F470439

General Info

Members Datasets Scaffolds Average Seq Length
626 293 1252 155

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100149419|Ga0070698_1001494191
Length 174
Sequence MVQWSTSRGCCVCVVSSVSVQNLKEGSMASDIFAKIGDIKGESLDDKHKDEIELLSFSWGVTNTKATFQDLSIVHKIDKASPLLMRACATGTHLKEATITHRKAGKDQQGYLIVKMNDIIITGVTDGDASGQAGSETVSLAFAKIDLEYKPQKADGSLDTGIHFKYDLKANKEG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
208 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
209 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
210 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
211 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 4.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.31
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100149419 3300005471 Bacteria 2284
2 Ga0006759J45824_1048008 3300003163 Bacteria 1759
3 Ga0006770J48903_1038478 3300003305 Bacteria 1743
4 Ga0006770J48903_1048694 3300003305 Bacteria 836
5 Ga0007417J51691_1035169 3300003544 Bacteria 1596
6 Ga0007417J51691_1038443 3300003544 Bacteria 938
7 Ga0007410J51695_1034363 3300003574 Bacteria 1200
8 Ga0007410J51695_1034818 3300003574 Bacteria 1741
9 Ga0007410J51695_1087691 3300003574 Bacteria 1257
10 Ga0007410J51695_1087692 3300003574 Bacteria 1022
11 Ga0007410J51695_1090899 3300003574 Bacteria 875
12 Ga0007409J51694_1025113 3300003575 Bacteria 1580
13 Ga0007409J51694_1026055 3300003575 Bacteria 1537
14 Ga0007409J51694_1032282 3300003575 Bacteria 1841
15 Ga0007416J51690_1027157 3300003577 Bacteria 1551
16 Ga0007416J51690_1033067 3300003577 Bacteria 1305
17 Ga0032354_1059829 3300003693 Bacteria 766
18 Ga0032354_1067914 3300003693 Bacteria 1833
19 Ga0032354_1073346 3300003693 Bacteria 1028
20 Ga0058859_10015082 3300004798 Bacteria 1109
21 Ga0058859_11607011 3300004798 Bacteria 794
22 Ga0058860_12046477 3300004801 Unclassified 759
23 Ga0058860_12189749 3300004801 Unclassified 1016
24 Ga0058862_12278606 3300004803 Unclassified 578
25 Ga0065704_10439696 3300005289 Bacteria 715
26 Ga0065712_10089842 3300005290 Bacteria 2451
27 Ga0065715_10000567 3300005293 Bacteria 11006
28 Ga0065715_10020705 3300005293 Bacteria 2377
29 Ga0065715_10107774 3300005293 Bacteria 2753
30 Ga0065715_10140184 3300005293 Bacteria 1866
31 Ga0065715_10222302 3300005293 Bacteria 1267
32 Ga0065707_10128601 3300005295 Bacteria 1958
33 Ga0065707_10243139 3300005295 Bacteria 1149
34 Ga0070683_100000387 3300005329 Bacteria 30469
35 Ga0070683_100036430 3300005329 Bacteria 4501
36 Ga0070690_100247031 3300005330 Bacteria 1261
37 Ga0070690_100280580 3300005330 Unclassified 1188
38 Ga0070670_100002891 3300005331 Bacteria 14215
39 Ga0070670_100032038 3300005331 Bacteria 4526
40 Ga0070670_100099668 3300005331 Bacteria 2500
41 Ga0070677_10021614 3300005333 Bacteria 2363
42 Ga0070677_10187243 3300005333 Bacteria 990
43 Ga0070666_10019437 3300005335 Bacteria 4385
44 Ga0070666_10286692 3300005335 Unclassified 1171
45 Ga0070682_100012081 3300005337 Unclassified 4942
46 Ga0070682_100031516 3300005337 Bacteria 3207
47 Ga0068868_101831376 3300005338 Bacteria 574
48 Ga0070660_100105986 3300005339 Bacteria 2232
49 Ga0070689_100004232 3300005340 Bacteria 9673
50 Ga0070689_100101380 3300005340 Bacteria 2279
51 Ga0070689_100812182 3300005340 Bacteria 823
52 Ga0070691_10070990 3300005341 Unclassified 1690
53 Ga0070687_100028821 3300005343 Bacteria 2696
54 Ga0070687_100263903 3300005343 Bacteria 1076
55 Ga0070661_100047937 3300005344 Bacteria 3127
56 Ga0070661_101187683 3300005344 Bacteria 638
57 Ga0070668_100146089 3300005347 Bacteria 1909
58 Ga0070669_100000810 3300005353 Bacteria 22749
