Bacteria | 4686 |
| 505 | Ga0439462_0003568 | 3300042015 | Bacteria | 3743 |
| 506 | Ga0450894_001231 | 3300042131 | Bacteria | 3763 |
| 507 | Ga0439434_0010291 | 3300042435 | Bacteria | 2758 |
| 508 | Ga0451577_0054485 | 3300042876 | Bacteria | 3570 |
| 509 | Ga0451577_0069257 | 3300042876 | Bacteria | 3146 |
| 510 | Ga0451577_0144216 | 3300042876 | Bacteria | 2141 |
| 511 | Ga0451577_0488022 | 3300042876 | Unclassified | 1119 |
| 512 | Ga0466969_0000167 | 3300044656 | Bacteria | 35385 |
| 513 | Ga0466972_0000064 | 3300044658 | Bacteria | 104558 |
| 514 | Ga0466972_0000083 | 3300044658 | Bacteria | 87204 |
| 515 | Ga0466972_0001783 | 3300044658 | Bacteria | 10538 |
| 516 | Ga0453683_0126612 | 3300044673 | Bacteria | 1608 |
| 517 | Ga0466965_0007953 | 3300044683 | Bacteria | 4889 |
| 518 | Ga0466966_0000161 | 3300044684 | Bacteria | 43671 |
| 519 | Ga0453684_0307987 | 3300044712 | Unclassified | 1798 |
| 520 | Ga0466971_0035623 | 3300044719 | Bacteria | 2232 |
| 521 | Ga0466970_0002805 | 3300044765 | Bacteria | 8410 |
| 522 | Ga0466957_0000551 | 3300044842 | Bacteria | 18906 |
| 523 | Ga0466957_0009998 | 3300044842 | Bacteria | 5429 |
| 524 | Ga0466959_0000005 | 3300045049 | Bacteria | 213958 |
| 525 | Ga0466959_0000420 | 3300045049 | Bacteria | 24757 |
| 526 | Ga0466959_0236560 | 3300045049 | Bacteria | 1263 |
| 527 | Ga0466958_0068923 | 3300045836 | Bacteria | 2163 |
| 528 | Ga0466967_0608670 | 3300045976 | Bacteria | 1079 |
| 529 | Ga0495629_0033164 | 3300046459 | Bacteria | 3654 |
| 530 | Ga0495582_0113429 | 3300046473 | Unclassified | 1523 |
| 531 | Ga0495606_0002264 | 3300046507 | Bacteria | 22818 |
| 532 | Ga0495630_0078985 | 3300046517 | Bacteria | 2482 |
| 533 | Ga0495648_0004081 | 3300046524 | Bacteria | 12598 |
| 534 | Ga0495622_0049258 | 3300046557 | Bacteria | 1956 |
| 535 | Ga0495656_0043876 | 3300046615 | Bacteria | 1880 |
| 536 | Ga0495668_0001302 | 3300046616 | Bacteria | 24603 |
| 537 | Ga0495668_0002880 | 3300046616 | Bacteria | 13634 |
| 538 | Ga0495611_0000176 | 3300046648 | Bacteria | 46302 |
| 539 | Ga0495658_0015221 | 3300046683 | Bacteria | 3944 |
| 540 | Ga0495670_0065223 | 3300046691 | Bacteria | 1835 |
| 541 | Ga0495636_0000004 | 3300047318 | Bacteria | 109175 |
| 542 | Ga0495672_0008108 | 3300047320 | Bacteria | 7801 |
| 543 | Ga0495672_0048595 | 3300047320 | Bacteria | 2515 |
| 544 | Ga0495672_0062390 | 3300047320 | Bacteria | 2144 |
| 545 | Ga0495676_0053899 | 3300047321 | Bacteria | 3201 |
| 546 | Ga0495687_000039 | 3300047443 | Bacteria | 245077 |
| 547 | Ga0496114_0000295 | 3300048917 | Bacteria | 36585 |
| 548 | Ga0501034_0000043 | 3300049571 | Bacteria | 229049 |
| 549 | Ga0501034_0002711 | 3300049571 | Bacteria | 20864 |
| 550 | Ga0501034_0004134 | 3300049571 | Bacteria | 16252 |
| 551 | Ga0501034_0495966 | 3300049571 | Bacteria | 1135 |
| 552 | Ga0501036_0041144 | 3300049572 | Bacteria | 3911 |
| 553 | Ga0501037_0002736 | 3300049573 | Bacteria | 12747 |
| 554 | Ga0501038_0027763 | 3300049574 | Bacteria | 5031 |
| 555 | Ga0501038_0099782 | 3300049574 | Bacteria | 2420 |
| 556 | Ga0501043_0002356 | 3300049579 | Bacteria | 16018 |
| 557 | Ga0501043_0098893 | 3300049579 | Bacteria | 2293 |
| 558 | Ga0501046_0010797 | 3300049580 | Bacteria | 7830 |
| 559 | Ga0501047_0002262 | 3300049581 | Bacteria | 18429 |
| 560 | Ga0501047_0003566 | 3300049581 | Bacteria | 14690 |
| 561 | Ga0501047_0048391 | 3300049581 | Bacteria | 4106 |
| 562 | Ga0501070_0031283 | 3300049586 | Bacteria | 4459 |
| 563 | Ga0501073_0000270 | 3300049589 | Bacteria | 34510 |
| 564 | Ga0501073_0036657 | 3300049589 | Bacteria | 3484 |
| 565 | Ga0501074_0001640 | 3300049590 | Bacteria | 15163 |
| 566 | Ga0501202_004104 | 3300049652 | Bacteria | 2536 |
| 567 | Ga0501202_004331 | 3300049652 | Bacteria | 2483 |
| 568 | Ga0501217_014317 | 3300049661 | Bacteria | 1790 |
| 569 | Ga0501222_002004 | 3300049662 | Bacteria | 2823 |
| 570 | Ga0501223_030072 | 3300049663 | Bacteria | 1056 |
| 571 | Ga0501253_026692 | 3300049683 | Bacteria | 1067 |
| 572 | Ga0501259_000246 | 3300049688 | Bacteria | 8479 |
| 573 | Ga0501261_003555 | 3300049690 | Bacteria | 1914 |
| 574 | Ga0501221_001021 | 3300049704 | Bacteria | 4595 |
| 575 | Ga0501225_0014361 | 3300049705 | Bacteria | 2212 |
| 576 | Ga0501225_0029317 | 3300049705 | Bacteria | 1512 |
| 577 | Ga0501234_001182 | 3300049707 | Bacteria | 4115 |
| 578 | Ga0501080_0007763 | 3300049742 | Bacteria | 9696 |
| 579 | Ga0501080_0243860 | 3300049742 | Bacteria | 1639 |
| 580 | Ga0501083_0003740 | 3300049744 | Bacteria | 10687 |
| 581 | Ga0501083_0056363 | 3300049744 | Bacteria | 2633 |
| 582 | Ga0501241_011063 | 3300049758 | Bacteria | 1639 |
| 583 | Ga0501035_0018543 | 3300049822 | Bacteria | 6411 |
| 584 | Ga0501035_0089090 | 3300049822 | Bacteria | 2718 |
| 585 | Ga0501035_0306920 | 3300049822 | Bacteria | 1336 |
| 586 | Ga0501044_0008438 | 3300049823 | Bacteria | 11298 |
| 587 | Ga0501044_0020228 | 3300049823 | Bacteria | 7104 |
| 588 | Ga0501044_0027639 | 3300049823 | Bacteria | 5992 |
| 589 | Ga0501284_00093 | 3300050005 | Bacteria | 19510 |
| 590 | nmdc:mga0k408_28079_c1 | 3300050493 | Bacteria | 3198 |
| 591 | nmdc:mga0k408_37783_c1 | 3300050493 | Bacteria | 2772 |
| 592 | nmdc:mga05p37_31751_c1 | 3300050507 | Bacteria | 6454 |
| 593 | nmdc:mga09592_116612_c1 | 3300050508 | Unclassified | 2292 |
| 594 | nmdc:mga09592_175977_c1 | 3300050508 | Bacteria | 1851 |
| 595 | nmdc:mga0qj67_7913_c1 | 3300050509 | Bacteria | 7856 |
| 596 | nmdc:mga06r32_12289_c1 | 3300050510 | Bacteria | 7722 |
| 597 | nmdc:mga06r32_17490_c1 | 3300050510 | Bacteria | 6544 |
| 598 | nmdc:mga08y16_10827_c1 | 3300050511 | Bacteria | 9575 |
| 599 | Ga0500578_0000066 | 3300053086 | Bacteria | 116854 |
| 600 | Ga0500578_0004714 | 3300053086 | Bacteria | 9476 |
| 601 | Ga0500644_0002143 | 3300053088 | Bacteria | 4995 |
| 602 | Ga0500646_0003287 | 3300053090 | Bacteria | 4153 |
| 603 | Ga0500646_0027581 | 3300053090 | Bacteria | 1546 |
| 604 | Ga0500583_0000002 | 3300053092 | Bacteria | 232826 |
| 605 | Ga0500583_0002413 | 3300053092 | Bacteria | 5611 |
| 606 | Ga0500562_000040 | 3300053108 | Bacteria | 69393 |
| 607 | Ga0500572_019936 | 3300053111 | Bacteria | 1758 |
| 608 | Ga0500642_0056288 | 3300053130 | Bacteria | 1752 |
| 609 | Ga0500559_0019833 | 3300053136 | Bacteria | 2841 |
| 610 | Ga0500568_0000610 | 3300053139 | Bacteria | 25862 |
| 611 | Ga0500589_037777 | 3300053147 | Bacteria | 2254 |
| 612 | Ga0500604_0009447 | 3300053151 | Unclassified | 2599 |
| 613 | Ga0500616_0005185 | 3300053153 | Bacteria | 8935 |
| 614 | Ga0500622_0000432 | 3300053156 | Bacteria | 39841 |
| 615 | Ga0500622_0019511 | 3300053156 | Bacteria | 3601 |
| 616 | Ga0500622_0027780 | 3300053156 | Unclassified | 2982 |