59 Ga0070669_100128219 3300005353 Bacteria 1943
60 Ga0070669_101568788 3300005353 Bacteria 573
61 Ga0070675_100000420 3300005354 Bacteria 28958
62 Ga0070675_100081989 3300005354 Bacteria 2691
63 Ga0070675_100748623 3300005354 Bacteria 892
64 Ga0070675_100794307 3300005354 Bacteria 865
65 Ga0070675_100795132 3300005354 Bacteria 864
66 Ga0070675_101022436 3300005354 Bacteria 759
67 Ga0070675_101321909 3300005354 Bacteria 664
68 Ga0070671_100032811 3300005355 Bacteria 4292
69 Ga0070671_100072121 3300005355 Bacteria 2883
70 Ga0070671_100212485 3300005355 Bacteria 1641
71 Ga0070671_100914027 3300005355 Bacteria 767
72 Ga0070674_100483776 3300005356 Bacteria 1028
73 Ga0070674_100703298 3300005356 Bacteria 864
74 Ga0070673_100301968 3300005364 Bacteria 1410
75 Ga0070673_100461484 3300005364 Bacteria 1144
76 Ga0070673_100535918 3300005364 Bacteria 1062
77 Ga0070673_101383972 3300005364 Bacteria 662
78 Ga0070688_100008399 3300005365 Bacteria 5603
79 Ga0070688_100105234 3300005365 Bacteria 1867
80 Ga0070667_100129085 3300005367 Unclassified 2205
81 Ga0070667_100766292 3300005367 Bacteria 895
82 Ga0070709_10832414 3300005434 Unclassified 726
83 Ga0070709_11098959 3300005434 Bacteria 636
84 Ga0070714_101126431 3300005435 Unclassified 765
85 Ga0070713_100391911 3300005436 Bacteria 1296
86 Ga0070713_101293629 3300005436 Bacteria 706
87 Ga0070711_100003017 3300005439 Bacteria 9731
88 Ga0070711_100095708 3300005439 Bacteria 2149
89 Ga0070705_100096615 3300005440 Bacteria 1855
90 Ga0070700_100019727 3300005441 Bacteria 3895
91 Ga0070700_100802496 3300005441 Bacteria 758
92 Ga0070694_100386227 3300005444 Bacteria 1093
93 Ga0070694_100532130 3300005444 Unclassified 939
94 Ga0070708_100022009 3300005445 Bacteria 5403
95 Ga0070708_100482100 3300005445 Bacteria 1170
96 Ga0070678_100001272 3300005456 Bacteria 13364
97 Ga0070678_100059551 3300005456 Bacteria 2807
98 Ga0070678_100394176 3300005456 Bacteria 1201
99 Ga0070678_101288200 3300005456 Bacteria 680
100 Ga0070662_100111900 3300005457 Bacteria 2081
101 Ga0070662_101011124 3300005457 Bacteria 712
102 Ga0070681_10036083 3300005458 Bacteria 4966
103 Ga0070681_10472872 3300005458 Bacteria 1166
104 Ga0068867_100203173 3300005459 Bacteria 1587
105 Ga0068867_101164580 3300005459 Bacteria 707
106 Ga0070685_10164672 3300005466 Bacteria 1416
107 Ga0070706_100052469 3300005467 Bacteria 3763
108 Ga0070706_100917248 3300005467 Bacteria 809
109 Ga0070707_100055490 3300005468 Bacteria 3798
110 Ga0070698_101044680 3300005471 Bacteria 765
111 Ga0070699_100008961 3300005518 Bacteria 8670
112 Ga0070699_100077473 3300005518 Bacteria 2894
113 Ga0070679_100002810 3300005530 Bacteria 15819
114 Ga0070679_100226828 3300005530 Bacteria 1828
115 Ga0070679_100346655 3300005530 Bacteria 1433
116 Ga0070684_100000221 3300005535 Bacteria 39898
117 Ga0070684_100001001 3300005535 Bacteria 20112
118 Ga0070684_100118201 3300005535 Bacteria 2382
119 Ga0070684_100780173 3300005535 Bacteria 893
120 Ga0070697_100054136 3300005536 Bacteria 3261
121 Ga0068853_100504299 3300005539 Bacteria 1143
122 Ga0070672_100173723 3300005543 Bacteria 1793
123 Ga0070686_100009335 3300005544 Bacteria 5511
124 Ga0070695_100283540 3300005545 Unclassified 1218
125 Ga0070695_101334229 3300005545 Unclassified 593
126 Ga0070696_100091211 3300005546 Bacteria 2169
127 Ga0070693_100002648 3300005547 Bacteria 8244
128 Ga0070665_100336867 3300005548 Bacteria 1513
129 Ga0070704_100068116 3300005549 Unclassified 2573
130 Ga0070704_100551548 3300005549 Bacteria 1007
131 Ga0068855_101599484 3300005563 Bacteria 667
132 Ga0070664_100001047 3300005564 Bacteria 21733
133 Ga0070664_100222132 3300005564 Bacteria 1690