| 617 | Ga0500622_0198645 | 3300053156 | Bacteria | 914 |
| 618 | Ga0500636_0090165 | 3300053177 | Bacteria | 1757 |
| 619 | Ga0500611_000018 | 3300053727 | Bacteria | 111023 |
| 620 | Ga0500645_043077 | 3300053730 | Bacteria | 1330 |
| 621 | Ga0501084_0109441 | 3300054114 | Bacteria | 2321 |
| 622 | Ga0466962_0032021 | 3300061719 | Bacteria | 2517 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049663 | Ga0501223_030072 | Ga0501223_030072_68_871 | 248 |
| 2 | 3300049683 | Ga0501253_026692 | Ga0501253_026692_84_887 | 248 |
| 3 | 3300035724 | Ga0373933_0206838 | Ga0373933_0206838_31_843 | 266 |
| 4 | 3300045049 | Ga0466959_0236560 | Ga0466959_0236560_73_903 | 270 |
| 5 | 3300005455 | Ga0070663_100029912 | Ga0070663_1000299121 | 273 |
| 6 | 3300026067 | Ga0207678_10318808 | Ga0207678_103188082 | 273 |
| 7 | 3300026089 | Ga0207648_10078650 | Ga0207648_100786504 | 282 |
| 8 | 3300005530 | Ga0070679_100001217 | Ga0070679_10000121711 | 284 |
| 9 | 3300025921 | Ga0207652_10000310 | Ga0207652_1000031011 | 284 |
| 10 | 3300039437 | Ga0436365_0759450 | Ga0436365_0759450_494_1378 | 284 |
| 11 | 3300053156 | Ga0500622_0198645 | Ga0500622_0198645_16_900 | 289 |
| 12 | 3300053730 | Ga0500645_043077 | Ga0500645_043077_60_944 | 289 |
| 13 | 3300053153 | Ga0500616_0005185 | Ga0500616_0005185_6640_7542 | 296 |
| 14 | 3300014325 | Ga0163163_10000141 | Ga0163163_1000014140 | 297 |
| 15 | 3300009093 | Ga0105240_10062565 | Ga0105240_100625652 | 301 |
| 16 | 3300025913 | Ga0207695_10085174 | Ga0207695_100851743 | 301 |
| 17 | 3300013307 | Ga0157372_10782263 | Ga0157372_107822631 | 302 |
| 18 | 3300035695 | Ga0373927_0126402 | Ga0373927_0126402_259_1191 | 302 |
| 19 | 3300044658 | Ga0466972_0000083 | Ga0466972_0000083_39545_40477 | 302 |
| 20 | 3300044684 | Ga0466966_0000161 | Ga0466966_0000161_32775_33707 | 302 |
| 21 | 3300044842 | Ga0466957_0009998 | Ga0466957_0009998_2589_3521 | 302 |
| 22 | 3300045049 | Ga0466959_0000005 | Ga0466959_0000005_55223_56155 | 302 |
| 23 | 3300050493 | nmdc:mga0k408_28079_c1 | nmdc:mga0k408_28079_c1_1522_2454 | 302 |
| 24 | 3300053086 | Ga0500578_0004714 | Ga0500578_0004714_696_1628 | 302 |
| 25 | 3300053111 | Ga0500572_019936 | Ga0500572_019936_435_1367 | 302 |
| 26 | 3300053177 | Ga0500636_0090165 | Ga0500636_0090165_622_1554 | 302 |
| 27 | 3300003316 | rootH1_10078605 | rootH1_100786052 | 304 |
| 28 | 3300003323 | rootH1_10220108 | rootH1_102201081 | 304 |
| 29 | 3300005367 | Ga0070667_100285391 | Ga0070667_1002853912 | 304 |
| 30 | 3300005438 | Ga0070701_10085384 | Ga0070701_100853842 | 304 |
| 31 | 3300005441 | Ga0070700_100032359 | Ga0070700_1000323592 | 304 |
| 32 | 3300010375 | Ga0105239_10008603 | Ga0105239_1000860311 | 304 |
| 33 | 3300041460 | Ga0451802_0078279 | Ga0451802_0078279_32_970 | 304 |
| 34 | 3300044842 | Ga0466957_0000551 | Ga0466957_0000551_14113_15051 | 304 |
| 35 | 3300049581 | Ga0501047_0048391 | Ga0501047_0048391_746_1684 | 304 |
| 36 | 3300049705 | Ga0501225_0029317 | Ga0501225_0029317_538_1476 | 304 |
| 37 | 3300053092 | Ga0500583_0002413 | Ga0500583_0002413_54_992 | 304 |
| 38 | 3300053130 | Ga0500642_0056288 | Ga0500642_0056288_232_1170 | 304 |
| 39 | 3300033179 | Ga0307507_10039255 | Ga0307507_100392556 | 306 |
| 40 | 3300041451 | Ga0451791_0370370 | Ga0451791_0370370_306_1253 | 307 |
| 41 | 3300031456 | Ga0307513_10052945 | Ga0307513_100529452 | 309 |
| 42 | 3300005563 | Ga0068855_100000454 | Ga0068855_10000045430 | 312 |
| 43 | 3300025913 | Ga0207695_10000073 | Ga0207695_10000073234 | 312 |
| 44 | 3300046615 | Ga0495656_0043876 | Ga0495656_0043876_884_1861 | 313 |
| 45 | 3300047318 | Ga0495636_0000004 | Ga0495636_0000004_45899_46876 | 313 |
| 46 | 3300021384 | Ga0213876_10008585 | Ga0213876_100085857 | 314 |
| 47 | 3300031595 | Ga0265313_10045631 | Ga0265313_100456312 | 314 |
| 48 | 3300039437 | Ga0436365_1285215 | Ga0436365_1285215_2376_3365 | 314 |
| 49 | iso_pu_bacteria | 2818991444 | 2819588729 | 315 |
| 50 | iso_pu_bacteria | 2929154850 | 2929157459 | 315 |
| 51 | 3300013297 | Ga0157378_10036965 | Ga0157378_100369654 | 316 |
| 52 | iso_pu_bacteria | 2881955468 | 2881957071 | 316 |
| 53 | 3300005466 | Ga0070685_10312000 | Ga0070685_103120001 | 317 |
| 54 | 3300013307 | Ga0157372_10144429 | Ga0157372_101444293 | 318 |
| 55 | 3300003320 | rootH2_10135059 | rootH2_101350593 | 319 |
| 56 | 3300005356 | Ga0070674_100065186 | Ga0070674_1000651862 | 319 |
| 57 | 3300009551 | Ga0105238_10113786 | Ga0105238_101137863 | 319 |
| 58 | 3300010375 | Ga0105239_10000754 | Ga0105239_1000075412 | 319 |
| 59 | 3300013105 | Ga0157369_10247999 | Ga0157369_102479992 | 319 |
| 60 | 3300013307 | Ga0157372_10003000 | Ga0157372_1000300011 | 319 |
| 61 | 3300014326 | Ga0157380_10106081 | Ga0157380_101060812 | 319 |
| 62 | 3300044719 | Ga0466971_0035623 | Ga0466971_0035623_253_1230 | 319 |
| 63 | 3300045049 | Ga0466959_0000420 | Ga0466959_0000420_18625_19602 | 319 |
| 64 | 3300045836 | Ga0466958_0068923 | Ga0466958_0068923_57_1034 | 319 |
| 65 | 3300049571 | Ga0501034_0004134 | Ga0501034_0004134_10926_11912 | 319 |
| 66 | 3300049573 | Ga0501037_0002736 | Ga0501037_0002736_10561_11547 | 319 |
| 67 | 3300049574 | Ga0501038_0099782 | Ga0501038_0099782_36_1022 | 319 |
| 68 | 3300049579 | Ga0501043_0098893 | Ga0501043_0098893_718_1698 | 319 |
| 69 | 3300049581 | Ga0501047_0003566 | Ga0501047_0003566_2224_3210 | 319 |
| 70 | 3300049822 | Ga0501035_0306920 | Ga0501035_0306920_69_1055 | 319 |
| 71 | 3300049823 | Ga0501044_0020228 | Ga0501044_0020228_5145_6131 | 319 |
| 72 | 3300053088 | Ga0500644_0002143 | Ga0500644_0002143_2955_3944 | 319 |
| 73 | 3300053108 | Ga0500562_000040 | Ga0500562_000040_42958_43947 | 319 |
| 74 | 3300053156 | Ga0500622_0000432 | Ga0500622_0000432_1845_2819 | 319 |
| 75 | 3300061719 | Ga0466962_0032021 | Ga0466962_0032021_754_1731 | 319 |
| 76 | iso_pu_bacteria | 2914759650 | 2914760345 | 319 |
| 77 | 3300003320 | rootH2_10008117 | rootH2_1000811719 | 320 |
| 78 | 3300003320 | rootH2_10036959 | rootH2_100369599 | 320 |
| 79 | 3300005290 | Ga0065712_10014358 | Ga0065712_100143582 | 320 |
| 80 | 3300005329 | Ga0070683_100007365 | Ga0070683_1000073654 | 320 |
| 81 | 3300005333 | Ga0070677_10033659 | Ga0070677_100336592 | 320 |
| 82 | 3300005336 | Ga0070680_100422813 | Ga0070680_1004228131 | 320 |
| 83 | 3300005341 | Ga0070691_10034522 | Ga0070691_100345223 | 320 |
| 84 | 3300005354 | Ga0070675_100054206 | Ga0070675_1000542062 | 320 |
| 85 | 3300005356 | Ga0070674_100060611 | Ga0070674_1000606113 | 320 |
| 86 | 3300005455 | Ga0070663_100352807 | Ga0070663_1003528071 | 320 |
| 87 | 3300005458 | Ga0070681_10065931 | Ga0070681_100659312 | 320 |
| 88 | 3300005458 | Ga0070681_10150342 | Ga0070681_101503422 | 320 |
| 89 | 3300005459 | Ga0068867_100227742 | Ga0068867_1002277421 | 320 |