134 Ga0070664_100315229 3300005564 Bacteria 1416
135 Ga0068857_100012736 3300005577 Bacteria 7329
136 Ga0068857_100575047 3300005577 Unclassified 1063
137 Ga0068854_100098429 3300005578 Bacteria 2189
138 Ga0068854_101045688 3300005578 Bacteria 725
139 Ga0068856_100022134 3300005614 Bacteria 6180
140 Ga0070702_100003217 3300005615 Bacteria 7262
141 Ga0070702_100104354 3300005615 Bacteria 1745
142 Ga0070702_100263804 3300005615 Bacteria 1174
143 Ga0068859_100008674 3300005617 Bacteria 10275
144 Ga0068859_100272414 3300005617 Bacteria 1785
145 Ga0068859_101733541 3300005617 Unclassified 690
146 Ga0068864_100097809 3300005618 Bacteria 2599
147 Ga0068864_100416846 3300005618 Bacteria 1279
148 Ga0068864_100479432 3300005618 Bacteria 1194
149 Ga0068866_10009424 3300005718 Bacteria 4146
150 Ga0068861_100036162 3300005719 Bacteria 3663
151 Ga0068870_10073899 3300005840 Bacteria 1866
152 Ga0068858_100028600 3300005842 Bacteria 5177
153 Ga0068858_100086763 3300005842 Bacteria 2911
154 Ga0068858_100865100 3300005842 Bacteria 883
155 Ga0068860_100063330 3300005843 Bacteria 3513
156 Ga0068860_101187928 3300005843 Unclassified 783
157 Ga0068862_100594613 3300005844 Bacteria 1061
158 Ga0068862_100797276 3300005844 Bacteria 922
159 Ga0068862_101287466 3300005844 Bacteria 732
160 Ga0081455_10050918 3300005937 Bacteria 3556
161 Ga0081455_10067271 3300005937 Bacteria 2986
162 Ga0081455_10406872 3300005937 Bacteria 942
163 Ga0081455_10533200 3300005937 Unclassified 780
164 Ga0070717_10014685 3300006028 Bacteria 6026
165 Ga0070717_10096935 3300006028 Bacteria 2498
166 Ga0070717_10141296 3300006028 Bacteria 2077
167 Ga0070715_10126766 3300006163 Bacteria 1224
168 Ga0070716_100022902 3300006173 Bacteria 3306
169 Ga0070716_100623563 3300006173 Bacteria 814
170 Ga0070716_100649508 3300006173 Unclassified 800
171 Ga0070712_100006611 3300006175 Bacteria 7205
172 Ga0070712_100181908 3300006175 Bacteria 1639
173 Ga0070712_100325833 3300006175 Bacteria 1250
174 Ga0070712_100530575 3300006175 Bacteria 990
175 Ga0075427_10051690 3300006194 Bacteria 708
176 Ga0075427_10081606 3300006194 Unclassified 585
177 Ga0097621_100055828 3300006237 Bacteria 3226
178 Ga0097621_101163528 3300006237 Bacteria 726
179 Ga0097621_101304460 3300006237 Bacteria 686
180 Ga0068871_100006757 3300006358 Bacteria 8148
181 Ga0068871_100135410 3300006358 Bacteria 2092
182 Ga0068871_100141108 3300006358 Bacteria 2049
183 Ga0068871_100187750 3300006358 Bacteria 1779
184 Ga0068871_100526498 3300006358 Bacteria 1068
185 Ga0068871_100547370 3300006358 Bacteria 1048
186 Ga0068871_100805477 3300006358 Unclassified 866
187 Ga0075428_100080323 3300006844 Bacteria 3559
188 Ga0075428_100152383 3300006844 Bacteria 2511
189 Ga0075428_100221779 3300006844 Bacteria 2041
190 Ga0075428_101022195 3300006844 Bacteria 874
191 Ga0075430_100004027 3300006846 Bacteria 12394
192 Ga0075430_100053822 3300006846 Bacteria 3388
193 Ga0075430_100790078 3300006846 Unclassified 782
194 Ga0075430_101106700 3300006846 Bacteria 652
195 Ga0075431_100017211 3300006847 Bacteria 7345
196 Ga0075431_100084490 3300006847 Bacteria 3277
197 Ga0075431_100550721 3300006847 Bacteria 1141
198 Ga0075431_100810757 3300006847 Bacteria 909
199 Ga0075433_10009142 3300006852 Bacteria 7912
200 Ga0075433_10115746 3300006852 Bacteria 2379
201 Ga0075433_10161088 3300006852 Bacteria 1997
202 Ga0075433_10200684 3300006852 Unclassified 1773
203 Ga0075433_10398978 3300006852 Unclassified 1213
204 Ga0075434_100060958 3300006871 Bacteria 3753
205 Ga0075434_100108516 3300006871 Bacteria 2786
206 Ga0075434_101219871 3300006871 Unclassified 764
207 Ga0075429_100060784 3300006880 Bacteria 3290
208 Ga0075429_100317669 3300006880 Bacteria 1363
209 Ga0075429_101296940 3300006880 Bacteria 635
210 Ga0068865_100115529 3300006881 Bacteria 1986
211 Ga0068865_101058714 3300006881 Bacteria 713
212 Ga0075436_100000215 3300006914 Bacteria 35586
213 Ga0097620_100008673 3300006931 Bacteria 10275
214 Ga0097620_100272410 3300006931 Bacteria 1785
215 Ga0097620_101733647 3300006931 Unclassified 690
216 Ga0075435_100024359 3300007076 Bacteria 4696
217 Ga0075435_100091471 3300007076 Bacteria 2511
218 Ga0075435_100116199 3300007076 Bacteria 2228
219 Ga0075435_100223635 3300007076 Bacteria 1599
220 Ga0099794_10031551 3300007265 Bacteria 2482
221 Ga0099795_10108631 3300007788 Bacteria 1097
222 Ga0099795_10221254 3300007788 Bacteria 806
223 Ga0105240_10063256 3300009093 Unclassified 4604
224 Ga0111539_10007570 3300009094 Bacteria 13881
225 Ga0111539_10056192 3300009094 Bacteria 4679
226 Ga0111539_10404118 3300009094 Bacteria 1591
227 Ga0111539_10632130 3300009094 Bacteria 1246
228 Ga0111539_10906529 3300009094 Bacteria 1025
229 Ga0111539_10942545 3300009094 Bacteria 1004
230 Ga0105245_10045161 3300009098 Bacteria 3934
231 Ga0105245_10372261 3300009098 Bacteria 1420
232 Ga0105247_10075286 3300009101 Bacteria 2118
233 Ga0105247_10842820 3300009101 Bacteria 703
234 Ga0114129_10001078 3300009147 Bacteria 35880
235 Ga0114129_10003230 3300009147 Bacteria 22875
236 Ga0114129_10059645 3300009147 Bacteria 5334
237 Ga0114129_10242694 3300009147 Bacteria 2421
238 Ga0114129_10332440 3300009147 Bacteria 2017
239 Ga0114129_10656617 3300009147 Bacteria 1353
240 Ga0114129_10863796 3300009147 Bacteria 1149
241 Ga0105243_10022543 3300009148 Bacteria 4787
242 Ga0105243_10418493 3300009148 Bacteria 1249
243 Ga0105241_10075860 3300009174 Bacteria 2620
244 Ga0105241_10077118 3300009174 Bacteria 2601
245 Ga0105241_10437641 3300009174 Bacteria 1154
246 Ga0105242_10079873 3300009176 Bacteria 2732
247 Ga0105242_10188157 3300009176 Bacteria 1826
248 Ga0105242_10222581 3300009176 Bacteria 1687
249 Ga0105242_10574536 3300009176 Bacteria 1085
250 Ga0105242_10957294 3300009176 Bacteria 861
251 Ga0105242_10996465 3300009176 Bacteria 845
252 Ga0105242_11770166 3300009176 Bacteria 656
253 Ga0105248_10007999 3300009177 Bacteria 11613
254 Ga0105248_10022095 3300009177 Bacteria 7050
255 Ga0105248_10243181 3300009177 Bacteria 2026
256 Ga0105248_10332563 3300009177 Bacteria 1711
257 Ga0105238_10065734 3300009551 Bacteria 3628
258 Ga0105238_10097055 3300009551 Bacteria 2933
259 Ga0105238_10524539 3300009551 Unclassified 1187
260 Ga0105249_11187146 3300009553 Bacteria 834
261 Ga0099796_10079641 3300010159 Bacteria 1199
262 Ga0105239_10044932 3300010375 Bacteria 4842
263 Ga0105239_10398339 3300010375 Bacteria 1558
264 Ga0105239_10842139 3300010375 Bacteria 1052
265 Ga0105246_10049395 3300011119 Bacteria 2881
266 Ga0105246_10202127 3300011119 Bacteria 1545
267 Ga0105246_10376246 3300011119 Bacteria 1172
268 Ga0105246_10591181 3300011119 Unclassified 957
269 Ga0105246_10834787 3300011119 Bacteria 821
270 Ga0157371_10076615 3300013102 Bacteria 2368
271 Ga0157369_10036609 3300013105 Bacteria 5375
272 Ga0157374_10697064 3300013296 Unclassified 1028
273 Ga0157378_10014661 3300013297 Bacteria 6864
274 Ga0157378_10381227 3300013297 Unclassified 1385
275 Ga0157378_10670486 3300013297 Bacteria 1054
276 Ga0163162_10359503 3300013306 Bacteria 1589
277 Ga0163162_10975178 3300013306 Unclassified 958
278 Ga0157372_10446852 3300013307 Bacteria 1507
279 Ga0157372_10968597 3300013307 Bacteria 986
280 Ga0157375_10036027 3300013308 Bacteria 4729