| 90 | 3300005466 | Ga0070685_10091216 | Ga0070685_100912162 | 320 |
| 91 | 3300005535 | Ga0070684_100154219 | Ga0070684_1001542191 | 320 |
| 92 | 3300005614 | Ga0068856_100084463 | Ga0068856_1000844633 | 320 |
| 93 | 3300005616 | Ga0068852_100034055 | Ga0068852_1000340556 | 320 |
| 94 | 3300005983 | Ga0081540_1003257 | Ga0081540_10032575 | 320 |
| 95 | 3300006237 | Ga0097621_100000138 | Ga0097621_10000013814 | 320 |
| 96 | 3300006358 | Ga0068871_100000427 | Ga0068871_1000004276 | 320 |
| 97 | 3300006847 | Ga0075431_100115586 | Ga0075431_1001155862 | 320 |
| 98 | 3300006880 | Ga0075429_100144472 | Ga0075429_1001444722 | 320 |
| 99 | 3300009093 | Ga0105240_10005924 | Ga0105240_100059247 | 320 |
| 100 | 3300009094 | Ga0111539_10015160 | Ga0111539_100151605 | 320 |
| 101 | 3300009147 | Ga0114129_10020798 | Ga0114129_100207986 | 320 |
| 102 | 3300009176 | Ga0105242_10401590 | Ga0105242_104015901 | 320 |
| 103 | 3300009177 | Ga0105248_10007233 | Ga0105248_100072334 | 320 |
| 104 | 3300009553 | Ga0105249_10026614 | Ga0105249_100266143 | 320 |
| 105 | 3300010375 | Ga0105239_10005357 | Ga0105239_1000535714 | 320 |
| 106 | 3300013100 | Ga0157373_10096532 | Ga0157373_100965322 | 320 |
| 107 | 3300013102 | Ga0157371_10012550 | Ga0157371_100125503 | 320 |
| 108 | 3300013105 | Ga0157369_10126575 | Ga0157369_101265753 | 320 |
| 109 | 3300013296 | Ga0157374_10000003 | Ga0157374_10000003622 | 320 |
| 110 | 3300013306 | Ga0163162_10000531 | Ga0163162_1000053114 | 320 |
| 111 | 3300013306 | Ga0163162_10039867 | Ga0163162_100398673 | 320 |
| 112 | 3300013307 | Ga0157372_10008075 | Ga0157372_100080754 | 320 |
| 113 | 3300013308 | Ga0157375_10000230 | Ga0157375_1000023018 | 320 |
| 114 | 3300013308 | Ga0157375_10080650 | Ga0157375_100806503 | 320 |
| 115 | 3300014326 | Ga0157380_10011554 | Ga0157380_100115545 | 320 |
| 116 | 3300014326 | Ga0157380_10110525 | Ga0157380_101105252 | 320 |
| 117 | 3300014968 | Ga0157379_10004457 | Ga0157379_1000445710 | 320 |
| 118 | 3300014969 | Ga0157376_10000514 | Ga0157376_100005148 | 320 |
| 119 | 3300014969 | Ga0157376_10034592 | Ga0157376_100345922 | 320 |
| 120 | 3300014969 | Ga0157376_10240533 | Ga0157376_102405332 | 320 |
| 121 | 3300025893 | Ga0207682_10003280 | Ga0207682_100032803 | 320 |
| 122 | 3300025912 | Ga0207707_10234589 | Ga0207707_102345892 | 320 |
| 123 | 3300025921 | Ga0207652_10240563 | Ga0207652_102405632 | 320 |
| 124 | 3300025940 | Ga0207691_10006805 | Ga0207691_100068057 | 320 |
| 125 | 3300025940 | Ga0207691_10370970 | Ga0207691_103709702 | 320 |
| 126 | 3300025941 | Ga0207711_10041755 | Ga0207711_100417553 | 320 |
| 127 | 3300025944 | Ga0207661_10003174 | Ga0207661_1000317412 | 320 |
| 128 | 3300025961 | Ga0207712_10132714 | Ga0207712_101327141 | 320 |
| 129 | 3300026142 | Ga0207698_10061742 | Ga0207698_100617421 | 320 |
| 130 | 3300031616 | Ga0307508_10005225 | Ga0307508_100052252 | 320 |
| 131 | 3300032004 | Ga0307414_10364548 | Ga0307414_103645481 | 320 |
| 132 | 3300037418 | Ga0395900_0099014 | Ga0395900_0099014_1050_2033 | 320 |
| 133 | 3300037466 | Ga0395898_0283416 | Ga0395898_0283416_309_1292 | 320 |
| 134 | 3300037471 | Ga0395905_0022702 | Ga0395905_0022702_4754_5737 | 320 |
| 135 | 3300038443 | Ga0395901_0091687 | Ga0395901_0091687_924_1907 | 320 |
| 136 | 3300042876 | Ga0451577_0144216 | Ga0451577_0144216_1023_1997 | 320 |
| 137 | 3300044673 | Ga0453683_0126612 | Ga0453683_0126612_545_1519 | 320 |
| 138 | 3300046557 | Ga0495622_0049258 | Ga0495622_0049258_615_1595 | 320 |
| 139 | 3300050507 | nmdc:mga05p37_31751_c1 | nmdc:mga05p37_31751_c1_3478_4461 | 320 |
| 140 | 3300050508 | nmdc:mga09592_116612_c1 | nmdc:mga09592_116612_c1_874_1857 | 320 |
| 141 | 3300050510 | nmdc:mga06r32_17490_c1 | nmdc:mga06r32_17490_c1_4480_5463 | 320 |
| 142 | 3300050511 | nmdc:mga08y16_10827_c1 | nmdc:mga08y16_10827_c1_6121_7104 | 320 |
| 143 | 3300053090 | Ga0500646_0003287 | Ga0500646_0003287_2925_3905 | 320 |
| 144 | 3300003320 | rootH2_10176815 | rootH2_101768152 | 321 |
| 145 | 3300005539 | Ga0068853_100105862 | Ga0068853_1001058622 | 321 |
| 146 | 3300005548 | Ga0070665_100004519 | Ga0070665_1000045196 | 321 |
| 147 | 3300005616 | Ga0068852_100257532 | Ga0068852_1002575322 | 321 |
| 148 | 3300009093 | Ga0105240_10000011 | Ga0105240_10000011150 | 321 |
| 149 | 3300009093 | Ga0105240_10000253 | Ga0105240_1000025372 | 321 |
| 150 | 3300009094 | Ga0111539_10480883 | Ga0111539_104808831 | 321 |
| 151 | 3300009174 | Ga0105241_10000921 | Ga0105241_100009215 | 321 |
| 152 | 3300009545 | Ga0105237_10019647 | Ga0105237_100196472 | 321 |
| 153 | 3300009545 | Ga0105237_10040889 | Ga0105237_100408895 | 321 |
| 154 | 3300009545 | Ga0105237_10041931 | Ga0105237_100419312 | 321 |
| 155 | 3300009551 | Ga0105238_10000806 | Ga0105238_1000080612 | 321 |
| 156 | 3300009551 | Ga0105238_10146275 | Ga0105238_101462753 | 321 |
| 157 | 3300010375 | Ga0105239_10000052 | Ga0105239_10000052164 | 321 |
| 158 | 3300010375 | Ga0105239_10004525 | Ga0105239_100045259 | 321 |
| 159 | 3300010375 | Ga0105239_10005010 | Ga0105239_100050106 | 321 |
| 160 | 3300010375 | Ga0105239_10052253 | Ga0105239_100522533 | 321 |
| 161 | 3300013104 | Ga0157370_10008048 | Ga0157370_1000804811 | 321 |
| 162 | 3300013105 | Ga0157369_10109167 | Ga0157369_101091672 | 321 |
| 163 | 3300013307 | Ga0157372_10018402 | Ga0157372_100184022 | 321 |
| 164 | 3300025904 | Ga0207647_10000139 | Ga0207647_1000013920 | 321 |
| 165 | 3300025911 | Ga0207654_10043080 | Ga0207654_100430802 | 321 |
| 166 | 3300025913 | Ga0207695_10000010 | Ga0207695_10000010538 | 321 |
| 167 | 3300025913 | Ga0207695_10001248 | Ga0207695_100012488 | 321 |
| 168 | 3300025913 | Ga0207695_10054406 | Ga0207695_100544062 | 321 |
| 169 | 3300025914 | Ga0207671_10000150 | Ga0207671_1000015050 | 321 |
| 170 | 3300025914 | Ga0207671_10002003 | Ga0207671_1000200311 | 321 |
| 171 | 3300025914 | Ga0207671_10012112 | Ga0207671_100121122 | 321 |
| 172 | 3300025914 | Ga0207671_10017094 | Ga0207671_100170946 | 321 |
| 173 | 3300025924 | Ga0207694_10004674 | Ga0207694_1000467411 | 321 |
| 174 | 3300026078 | Ga0207702_10296827 | Ga0207702_102968272 | 321 |
| 175 | 3300026142 | Ga0207698_10522953 | Ga0207698_105229531 | 321 |
| 176 | 3300028379 | Ga0268266_10026105 | Ga0268266_100261055 | 321 |
| 177 | 3300028800 | Ga0265338_10038157 | Ga0265338_100381575 | 321 |
| 178 | 3300031240 | Ga0265320_10105146 | Ga0265320_101051462 | 321 |
| 179 | 3300031251 | Ga0265327_10028580 | Ga0265327_100285802 | 321 |
| 180 | 3300046524 | Ga0495648_0004081 | Ga0495648_0004081_10657_11637 | 321 |
| 181 | 3300046648 | Ga0495611_0000176 | Ga0495611_0000176_9649_10668 | 321 |
| 182 | 3300049822 | Ga0501035_0018543 | Ga0501035_0018543_3526_4539 | 321 |