281 Ga0157375_10281921 3300013308 Bacteria 1825
282 Ga0157375_10403684 3300013308 Bacteria 1533
283 Ga0157375_10988875 3300013308 Bacteria 981
284 Ga0163163_10013436 3300014325 Bacteria 7499
285 Ga0163163_10038529 3300014325 Bacteria 4660
286 Ga0163163_10621912 3300014325 Bacteria 1143
287 Ga0163163_10692256 3300014325 Unclassified 1083
288 Ga0157380_10049323 3300014326 Bacteria 3320
289 Ga0157380_10274968 3300014326 Bacteria 1538
290 Ga0157380_10384571 3300014326 Bacteria 1326
291 Ga0157380_10806066 3300014326 Unclassified 956
292 Ga0157380_12409135 3300014326 Bacteria 592
293 Ga0157377_10056502 3300014745 Bacteria 2229
294 Ga0157377_10068989 3300014745 Bacteria 2039
295 Ga0157379_10015468 3300014968 Bacteria 6696
296 Ga0157379_10327434 3300014968 Bacteria 1399
297 Ga0157376_10016507 3300014969 Bacteria 5609
298 Ga0157376_10027645 3300014969 Bacteria 4499
299 Ga0157376_10146137 3300014969 Bacteria 2127
300 Ga0157376_10184300 3300014969 Bacteria 1910
301 Ga0157376_10231703 3300014969 Bacteria 1716
302 Ga0157376_10278178 3300014969 Bacteria 1575
303 Ga0182007_10139652 3300015262 Bacteria 819
304 Ga0206356_10309224 3300020070 Bacteria 716
305 Ga0206356_10948705 3300020070 Bacteria 1419
306 Ga0207682_10045988 3300025893 Bacteria 1793
307 Ga0207682_10070454 3300025893 Bacteria 1480
308 Ga0207682_10095521 3300025893 Bacteria 1294
309 Ga0207682_10159041 3300025893 Bacteria 1023
310 Ga0207692_10212009 3300025898 Unclassified 1144
311 Ga0207642_10008019 3300025899 Unclassified 3600
312 Ga0207680_10185650 3300025903 Bacteria 1409
313 Ga0207647_10316211 3300025904 Unclassified 887
314 Ga0207685_10057441 3300025905 Bacteria 1526
315 Ga0207685_10168400 3300025905 Unclassified 1006
316 Ga0207699_10676230 3300025906 Unclassified 755
317 Ga0207643_10047102 3300025908 Bacteria 2438
318 Ga0207643_10074136 3300025908 Bacteria 1962
319 Ga0207643_10080279 3300025908 Bacteria 1889
320 Ga0207684_10027757 3300025910 Bacteria 4821
321 Ga0207654_10083492 3300025911 Bacteria 1929
322 Ga0207654_10173971 3300025911 Bacteria 1400
323 Ga0207707_10070930 3300025912 Bacteria 3036
324 Ga0207707_10123285 3300025912 Bacteria 2266
325 Ga0207671_10597052 3300025914 Unclassified 880
326 Ga0207693_10008944 3300025915 Bacteria 8173
327 Ga0207693_10057650 3300025915 Bacteria 3044
328 Ga0207693_10170931 3300025915 Bacteria 1711
329 Ga0207693_10469653 3300025915 Bacteria 983
330 Ga0207663_10614302 3300025916 Bacteria 855
331 Ga0207662_10108704 3300025918 Bacteria 1727
332 Ga0207662_10166284 3300025918 Bacteria 1412
333 Ga0207662_10550874 3300025918 Bacteria 799
334 Ga0207657_10162847 3300025919 Bacteria 1811
335 Ga0207649_10067793 3300025920 Bacteria 2266
336 Ga0207652_10071309 3300025921 Bacteria 3019
337 Ga0207652_10621589 3300025921 Unclassified 968
338 Ga0207646_10070303 3300025922 Bacteria 3126
339 Ga0207681_10003328 3300025923 Bacteria 10062
340 Ga0207694_10450784 3300025924 Bacteria 1074
341 Ga0207650_10004437 3300025925 Bacteria 9587
342 Ga0207650_10021599 3300025925 Bacteria 4548
343 Ga0207650_10533962 3300025925 Bacteria 982
344 Ga0207659_10000342 3300025926 Bacteria 27909
345 Ga0207659_10170489 3300025926 Bacteria 1717
346 Ga0207659_10171401 3300025926 Bacteria 1712
347 Ga0207659_10554662 3300025926 Bacteria 977
348 Ga0207659_10656879 3300025926 Bacteria 896
349 Ga0207659_11218687 3300025926 Bacteria 647
350 Ga0207687_10141111 3300025927 Bacteria 1828
351 Ga0207700_10017009 3300025928 Bacteria 4846
352 Ga0207700_10119889 3300025928 Bacteria 2131
353 Ga0207700_10335590 3300025928 Bacteria 1313
354 Ga0207644_10024515 3300025931 Bacteria 4143
355 Ga0207644_10153179 3300025931 Bacteria 1786
356 Ga0207644_10800854 3300025931 Bacteria 788
357 Ga0207690_10017781 3300025932 Bacteria 4350
358 Ga0207706_10029989 3300025933 Bacteria 4855
359 Ga0207706_10441887 3300025933 Bacteria 1126
360 Ga0207686_10023969 3300025934 Bacteria 3529
361 Ga0207686_10136759 3300025934 Bacteria 1688
362 Ga0207709_10046757 3300025935 Bacteria 2628
363 Ga0207670_10025365 3300025936 Bacteria 3720
364 Ga0207670_10071144 3300025936 Bacteria 2405
365 Ga0207704_10129475 3300025938 Bacteria 1745
366 Ga0207665_10012814 3300025939 Bacteria 5512
367 Ga0207665_10618968 3300025939 Bacteria 847
368 Ga0207691_10114834 3300025940 Bacteria 2392
369 Ga0207691_10147327 3300025940 Bacteria 2071
370 Ga0207711_10024965 3300025941 Bacteria 5013
371 Ga0207711_10074908 3300025941 Bacteria 2945
372 Ga0207711_10140387 3300025941 Bacteria 2173
373 Ga0207711_11118285 3300025941 Bacteria 729
374 Ga0207661_10005486 3300025944 Bacteria 8947
375 Ga0207661_10006850 3300025944 Bacteria 8077
376 Ga0207661_10016668 3300025944 Bacteria 5422
377 Ga0207679_10000614 3300025945 Bacteria 23779
378 Ga0207679_10060728 3300025945 Bacteria 2810
379 Ga0207679_10227504 3300025945 Bacteria 1573
380 Ga0207651_10083916 3300025960 Bacteria 2306
381 Ga0207651_10125755 3300025960 Bacteria 1953
382 Ga0207651_11082031 3300025960 Bacteria 718
383 Ga0207712_11566252 3300025961 Bacteria 590
384 Ga0207640_10705249 3300025981 Bacteria 866
385 Ga0207658_10492890 3300025986 Unclassified 1090
386 Ga0207658_10697524 3300025986 Bacteria 917
387 Ga0207677_10342049 3300026023 Bacteria 1250
388 Ga0207703_10019579 3300026035 Bacteria 5289
389 Ga0207703_10273903 3300026035 Unclassified 1530
390 Ga0207703_10625855 3300026035 Bacteria 1019
391 Ga0207639_10592673 3300026041 Bacteria 1021
392 Ga0207708_10314269 3300026075 Unclassified 1277
393 Ga0207702_10020263 3300026078 Bacteria 5509
394 Ga0207702_10118277 3300026078 Bacteria 2367
395 Ga0207702_10415180 3300026078 Bacteria 1300
396 Ga0207702_10558106 3300026078 Bacteria 1121
397 Ga0207641_10363266 3300026088 Bacteria 1383
398 Ga0207648_10034821 3300026089 Bacteria 4439
399 Ga0207648_10272570 3300026089 Bacteria 1512
400 Ga0207676_10073779 3300026095 Bacteria 2747
401 Ga0207676_10094454 3300026095 Bacteria 2464
402 Ga0207674_10018697 3300026116 Bacteria 7524
403 Ga0207674_10028612 3300026116 Bacteria 5879
404 Ga0207683_10000291 3300026121 Bacteria 45113
405 Ga0207683_10014072 3300026121 Bacteria 6820
406 Ga0207683_10101141 3300026121 Bacteria 2574
407 Ga0207683_10347201 3300026121 Bacteria 1361
408 Ga0207683_10506701 3300026121 Bacteria 1115
409 Ga0207698_10140835 3300026142 Bacteria 2078
410 Ga0209588_1043112 3300027671 Bacteria 1457
411 Ga0207428_10003186 3300027907 Bacteria 16064
412 Ga0207428_10099305 3300027907 Bacteria 2251
413 Ga0268266_10345572 3300028379 Bacteria 1397
414 Ga0268265_10019763 3300028380 Bacteria 4689
415 Ga0268265_10409578 3300028380 Bacteria 1256
416 Ga0268264_11105228 3300028381 Bacteria 801
417 Ga0268264_11131879 3300028381 Unclassified 792
418 Ga0307408_100001384 3300031548 Bacteria 18041
419 Ga0307408_100037229 3300031548 Bacteria 3426
420 Ga0307408_100244383 3300031548 Bacteria 1477
421 Ga0307405_10018397 3300031731 Bacteria 3854
422 Ga0307405_10322278 3300031731 Bacteria 1181
423 Ga0307405_10545444 3300031731 Unclassified 937
424 Ga0307413_10472779 3300031824 Unclassified 1000
425 Ga0307407_10469082 3300031903 Bacteria 917
426 Ga0307412_10286163 3300031911 Bacteria 1296
427 Ga0307412_10970173 3300031911 Bacteria 749
428 Ga0307409_100823454 3300031995 Bacteria 937
429 Ga0307416_100004726 3300032002 Bacteria 8258
430 Ga0307416_100009943 3300032002 Bacteria 6258