| 183 | 3300053136 | Ga0500559_0019833 | Ga0500559_0019833_1371_2351 | 321 |
| 184 | 3300053156 | Ga0500622_0027780 | Ga0500622_0027780_716_1696 | 321 |
| 185 | 3300003320 | rootH2_10329777 | rootH2_103297772 | 322 |
| 186 | 3300003323 | rootH1_10060970 | rootH1_100609702 | 322 |
| 187 | 3300005459 | Ga0068867_100174164 | Ga0068867_1001741641 | 322 |
| 188 | 3300005530 | Ga0070679_100076589 | Ga0070679_1000765892 | 322 |
| 189 | 3300005577 | Ga0068857_100077874 | Ga0068857_1000778744 | 322 |
| 190 | 3300009093 | Ga0105240_10001160 | Ga0105240_100011606 | 322 |
| 191 | 3300009093 | Ga0105240_10003903 | Ga0105240_100039036 | 322 |
| 192 | 3300009551 | Ga0105238_10028558 | Ga0105238_100285583 | 322 |
| 193 | 3300010375 | Ga0105239_10002487 | Ga0105239_100024879 | 322 |
| 194 | 3300010375 | Ga0105239_10027112 | Ga0105239_100271122 | 322 |
| 195 | 3300013100 | Ga0157373_10112212 | Ga0157373_101122122 | 322 |
| 196 | 3300013296 | Ga0157374_10014412 | Ga0157374_100144128 | 322 |
| 197 | 3300013296 | Ga0157374_10083438 | Ga0157374_100834382 | 322 |
| 198 | 3300013306 | Ga0163162_10416434 | Ga0163162_104164342 | 322 |
| 199 | 3300013307 | Ga0157372_10023794 | Ga0157372_100237942 | 322 |
| 200 | 3300013307 | Ga0157372_10613456 | Ga0157372_106134562 | 322 |
| 201 | 3300025913 | Ga0207695_10000021 | Ga0207695_10000021482 | 322 |
| 202 | 3300025913 | Ga0207695_10000039 | Ga0207695_1000003925 | 322 |
| 203 | 3300025913 | Ga0207695_10028522 | Ga0207695_100285223 | 322 |
| 204 | 3300026041 | Ga0207639_10019304 | Ga0207639_100193045 | 322 |
| 205 | 3300031548 | Ga0307408_100264281 | Ga0307408_1002642812 | 322 |
| 206 | 3300032002 | Ga0307416_100031968 | Ga0307416_1000319682 | 322 |
| 207 | 3300032005 | Ga0307411_10178365 | Ga0307411_101783652 | 322 |
| 208 | 3300032126 | Ga0307415_100106878 | Ga0307415_1001068782 | 322 |
| 209 | 3300042876 | Ga0451577_0069257 | Ga0451577_0069257_1453_2478 | 322 |
| 210 | 3300044683 | Ga0466965_0007953 | Ga0466965_0007953_317_1288 | 322 |
| 211 | 3300046616 | Ga0495668_0001302 | Ga0495668_0001302_12365_13357 | 322 |
| 212 | 3300046616 | Ga0495668_0002880 | Ga0495668_0002880_5799_6779 | 322 |
| 213 | 3300049652 | Ga0501202_004104 | Ga0501202_004104_1041_2024 | 322 |
| 214 | 3300053151 | Ga0500604_0009447 | Ga0500604_0009447_94_1074 | 322 |
| 215 | iso_pu_bacteria | 2738541278 | 2738728228 | 322 |
| 216 | 3300003320 | rootH2_10111981 | rootH2_101119813 | 323 |
| 217 | 3300005327 | Ga0070658_10000438 | Ga0070658_1000043812 | 323 |
| 218 | 3300005328 | Ga0070676_10000997 | Ga0070676_100009973 | 323 |
| 219 | 3300005334 | Ga0068869_100028262 | Ga0068869_1000282622 | 323 |
| 220 | 3300005335 | Ga0070666_10000456 | Ga0070666_1000045613 | 323 |
| 221 | 3300005337 | Ga0070682_100233776 | Ga0070682_1002337762 | 323 |
| 222 | 3300005338 | Ga0068868_100009246 | Ga0068868_1000092464 | 323 |
| 223 | 3300005338 | Ga0068868_100107167 | Ga0068868_1001071672 | 323 |
| 224 | 3300005339 | Ga0070660_100156045 | Ga0070660_1001560452 | 323 |
| 225 | 3300005340 | Ga0070689_100201778 | Ga0070689_1002017782 | 323 |
| 226 | 3300005341 | Ga0070691_10007869 | Ga0070691_100078691 | 323 |
| 227 | 3300005347 | Ga0070668_100000202 | Ga0070668_10000020228 | 323 |
| 228 | 3300005355 | Ga0070671_100062625 | Ga0070671_1000626253 | 323 |
| 229 | 3300005364 | Ga0070673_100077223 | Ga0070673_1000772232 | 323 |
| 230 | 3300005366 | Ga0070659_100009938 | Ga0070659_1000099384 | 323 |
| 231 | 3300005366 | Ga0070659_100046176 | Ga0070659_1000461762 | 323 |
| 232 | 3300005367 | Ga0070667_100013521 | Ga0070667_1000135213 | 323 |
| 233 | 3300005457 | Ga0070662_100003965 | Ga0070662_1000039654 | 323 |
| 234 | 3300005458 | Ga0070681_10150155 | Ga0070681_101501552 | 323 |
| 235 | 3300005459 | Ga0068867_100005053 | Ga0068867_1000050534 | 323 |
| 236 | 3300005539 | Ga0068853_100020367 | Ga0068853_1000203675 | 323 |
| 237 | 3300005539 | Ga0068853_100022604 | Ga0068853_1000226042 | 323 |
| 238 | 3300005543 | Ga0070672_100001130 | Ga0070672_1000011307 | 323 |
| 239 | 3300005547 | Ga0070693_100100748 | Ga0070693_1001007482 | 323 |
| 240 | 3300005548 | Ga0070665_100019347 | Ga0070665_1000193476 | 323 |
| 241 | 3300005563 | Ga0068855_100028168 | Ga0068855_1000281682 | 323 |
| 242 | 3300005563 | Ga0068855_100041388 | Ga0068855_1000413882 | 323 |
| 243 | 3300005563 | Ga0068855_100365613 | Ga0068855_1003656132 | 323 |
| 244 | 3300005577 | Ga0068857_100127189 | Ga0068857_1001271892 | 323 |
| 245 | 3300005616 | Ga0068852_100208529 | Ga0068852_1002085292 | 323 |
| 246 | 3300005616 | Ga0068852_100380479 | Ga0068852_1003804791 | 323 |
| 247 | 3300005618 | Ga0068864_100000772 | Ga0068864_10000077221 | 323 |
| 248 | 3300005618 | Ga0068864_100226792 | Ga0068864_1002267922 | 323 |
| 249 | 3300005719 | Ga0068861_100014925 | Ga0068861_1000149253 | 323 |
| 250 | 3300005834 | Ga0068851_10000581 | Ga0068851_100005815 | 323 |
| 251 | 3300005841 | Ga0068863_100003530 | Ga0068863_1000035309 | 323 |
| 252 | 3300005842 | Ga0068858_100000805 | Ga0068858_10000080524 | 323 |
| 253 | 3300005843 | Ga0068860_100023578 | Ga0068860_1000235785 | 323 |
| 254 | 3300006237 | Ga0097621_100014028 | Ga0097621_1000140283 | 323 |
| 255 | 3300006358 | Ga0068871_100001816 | Ga0068871_1000018169 | 323 |
| 256 | 3300006358 | Ga0068871_100006696 | Ga0068871_1000066966 | 323 |
| 257 | 3300006358 | Ga0068871_100015060 | Ga0068871_1000150604 | 323 |
| 258 | 3300006881 | Ga0068865_100008579 | Ga0068865_1000085793 | 323 |
| 259 | 3300009093 | Ga0105240_10001493 | Ga0105240_1000149310 | 323 |
| 260 | 3300009093 | Ga0105240_10032806 | Ga0105240_100328064 | 323 |
| 261 | 3300009101 | Ga0105247_10013430 | Ga0105247_100134304 | 323 |
| 262 | 3300009174 | Ga0105241_10003754 | Ga0105241_100037547 | 323 |
| 263 | 3300009174 | Ga0105241_10144158 | Ga0105241_101441582 | 323 |
| 264 | 3300009176 | Ga0105242_10012591 | Ga0105242_100125916 | 323 |
| 265 | 3300009177 | Ga0105248_10020667 | Ga0105248_100206674 | 323 |
| 266 | 3300009545 | Ga0105237_10076119 | Ga0105237_100761193 | 323 |
| 267 | 3300009553 | Ga0105249_10008000 | Ga0105249_100080003 | 323 |
| 268 | 3300010375 | Ga0105239_10162460 | Ga0105239_101624604 | 323 |
| 269 | 3300013100 | Ga0157373_10056810 | Ga0157373_100568101 | 323 |
| 270 | 3300013104 | Ga0157370_10003352 | Ga0157370_100033525 | 323 |
| 271 | 3300013105 | Ga0157369_10091598 | Ga0157369_100915982 | 323 |
| 272 | 3300013105 | Ga0157369_10309289 | Ga0157369_103092892 | 323 |
| 273 | 3300013296 | Ga0157374_10001182 | Ga0157374_100011823 | 323 |
| 274 | 3300013297 | Ga0157378_10014067 | Ga0157378_100140671 | 323 |
| 275 | 3300013306 | Ga0163162_10007084 | Ga0163162_100070848 | 323 |
| 276 | 3300013306 | Ga0163162_10021924 | Ga0163162_100219245 | 323 |
| 277 | 3300013306 | Ga0163162_10052313 | Ga0163162_100523133 | 323 |