431 Ga0307416_101311157 3300032002 Bacteria 830
432 Ga0307411_10009594 3300032005 Bacteria 5103
433 Ga0307411_10313039 3300032005 Bacteria 1264
434 Ga0307415_100249307 3300032126 Bacteria 1442
435 Ga0373936_0021297 3300035113 Bacteria 2521
436 Ga0373939_0180019 3300035114 Bacteria 788
437 Ga0373953_0386494 3300035117 Bacteria 615
438 Ga0373953_0413073 3300035117 Bacteria 595
439 Ga0373946_0108433 3300035171 Bacteria 1254
440 Ga0373955_0016446 3300035172 Bacteria 3642
441 Ga0373935_0007853 3300035692 Bacteria 6400
442 Ga0373935_0044109 3300035692 Bacteria 2809
443 Ga0373927_0075405 3300035695 Bacteria 2184
444 Ga0373927_0188621 3300035695 Bacteria 1353
445 Ga0373933_0164795 3300035724 Bacteria 1409
446 Ga0373933_0370191 3300035724 Bacteria 932
447 Ga0373947_0023927 3300035725 Bacteria 3556
448 Ga0373947_0110260 3300035725 Bacteria 1738
449 Ga0373947_0186291 3300035725 Unclassified 1353
450 Ga0373937_0025076 3300036401 Bacteria 5383
451 Ga0373937_0099987 3300036401 Bacteria 2691
452 Ga0373937_0555853 3300036401 Bacteria 1090
453 Ga0373937_0899627 3300036401 Bacteria 834
454 Ga0373937_1268239 3300036401 Bacteria 685
455 Ga0373925_0225121 3300037068 Bacteria 1498
456 Ga0373925_0298991 3300037068 Bacteria 1299
457 Ga0373925_0963917 3300037068 Bacteria 703
458 Ga0373925_1606720 3300037068 Bacteria 531
459 Ga0395899_0020576 3300037312 Bacteria 5002
460 Ga0395900_0005909 3300037418 Bacteria 12779
461 Ga0395901_0000754 3300038443 Bacteria 36379
462 Ga0395901_0102258 3300038443 Bacteria 3007
463 Ga0439453_0003657 3300041408 Bacteria 2229
464 Ga0451800_0065828 3300041459 Bacteria 684
465 Ga0439456_079310 3300042013 Bacteria 732
466 Ga0450896_009023 3300042133 Bacteria 1387
467 Ga0450898_023573 3300042134 Bacteria 1095
468 Ga0439435_0009223 3300042436 Bacteria 2310
469 Ga0439435_0072704 3300042436 Unclassified 1020
470 Ga0439444_0098686 3300042437 Unclassified 660
471 Ga0439460_0089214 3300042461 Unclassified 978
472 Ga0453683_0475238 3300044673 Bacteria 810
473 Ga0451576_0537804 3300045051 Bacteria 1228
474 Ga0495603_0019466 3300046455 Bacteria 4107
475 Ga0495603_0030815 3300046455 Bacteria 3231
476 Ga0495603_0103022 3300046455 Bacteria 1666
477 Ga0495603_0197869 3300046455 Bacteria 1161
478 Ga0495629_0242021 3300046459 Bacteria 1242
479 Ga0495651_0542445 3300046462 Bacteria 740
480 Ga0495580_0326173 3300046472 Bacteria 1043
481 Ga0495580_0641130 3300046472 Unclassified 699
482 Ga0495582_0452543 3300046473 Bacteria 741
483 Ga0495585_0262727 3300046492 Bacteria 858
484 Ga0495607_0130566 3300046501 Unclassified 1308
485 Ga0495607_0412961 3300046501 Bacteria 612
486 Ga0495630_0017888 3300046517 Bacteria 5199
487 Ga0495663_0164472 3300046525 Bacteria 762
488 Ga0495652_0346401 3300046529 Bacteria 1066
489 Ga0495587_0475446 3300046536 Bacteria 692
490 Ga0495621_0039491 3300046539 Bacteria 1651
491 Ga0495621_0307091 3300046539 Bacteria 659
492 Ga0495645_0598273 3300046543 Bacteria 679
493 Ga0495656_0353932 3300046615 Bacteria 761
494 Ga0495588_0324249 3300046674 Bacteria 810
495 Ga0495657_0347732 3300046675 Bacteria 878
496 Ga0495647_0102766 3300046681 Bacteria 1185
497 Ga0495647_0391250 3300046681 Bacteria 637
498 Ga0495658_0063650 3300046683 Bacteria 2123
499 Ga0495658_0210088 3300046683 Unclassified 1216
500 Ga0495669_0051038 3300046684 Bacteria 1856
501 Ga0495613_0140688 3300046689 Bacteria 1724
502 Ga0495624_0047992 3300046690 Bacteria 2712
503 Ga0495581_0324429 3300047315 Bacteria 899
504 Ga0495604_0218009 3300047317 Bacteria 1315
505 Ga0495674_0702734 3300047319 Bacteria 793
506 Ga0495676_0507312 3300047321 Bacteria 791
507 Ga0495676_0725453 3300047321 Bacteria 642
508 Ga0495680_0549679 3300047322 Bacteria 778
509 Ga0495675_0131537 3300047444 Bacteria 1555
510 Ga0495614_0254387 3300048089 Bacteria 804
511 Ga0496100_0004005 3300048903 Bacteria 7749
512 Ga0496100_0078907 3300048903 Bacteria 2217
513 Ga0496100_0095976 3300048903 Bacteria 2033
514 Ga0496100_0651279 3300048903 Unclassified 820
515 Ga0496101_0002820 3300048904 Bacteria 10678
516 Ga0496101_0053995 3300048904 Bacteria 2900
517 Ga0496101_0069035 3300048904 Bacteria 2585
518 Ga0496101_0087938 3300048904 Bacteria 2307
519 Ga0496101_0546808 3300048904 Bacteria 915
520 Ga0496102_0014207 3300048905 Bacteria 6918
521 Ga0496102_0064139 3300048905 Bacteria 3365
522 Ga0496102_0213397 3300048905 Bacteria 1819
523 Ga0496102_0809328 3300048905 Bacteria 859
524 Ga0496103_0352022 3300048906 Bacteria 947
525 Ga0496103_0475610 3300048906 Bacteria 800
526 Ga0496104_0001980 3300048907 Bacteria 17748
527 Ga0496104_0003426 3300048907 Bacteria 13679
528 Ga0496104_0137031 3300048907 Bacteria 2352
529 Ga0496104_0194509 3300048907 Bacteria 1940
530 Ga0496104_1612564 3300048907 Bacteria 551
531 Ga0496105_0015207 3300048908 Bacteria 6129
532 Ga0496105_0019418 3300048908 Bacteria 5481
533 Ga0496105_0071558 3300048908 Bacteria 2866
534 Ga0496105_0102008 3300048908 Bacteria 2369
535 Ga0496105_0163645 3300048908 Bacteria 1826
536 Ga0496106_0004159 3300048909 Bacteria 10784
537 Ga0496106_0008644 3300048909 Bacteria 7537
538 Ga0496106_1399911 3300048909 Unclassified 540
539 Ga0496107_0007102 3300048910 Bacteria 7716
540 Ga0496107_0156709 3300048910 Bacteria 1686
541 Ga0496107_0258463 3300048910 Bacteria 1296
542 Ga0496108_0034334 3300048911 Bacteria 4214
543 Ga0496109_0004929 3300048912 Bacteria 11141
544 Ga0496109_0020110 3300048912 Bacteria 5897
545 Ga0496110_0000797 3300048913 Bacteria 22029
546 Ga0496110_0075638 3300048913 Bacteria 2992
547 Ga0496110_0234867 3300048913 Bacteria 1668
548 Ga0496110_0437832 3300048913 Bacteria 1191
549 Ga0496111_0014509 3300048914 Bacteria 5385
550 Ga0496111_0419724 3300048914 Bacteria 988
551 Ga0496112_0024849 3300048915 Bacteria 5747
552 Ga0496112_0121395 3300048915 Bacteria 2583
553 Ga0496112_0597166 3300048915 Bacteria 1036
554 Ga0496112_0982621 3300048915 Bacteria 764
555 Ga0496112_1007464 3300048915 Bacteria 753
556 Ga0496113_0444761 3300048916 Bacteria 1041
557 Ga0496114_0111408 3300048917 Bacteria 2345
558 Ga0496114_0858705 3300048917 Unclassified 788
559 Ga0496115_0066607 3300048918 Bacteria 2911
560 Ga0496115_0489759 3300048918 Bacteria 989
561 Ga0496115_0655368 3300048918 Unclassified 829
562 Ga0501305_055413 3300049161 Unclassified 673
563 Ga0501307_046486 3300049162 Unclassified 643
564 Ga0501299_026119 3300049522 Bacteria 1101
565 Ga0501300_072741 3300049523 Unclassified 558
566 Ga0501031_0411319 3300049568 Bacteria 875
567 Ga0501034_0001733 3300049571 Bacteria 28047
568 Ga0501036_0092148 3300049572 Bacteria 2560
569 Ga0501040_0179710 3300049576 Bacteria 1500
570 Ga0501041_0852576 3300049577 Bacteria 585
571 Ga0501071_0043370 3300049587 Bacteria 3225
572 Ga0501073_0069074 3300049589 Bacteria 2462
573 Ga0501075_0120098 3300049591 Bacteria 2000
574 Ga0501076_0273318 3300049592 Bacteria 1384
575 Ga0501076_0800859 3300049592 Bacteria 777
576 Ga0501077_0176615 3300049593 Bacteria 1357
577 Ga0501077_0805469 3300049593 Unclassified 604
578 Ga0501227_224638 3300049665 Bacteria 535
579 Ga0501249_017583 3300049679 Bacteria 1541
580 Ga0501079_0051697 3300049741 Bacteria 3173
581 Ga0501081_0253928 3300049743 Bacteria 1284
582 nmdc:mga05p37_10252_c1 3300050507 Bacteria 11128
583 nmdc:mga05p37_182856_c1