| 278 | 3300013307 | Ga0157372_10321777 | Ga0157372_103217772 | 323 |
| 279 | 3300013308 | Ga0157375_10011512 | Ga0157375_100115126 | 323 |
| 280 | 3300013308 | Ga0157375_10088979 | Ga0157375_100889792 | 323 |
| 281 | 3300013308 | Ga0157375_10343914 | Ga0157375_103439142 | 323 |
| 282 | 3300014325 | Ga0163163_10005606 | Ga0163163_100056066 | 323 |
| 283 | 3300014968 | Ga0157379_10003524 | Ga0157379_100035246 | 323 |
| 284 | 3300014968 | Ga0157379_10051501 | Ga0157379_100515014 | 323 |
| 285 | 3300014969 | Ga0157376_10000472 | Ga0157376_100004726 | 323 |
| 286 | 3300014969 | Ga0157376_10118277 | Ga0157376_101182772 | 323 |
| 287 | 3300025321 | Ga0207656_10001031 | Ga0207656_100010313 | 323 |
| 288 | 3300025903 | Ga0207680_10000787 | Ga0207680_100007874 | 323 |
| 289 | 3300025907 | Ga0207645_10000769 | Ga0207645_1000076916 | 323 |
| 290 | 3300025909 | Ga0207705_10018385 | Ga0207705_100183852 | 323 |
| 291 | 3300025911 | Ga0207654_10001605 | Ga0207654_100016052 | 323 |
| 292 | 3300025911 | Ga0207654_10071506 | Ga0207654_100715062 | 323 |
| 293 | 3300025913 | Ga0207695_10086049 | Ga0207695_100860493 | 323 |
| 294 | 3300025917 | Ga0207660_10014835 | Ga0207660_100148352 | 323 |
| 295 | 3300025919 | Ga0207657_10047383 | Ga0207657_100473832 | 323 |
| 296 | 3300025919 | Ga0207657_10178995 | Ga0207657_101789952 | 323 |
| 297 | 3300025921 | Ga0207652_10000797 | Ga0207652_100007977 | 323 |
| 298 | 3300025931 | Ga0207644_10286831 | Ga0207644_102868312 | 323 |
| 299 | 3300025932 | Ga0207690_10030568 | Ga0207690_100305683 | 323 |
| 300 | 3300025933 | Ga0207706_10005157 | Ga0207706_100051576 | 323 |
| 301 | 3300025933 | Ga0207706_10014900 | Ga0207706_100149003 | 323 |
| 302 | 3300025938 | Ga0207704_10004575 | Ga0207704_100045753 | 323 |
| 303 | 3300025940 | Ga0207691_10000010 | Ga0207691_10000010112 | 323 |
| 304 | 3300025942 | Ga0207689_10053787 | Ga0207689_100537873 | 323 |
| 305 | 3300025949 | Ga0207667_10053640 | Ga0207667_100536402 | 323 |
| 306 | 3300025949 | Ga0207667_10256121 | Ga0207667_102561212 | 323 |
| 307 | 3300025960 | Ga0207651_10020255 | Ga0207651_100202552 | 323 |
| 308 | 3300025972 | Ga0207668_10000734 | Ga0207668_100007349 | 323 |
| 309 | 3300025986 | Ga0207658_10004161 | Ga0207658_100041614 | 323 |
| 310 | 3300026023 | Ga0207677_10027711 | Ga0207677_100277114 | 323 |
| 311 | 3300026035 | Ga0207703_10001543 | Ga0207703_100015435 | 323 |
| 312 | 3300026041 | Ga0207639_10020595 | Ga0207639_100205955 | 323 |
| 313 | 3300026041 | Ga0207639_10063356 | Ga0207639_100633562 | 323 |
| 314 | 3300026088 | Ga0207641_10003343 | Ga0207641_100033436 | 323 |
| 315 | 3300026089 | Ga0207648_10025237 | Ga0207648_100252375 | 323 |
| 316 | 3300026095 | Ga0207676_10002561 | Ga0207676_100025612 | 323 |
| 317 | 3300026095 | Ga0207676_10183991 | Ga0207676_101839912 | 323 |
| 318 | 3300026118 | Ga0207675_100017319 | Ga0207675_1000173194 | 323 |
| 319 | 3300026142 | Ga0207698_10282656 | Ga0207698_102826561 | 323 |
| 320 | 3300028379 | Ga0268266_10022079 | Ga0268266_100220795 | 323 |
| 321 | 3300028381 | Ga0268264_10057305 | Ga0268264_100573053 | 323 |
| 322 | 3300031852 | Ga0307410_10302334 | Ga0307410_103023342 | 323 |
| 323 | 3300033180 | Ga0307510_10000058 | Ga0307510_100000585 | 323 |
| 324 | 3300035172 | Ga0373955_0056777 | Ga0373955_0056777_1119_2099 | 323 |
| 325 | 3300045976 | Ga0466967_0608670 | Ga0466967_0608670_85_1065 | 323 |
| 326 | 3300046459 | Ga0495629_0033164 | Ga0495629_0033164_2124_3104 | 323 |
| 327 | 3300046473 | Ga0495582_0113429 | Ga0495582_0113429_500_1480 | 323 |
| 328 | 3300046507 | Ga0495606_0002264 | Ga0495606_0002264_17811_18794 | 323 |
| 329 | 3300046517 | Ga0495630_0078985 | Ga0495630_0078985_65_1045 | 323 |
| 330 | 3300046683 | Ga0495658_0015221 | Ga0495658_0015221_1536_2516 | 323 |
| 331 | 3300046691 | Ga0495670_0065223 | Ga0495670_0065223_703_1689 | 323 |
| 332 | 3300049571 | Ga0501034_0000043 | Ga0501034_0000043_136028_137017 | 323 |
| 333 | 3300049571 | Ga0501034_0495966 | Ga0501034_0495966_67_1050 | 323 |
| 334 | 3300049589 | Ga0501073_0036657 | Ga0501073_0036657_1141_2124 | 323 |
| 335 | 3300049742 | Ga0501080_0243860 | Ga0501080_0243860_405_1388 | 323 |
| 336 | 3300049744 | Ga0501083_0056363 | Ga0501083_0056363_223_1206 | 323 |
| 337 | 3300054114 | Ga0501084_0109441 | Ga0501084_0109441_471_1454 | 323 |
| 338 | 3300005337 | Ga0070682_100066390 | Ga0070682_1000663902 | 324 |
| 339 | 3300005543 | Ga0070672_100166508 | Ga0070672_1001665082 | 324 |
| 340 | 3300005616 | Ga0068852_100323052 | Ga0068852_1003230522 | 324 |
| 341 | 3300013306 | Ga0163162_10015300 | Ga0163162_100153005 | 324 |
| 342 | 3300028381 | Ga0268264_10000866 | Ga0268264_1000086612 | 324 |
| 343 | 3300031251 | Ga0265327_10012487 | Ga0265327_100124877 | 324 |
| 344 | 3300041413 | Ga0439465_0011285 | Ga0439465_0011285_763_1755 | 324 |
| 345 | 3300042131 | Ga0450894_001231 | Ga0450894_001231_250_1230 | 324 |
| 346 | 3300042435 | Ga0439434_0010291 | Ga0439434_0010291_1004_1984 | 324 |
| 347 | 3300042876 | Ga0451577_0054485 | Ga0451577_0054485_94_1092 | 324 |
| 348 | 3300044712 | Ga0453684_0307987 | Ga0453684_0307987_81_1079 | 324 |
| 349 | 3300049661 | Ga0501217_014317 | Ga0501217_014317_200_1192 | 324 |
| 350 | 3300005356 | Ga0070674_100021668 | Ga0070674_1000216683 | 325 |
| 351 | 3300030521 | Ga0307511_10000362 | Ga0307511_1000036217 | 325 |
| 352 | 3300042876 | Ga0451577_0488022 | Ga0451577_0488022_14_1042 | 325 |
| 353 | 3300049571 | Ga0501034_0002711 | Ga0501034_0002711_13850_14842 | 325 |
| 354 | 3300049572 | Ga0501036_0041144 | Ga0501036_0041144_2148_3140 | 325 |
| 355 | 3300049574 | Ga0501038_0027763 | Ga0501038_0027763_2443_3435 | 325 |
| 356 | 3300049579 | Ga0501043_0002356 | Ga0501043_0002356_9049_10041 | 325 |
| 357 | 3300049580 | Ga0501046_0010797 | Ga0501046_0010797_5824_6816 | 325 |
| 358 | 3300049581 | Ga0501047_0002262 | Ga0501047_0002262_9225_10217 | 325 |
| 359 | 3300049586 | Ga0501070_0031283 | Ga0501070_0031283_3121_4113 | 325 |
| 360 | 3300049589 | Ga0501073_0000270 | Ga0501073_0000270_5113_6105 | 325 |
| 361 | 3300049590 | Ga0501074_0001640 | Ga0501074_0001640_5827_6819 | 325 |
| 362 | 3300049742 | Ga0501080_0007763 | Ga0501080_0007763_5419_6411 | 325 |
| 363 | 3300049744 | Ga0501083_0003740 | Ga0501083_0003740_323_1315 | 325 |
| 364 | 3300049822 | Ga0501035_0089090 | Ga0501035_0089090_433_1425 | 325 |
| 365 | 3300049823 | Ga0501044_0027639 | Ga0501044_0027639_2579_3571 | 325 |
| 366 | 3300003323 | rootH1_10025575 | rootH1_100255759 | 326 |
| 367 | 3300005331 | Ga0070670_100092053 | Ga0070670_1000920532 | 326 |
| 368 | 3300005334 | Ga0068869_100125533 | Ga0068869_1001255332 | 326 |
| 369 | 3300005335 | Ga0070666_10000405 | Ga0070666_1000040519 | 326 |
| 370 | 3300005338 | Ga0068868_100102378 | Ga0068868_1001023783 | 326 |
| 371 | 3300005355 | Ga0070671_100017197 | Ga0070671_1000171975 | 326 |
| 372 | 3300005356 | Ga0070674_100012087 | Ga0070674_1000120873 | 326 |
| 373 | 3300005364 | Ga0070673_100012679 | Ga0070673_1000126794 | 326 |
| 374 | 3300005364 | Ga0070673_100015158 | Ga0070673_1000151582 | 326 |
| 375 | 3300005364 | Ga0070673_100195709 | Ga0070673_1001957093 | 326 |
| 376 | 3300005367 | Ga0070667_100011370 | Ga0070667_1000113704 | 326 |
| 377 | 3300005539 | Ga0068853_100023126 | Ga0068853_1000231266 | 326 |
| 378 | 3300005539 | Ga0068853_100094426 | Ga0068853_1000944262 | 326 |
| 379 | 3300005543 | Ga0070672_100022329 | Ga0070672_1000223294 | 326 |
| 380 | 3300005544 | Ga0070686_100086818 | Ga0070686_1000868181 | 326 |
| 381 | 3300005563 | Ga0068855_100022169 | Ga0068855_1000221692 | 326 |
| 382 | 3300005564 | Ga0070664_100047357 | Ga0070664_1000473572 | 326 |
| 383 | 3300005577 | Ga0068857_100105370 | Ga0068857_1001053703 | 326 |
| 384 | 3300005578 | Ga0068854_100071268 | Ga0068854_1000712683 | 326 |
| 385 | 3300005617 | Ga0068859_100000066 | Ga0068859_10000006634 | 326 |
| 386 | 3300005617 | Ga0068859_100023655 | Ga0068859_1000236556 | 326 |
| 387 | 3300005617 | Ga0068859_100343515 | Ga0068859_1003435152 | 326 |
| 388 | 3300005618 | Ga0068864_100026626 | Ga0068864_1000266262 | 326 |
| 389 | 3300005841 | Ga0068863_100002306 | Ga0068863_10000230621 | 326 |
| 390 | 3300005841 | Ga0068863_100067294 | Ga0068863_1000672943 | 326 |
| 391 | 3300005841 | Ga0068863_100116363 | Ga0068863_1001163632 | 326 |
| 392 | 3300005842 | Ga0068858_100005353 | Ga0068858_1000053537 | 326 |
| 393 | 3300005843 | Ga0068860_100009960 | Ga0068860_1000099603 | 326 |
| 394 | 3300005843 | Ga0068860_100010524 | Ga0068860_1000105243 | 326 |
| 395 | 3300006195 | Ga0075366_10019005 | Ga0075366_100190053 | 326 |
| 396 | 3300006195 | Ga0075366_10182641 | Ga0075366_101826411 | 326 |
| 397 | 3300006237 | Ga0097621_100002282 | Ga0097621_1000022821 | 326 |
| 398 | 3300006358 | Ga0068871_100033404 | Ga0068871_1000334043 | 326 |
| 399 | 3300006358 | Ga0068871_100130943 | Ga0068871_1001309432 | 326 |
| 400 | 3300006931 | Ga0097620_100000066 | Ga0097620_10000006634 | 326 |
| 401 | 3300006931 | Ga0097620_100023655 | Ga0097620_1000236556 | 326 |
| 402 | 3300006931 | Ga0097620_100343485 | Ga0097620_1003434852 | 326 |
| 403 | 3300009093 | Ga0105240_10237462 | Ga0105240_102374622 | 326 |
| 404 | 3300009094 | Ga0111539_10541210 | Ga0111539_105412102 | 326 |
| 405 | 3300009174 | Ga0105241_10001740 | Ga0105241_1000174016 | 326 |
| 406 | 3300009174 | Ga0105241_10032525 | Ga0105241_100325253 | 326 |
| 407 | 3300009553 | Ga0105249_10038416 | Ga0105249_100384161 | 326 |
| 408 | 3300010375 | Ga0105239_10032240 | Ga0105239_100322404 | 326 |
| 409 | 3300013104 | Ga0157370_10011930 | Ga0157370_100119304 | 326 |
| 410 | 3300013296 | Ga0157374_10011352 | Ga0157374_100113524 | 326 |
| 411 | 3300013297 | Ga0157378_10002641 | Ga0157378_100026414 | 326 |
| 412 | 3300013297 | Ga0157378_10004255 | Ga0157378_100042558 | 326 |
| 413 | 3300013297 | Ga0157378_10012471 | Ga0157378_100124716 | 326 |
| 414 | 3300013297 | Ga0157378_10143486 | Ga0157378_101434862 | 326 |
| 415 | 3300013297 | Ga0157378_10198296 | Ga0157378_101982963 | 326 |
| 416 | 3300013306 | Ga0163162_10001227 | Ga0163162_100012279 | 326 |
| 417 | 3300013306 | Ga0163162_10029320 | Ga0163162_100293203 | 326 |
| 418 | 3300013308 | Ga0157375_10139479 | Ga0157375_101394792 | 326 |
| 419 | 3300013308 | Ga0157375_10207895 | Ga0157375_102078952 | 326 |
| 420 | 3300014745 | Ga0157377_10008432 | Ga0157377_100084323 | 326 |
| 421 | 3300014969 | Ga0157376_10289569 | Ga0157376_102895692 | 326 |
| 422 | 3300025246 | Ga0209646_1001651 | Ga0209646_10016514 | 326 |
| 423 | 3300025901 | Ga0207688_10107352 | Ga0207688_101073522 | 326 |
| 424 | 3300025903 | Ga0207680_10000143 | Ga0207680_100001433 | 326 |
| 425 | 3300025914 | Ga0207671_10001491 | Ga0207671_1000149125 | 326 |
| 426 | 3300025942 | Ga0207689_10004391 | Ga0207689_100043915 | 326 |
| 427 | 3300025942 | Ga0207689_10240742 | Ga0207689_102407422 | 326 |
| 428 | 3300025945 | Ga0207679_10085487 | Ga0207679_100854872 | 326 |
| 429 | 3300025949 | Ga0207667_10008543 | Ga0207667_100085437 | 326 |
| 430 | 3300025960 | Ga0207651_10084259 | Ga0207651_100842592 | 326 |
| 431 | 3300025961 | Ga0207712_10036731 | Ga0207712_100367312 | 326 |
| 432 | 3300026023 | Ga0207677_10002453 | Ga0207677_100024536 | 326 |
| 433 | 3300026023 | Ga0207677_10135086 | Ga0207677_101350862 | 326 |
| 434 | 3300026035 | Ga0207703_10050136 | Ga0207703_100501362 | 326 |
| 435 | 3300026035 | Ga0207703_10220099 | Ga0207703_102200992 | 326 |
| 436 | 3300026088 | Ga0207641_10000828 | Ga0207641_1000082826 | 326 |
| 437 | 3300026088 | Ga0207641_10015130 | Ga0207641_100151302 | 326 |
| 438 | 3300026095 | Ga0207676_10023138 | Ga0207676_100231383 | 326 |
| 439 | 3300026116 | Ga0207674_10067595 | Ga0207674_100675952 | 326 |
| 440 | 3300028381 | Ga0268264_10012315 | Ga0268264_100123156 | 326 |
| 441 | 3300028794 | Ga0307515_10000251 | Ga0307515_10000251106 | 326 |
| 442 | 3300031507 | Ga0307509_10174692 | Ga0307509_101746921 | 326 |
| 443 | 3300041404 | Ga0439436_0013792 | Ga0439436_0013792_94_1098 | 326 |
| 444 | 3300041512 | Ga0451853_3568257 | Ga0451853_3568257_185_1189 | 326 |
| 445 | 3300042014 | Ga0439457_001548 | Ga0439457_001548_1348_2352 | 326 |
| 446 | 3300042014 | Ga0439457_003006 | Ga0439457_003006_3558_4574 | 326 |
| 447 | 3300042015 | Ga0439462_0003568 | Ga0439462_0003568_1320_2324 | 326 |
| 448 | 3300044656 | Ga0466969_0000167 | Ga0466969_0000167_26934_27938 | 326 |
| 449 | 3300044658 | Ga0466972_0000064 | Ga0466972_0000064_43200_44213 | 326 |
| 450 | 3300044765 | Ga0466970_0002805 | Ga0466970_0002805_4694_5707 | 326 |
| 451 | 3300047320 | Ga0495672_0008108 | Ga0495672_0008108_2514_3509 | 326 |
| 452 | 3300047320 | Ga0495672_0048595 | Ga0495672_0048595_108_1136 | 326 |
| 453 | 3300049758 | Ga0501241_011063 | Ga0501241_011063_60_1073 | 326 |
| 454 | 3300049823 | Ga0501044_0008438 | Ga0501044_0008438_970_1974 | 326 |
| 455 | 3300050005 | Ga0501284_00093 | Ga0501284_00093_11608_12621 | 326 |
| 456 | 3300050493 | nmdc:mga0k408_37783_c1 | nmdc:mga0k408_37783_c1_715_1719 | 326 |
| 457 | 3300053086 | Ga0500578_0000066 | Ga0500578_0000066_14253_15257 | 326 |
| 458 | 3300053090 | Ga0500646_0027581 | Ga0500646_0027581_243_1247 | 326 |
| 459 | 3300053092 | Ga0500583_0000002 | Ga0500583_0000002_72340_73344 | 326 |
| 460 | 3300053147 | Ga0500589_037777 | Ga0500589_037777_39_1043 | 326 |
| 461 | 3300053156 | Ga0500622_0019511 | Ga0500622_0019511_982_1986 | 326 |
| 462 | 3300053727 | Ga0500611_000018 | Ga0500611_000018_16132_17142 | 326 |
| 463 | 3300003320 | rootH2_10085841 | rootH2_100858412 | 327 |
| 464 | 3300003323 | rootH1_10248611 | rootH1_102486112 | 327 |
| 465 | 3300005289 | Ga0065704_10143018 | Ga0065704_101430182 | 327 |
| 466 | 3300005290 | Ga0065712_10073956 | Ga0065712_100739562 | 327 |
| 467 | 3300005334 | Ga0068869_100196651 | Ga0068869_1001966511 | 327 |
| 468 | 3300005340 | Ga0070689_100002169 | Ga0070689_1000021692 | 327 |
| 469 | 3300005354 | Ga0070675_100037287 | Ga0070675_1000372872 | 327 |
| 470 | 3300005364 | Ga0070673_100033648 | Ga0070673_1000336482 | 327 |
| 471 | 3300005458 | Ga0070681_10032305 | Ga0070681_100323055 | 327 |
| 472 | 3300005459 | Ga0068867_100042570 | Ga0068867_1000425702 | 327 |
| 473 | 3300005577 | Ga0068857_100058034 | Ga0068857_1000580343 | 327 |
| 474 | 3300005617 | Ga0068859_100006157 | Ga0068859_10000615711 | 327 |
| 475 | 3300005719 | Ga0068861_100002110 | Ga0068861_1000021104 | 327 |
| 476 | 3300005841 | Ga0068863_100510490 | Ga0068863_1005104901 | 327 |
| 477 | 3300006931 | Ga0097620_100006157 | Ga0097620_10000615711 | 327 |
| 478 | 3300009094 | Ga0111539_10008819 | Ga0111539_100088193 | 327 |
| 479 | 3300009174 | Ga0105241_10117716 | Ga0105241_101177162 | 327 |
| 480 | 3300009545 | Ga0105237_10000169 | Ga0105237_1000016933 | 327 |
| 481 | 3300009545 | Ga0105237_10200501 | Ga0105237_102005011 | 327 |
| 482 | 3300010375 | Ga0105239_10246516 | Ga0105239_102465162 | 327 |
| 483 | 3300013306 | Ga0163162_10382662 | Ga0163162_103826621 | 327 |
| 484 | 3300013307 | Ga0157372_10128787 | Ga0157372_101287872 | 327 |
| 485 | 3300013308 | Ga0157375_10327314 | Ga0157375_103273142 | 327 |
| 486 | 3300014326 | Ga0157380_10001158 | Ga0157380_100011585 | 327 |
| 487 | 3300014745 | Ga0157377_10001217 | Ga0157377_1000121710 | 327 |
| 488 | 3300025302 | Ga0207426_1000105 | Ga0207426_1000105124 | 327 |
| 489 | 3300025911 | Ga0207654_10080442 | Ga0207654_100804422 | 327 |
| 490 | 3300025912 | Ga0207707_10111459 | Ga0207707_101114593 | 327 |
| 491 | 3300025914 | Ga0207671_10001328 | Ga0207671_1000132818 | 327 |
| 492 | 3300025923 | Ga0207681_10020044 | Ga0207681_100200442 | 327 |
| 493 | 3300025942 | Ga0207689_10312361 | Ga0207689_103123612 | 327 |
| 494 | 3300025960 | Ga0207651_10033933 | Ga0207651_100339332 | 327 |
| 495 | 3300026089 | Ga0207648_10030283 | Ga0207648_100302833 | 327 |
| 496 | 3300026116 | Ga0207674_10008311 | Ga0207674_100083112 | 327 |
| 497 | 3300026118 | Ga0207675_100015799 | Ga0207675_1000157992 | 327 |
| 498 | 3300027907 | Ga0207428_10116255 | Ga0207428_101162552 | 327 |
| 499 | 3300047320 | Ga0495672_0062390 | Ga0495672_0062390_797_1813 | 327 |
| 500 | 3300003203 | JGI25406J46586_10001920 | JGI25406J46586_100019206 | 328 |
| 501 | 3300003322 | rootL2_10063902 | rootL2_100639022 | 328 |
| 502 | 3300003322 | rootL2_10274444 | rootL2_102744443 | 328 |
| 503 | 3300005334 | Ga0068869_100040799 | Ga0068869_1000407994 | 328 |
| 504 | 3300005985 | Ga0081539_10002362 | Ga0081539_1000236220 | 328 |
| 505 | 3300009176 | Ga0105242_10004602 | Ga0105242_100046023 | 328 |
| 506 | 3300013297 | Ga0157378_10059536 | Ga0157378_100595362 | 328 |
| 507 | 3300025925 | Ga0207650_10101272 | Ga0207650_101012723 | 328 |
| 508 | 3300025934 | Ga0207686_10028394 | Ga0207686_100283943 | 328 |
| 509 | 3300025940 | Ga0207691_10284335 | Ga0207691_102843351 | 328 |
| 510 | 3300025942 | Ga0207689_10021194 | Ga0207689_100211943 | 328 |
| 511 | 3300025961 | Ga0207712_10105168 | Ga0207712_101051682 | 328 |
| 512 | 3300028381 | Ga0268264_10428338 | Ga0268264_104283382 | 328 |
| 513 | 3300031730 | Ga0307516_10001001 | Ga0307516_1000100121 | 328 |
| 514 | 3300005340 | Ga0070689_100002275 | Ga0070689_1000022755 | 329 |
| 515 | 3300005355 | Ga0070671_100175604 | Ga0070671_1001756042 | 329 |
| 516 | 3300005367 | Ga0070667_100022399 | Ga0070667_1000223993 | 329 |
| 517 | 3300005457 | Ga0070662_100016841 | Ga0070662_1000168414 | 329 |
| 518 | 3300005535 | Ga0070684_100036422 | Ga0070684_1000364223 | 329 |
| 519 | 3300005548 | Ga0070665_100000074 | Ga0070665_100000074102 | 329 |
| 520 | 3300005563 | Ga0068855_100029855 | Ga0068855_1000298557 | 329 |
| 521 | 3300005564 | Ga0070664_100140282 | Ga0070664_1001402823 | 329 |
| 522 | 3300005577 | Ga0068857_100005191 | Ga0068857_10000519110 | 329 |
| 523 | 3300005616 | Ga0068852_100001872 | Ga0068852_1000018722 | 329 |
| 524 | 3300005616 | Ga0068852_100046829 | Ga0068852_1000468293 | 329 |
| 525 | 3300005841 | Ga0068863_100214721 | Ga0068863_1002147212 | 329 |
| 526 | 3300005841 | Ga0068863_100278630 | Ga0068863_1002786302 | 329 |
| 527 | 3300005842 | Ga0068858_100174583 | Ga0068858_1001745832 | 329 |
| 528 | 3300005843 | Ga0068860_100000110 | Ga0068860_10000011058 | 329 |
| 529 | 3300009093 | Ga0105240_10019282 | Ga0105240_100192826 | 329 |
| 530 | 3300009093 | Ga0105240_10043036 | Ga0105240_100430366 | 329 |
| 531 | 3300009174 | Ga0105241_10060412 | Ga0105241_100604122 | 329 |
| 532 | 3300009174 | Ga0105241_10189856 | Ga0105241_101898562 | 329 |
| 533 | 3300009176 | Ga0105242_10046232 | Ga0105242_100462321 | 329 |
| 534 | 3300009551 | Ga0105238_10036705 | Ga0105238_100367051 | 329 |
| 535 | 3300009553 | Ga0105249_10010825 | Ga0105249_100108253 | 329 |
| 536 | 3300013100 | Ga0157373_10132151 | Ga0157373_101321513 | 329 |
| 537 | 3300013104 | Ga0157370_10010246 | Ga0157370_100102467 | 329 |
| 538 | 3300013105 | Ga0157369_10066016 | Ga0157369_100660164 | 329 |
| 539 | 3300013297 | Ga0157378_10349068 | Ga0157378_103490681 | 329 |
| 540 | 3300013306 | Ga0163162_10001109 | Ga0163162_1000110927 | 329 |
| 541 | 3300013307 | Ga0157372_10002664 | Ga0157372_100026649 | 329 |
| 542 | 3300025904 | Ga0207647_10048330 | Ga0207647_100483302 | 329 |
| 543 | 3300025913 | Ga0207695_10182395 | Ga0207695_101823953 | 329 |
| 544 | 3300025913 | Ga0207695_10460267 | Ga0207695_104602671 | 329 |
| 545 | 3300025924 | Ga0207694_10046286 | Ga0207694_100462863 | 329 |
| 546 | 3300025933 | Ga0207706_10030551 | Ga0207706_100305513 | 329 |
| 547 | 3300025936 | Ga0207670_10004881 | Ga0207670_100048817 | 329 |
| 548 | 3300025942 | Ga0207689_10024214 | Ga0207689_100242144 | 329 |
| 549 | 3300025945 | Ga0207679_10063691 | Ga0207679_100636912 | 329 |
| 550 | 3300025949 | Ga0207667_10001687 | Ga0207667_1000168714 | 329 |
| 551 | 3300025961 | Ga0207712_10009397 | Ga0207712_100093977 | 329 |
| 552 | 3300026089 | Ga0207648_10019402 | Ga0207648_100194023 | 329 |
| 553 | 3300026116 | Ga0207674_10006251 | Ga0207674_100062512 | 329 |
| 554 | 3300026142 | Ga0207698_10207945 | Ga0207698_102079452 | 329 |
| 555 | 3300026142 | Ga0207698_10246023 | Ga0207698_102460232 | 329 |
| 556 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010726 | 329 |
| 557 | 3300028381 | Ga0268264_10000052 | Ga0268264_1000005260 | 329 |
| 558 | 3300044658 | Ga0466972_0001783 | Ga0466972_0001783_873_1910 | 329 |
| 559 | 3300047443 | Ga0495687_000039 | Ga0495687_000039_76435_77463 | 329 |
| 560 | 3300048917 | Ga0496114_0000295 | Ga0496114_0000295_7242_8294 | 329 |
| 561 | 3300049652 | Ga0501202_004331 | Ga0501202_004331_188_1234 | 329 |
| 562 | 3300049662 | Ga0501222_002004 | Ga0501222_002004_1249_2295 | 329 |
| 563 | 3300049688 | Ga0501259_000246 | Ga0501259_000246_3594_4640 | 329 |
| 564 | 3300049690 | Ga0501261_003555 | Ga0501261_003555_281_1327 | 329 |
| 565 | 3300049704 | Ga0501221_001021 | Ga0501221_001021_1844_2890 | 329 |
| 566 | 3300049705 | Ga0501225_0014361 | Ga0501225_0014361_541_1587 | 329 |
| 567 | 3300049707 | Ga0501234_001182 | Ga0501234_001182_2383_3429 | 329 |
| 568 | 3300005334 | Ga0068869_100139840 | Ga0068869_1001398402 | 330 |
| 569 | 3300005356 | Ga0070674_100081456 | Ga0070674_1000814562 | 330 |
| 570 | 3300005367 | Ga0070667_100062228 | Ga0070667_1000622282 | 330 |
| 571 | 3300005466 | Ga0070685_10238468 | Ga0070685_102384681 | 330 |
| 572 | 3300005617 | Ga0068859_100073625 | Ga0068859_1000736252 | 330 |
| 573 | 3300005843 | Ga0068860_100191429 | Ga0068860_1001914292 | 330 |
| 574 | 3300006844 | Ga0075428_100025432 | Ga0075428_1000254327 | 330 |
| 575 | 3300006844 | Ga0075428_100263981 | Ga0075428_1002639812 | 330 |
| 576 | 3300006846 | Ga0075430_100005928 | Ga0075430_10000592811 | 330 |
| 577 | 3300006931 | Ga0097620_100073628 | Ga0097620_1000736284 | 330 |
| 578 | 3300009101 | Ga0105247_10001631 | Ga0105247_100016316 | 330 |
| 579 | 3300009553 | Ga0105249_10063605 | Ga0105249_100636052 | 330 |
| 580 | 3300014325 | Ga0163163_10073305 | Ga0163163_100733054 | 330 |
| 581 | 3300025942 | Ga0207689_10002405 | Ga0207689_100024057 | 330 |
| 582 | 3300025961 | Ga0207712_10037461 | Ga0207712_100374612 | 330 |
| 583 | 3300050508 | nmdc:mga09592_175977_c1 | nmdc:mga09592_175977_c1_522_1532 | 330 |
| 584 | 3300050509 | nmdc:mga0qj67_7913_c1 | nmdc:mga0qj67_7913_c1_4703_5716 | 330 |
| 585 | 3300050510 | nmdc:mga06r32_12289_c1 | nmdc:mga06r32_12289_c1_6551_7564 | 330 |
| 586 | 3300053139 | Ga0500568_0000610 | Ga0500568_0000610_5014_6039 | 331 |
| 587 | 3300002459 | JGI24751J29686_10000673 | JGI24751J29686_100006732 | 332 |
| 588 | 3300003323 | rootH1_10299774 | rootH1_102997742 | 332 |
| 589 | 3300005328 | Ga0070676_10006732 | Ga0070676_100067323 | 332 |
| 590 | 3300005331 | Ga0070670_100025151 | Ga0070670_1000251513 | 332 |
| 591 | 3300005334 | Ga0068869_100200978 | Ga0068869_1002009782 | 332 |
| 592 | 3300005347 | Ga0070668_100113840 | Ga0070668_1001138402 | 332 |
| 593 | 3300005356 | Ga0070674_100121882 | Ga0070674_1001218822 | 332 |
| 594 | 3300005364 | Ga0070673_100141987 | Ga0070673_1001419872 | 332 |
| 595 | 3300005459 | Ga0068867_100082585 | Ga0068867_1000825852 | 332 |
| 596 | 3300005471 | Ga0070698_100040258 | Ga0070698_1000402582 | 332 |
| 597 | 3300005543 | Ga0070672_100080005 | Ga0070672_1000800052 | 332 |
| 598 | 3300005617 | Ga0068859_100115010 | Ga0068859_1001150103 | 332 |
| 599 | 3300005618 | Ga0068864_100054843 | Ga0068864_1000548433 | 332 |
| 600 | 3300005840 | Ga0068870_10030009 | Ga0068870_100300092 | 332 |
| 601 | 3300005841 | Ga0068863_100021215 | Ga0068863_1000212154 | 332 |
| 602 | 3300005841 | Ga0068863_100077385 | Ga0068863_1000773854 | 332 |
| 603 | 3300005841 | Ga0068863_100194998 | Ga0068863_1001949982 | 332 |
| 604 | 3300005843 | Ga0068860_100212937 | Ga0068860_1002129372 | 332 |
| 605 | 3300006237 | Ga0097621_100044926 | Ga0097621_1000449262 | 332 |
| 606 | 3300006358 | Ga0068871_100133860 | Ga0068871_1001338602 | 332 |
| 607 | 3300006880 | Ga0075429_100173479 | Ga0075429_1001734792 | 332 |
| 608 | 3300006881 | Ga0068865_100012717 | Ga0068865_1000127172 | 332 |
| 609 | 3300006931 | Ga0097620_100115012 | Ga0097620_1001150123 | 332 |
| 610 | 3300009176 | Ga0105242_10015317 | Ga0105242_100153176 | 332 |
| 611 | 3300013296 | Ga0157374_10174420 | Ga0157374_101744202 | 332 |
| 612 | 3300013306 | Ga0163162_10265357 | Ga0163162_102653572 | 332 |
| 613 | 3300014325 | Ga0163163_10014392 | Ga0163163_100143922 | 332 |
| 614 | 3300014969 | Ga0157376_10004908 | Ga0157376_100049082 | 332 |
| 615 | 3300025901 | Ga0207688_10170651 | Ga0207688_101706512 | 332 |
| 616 | 3300025903 | Ga0207680_10051997 | Ga0207680_100519972 | 332 |
| 617 | 3300025907 | Ga0207645_10000511 | Ga0207645_1000051116 | 332 |
| 618 | 3300025934 | Ga0207686_10001248 | Ga0207686_100012486 | 332 |
| 619 | 3300025942 | Ga0207689_10015655 | Ga0207689_100156557 | 332 |
| 620 | 3300026041 | Ga0207639_10037592 | Ga0207639_100375922 | 332 |
| 621 | 3300026075 | Ga0207708_10321406 | Ga0207708_103214062 | 332 |
| 622 | 3300026088 | Ga0207641_10000418 | Ga0207641_1000041836 | 332 |
| 623 | 3300026088 | Ga0207641_10023076 | Ga0207641_100230764 | 332 |
| 624 | 3300026088 | Ga0207641_10153109 | Ga0207641_101531092 | 332 |
| 625 | 3300026095 | Ga0207676_10065030 | Ga0207676_100650303 | 332 |
| 626 | 3300026121 | Ga0207683_10005675 | Ga0207683_100056755 | 332 |
| 627 | 3300047321 | Ga0495676_0053899 | Ga0495676_0053899_233_1246 | 332 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tts-assembly1.cif.gz_A | crystal structure of beta-galactosidase from bacillus circulans sp. alkalophilus | 0.7634 | 164 | 191 |
| 4ucf-assembly1.cif.gz_B | crystal structure of bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose | 0.6968 | 164 | 201 |
| 5e9a-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6842 | 164 | 191 |
| 2hsj-assembly1.cif.gz_D | the structure of a putative platelet activating factor from streptococcus pneumonia. | 0.6645 | 20 | 265 |
| 3dt9-assembly1.cif.gz_A | crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by soman | 0.657 | 18 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ii1A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9094 | 162 | 188 | 3.20.20.80 |
| af_Q9W2H8_565_770_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8546 | 167 | 192 | 3.20.20.80 |
| 4uoqB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8018 | 164 | 191 | 3.20.20.80 |
| 1bs9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7903 | 164 | 191 | 3.40.50.1820 |
| af_Q4V7D9_65_396_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6952 | 162 | 193 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5SXE8-F1-model_v4 | GSCFA family protein | 0.982 | 1 | 326 |
|
| AF-A0A3D6CBX4-F1-model_v4 | GSCFA domain-containing protein | 0.9802 | 1 | 289 |
|
| AF-A0A3C0IUB8-F1-model_v4 | GSCFA domain-containing protein | 0.9792 | 23 | 296 |
|
| AF-X1UA47-F1-model_v4 | GSCFA domain-containing protein | 0.9782 | 24 | 257 |
|
| AF-A0A4V2AXL4-F1-model_v4 | GSCFA domain-containing protein | 0.9779 | 1 | 328 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar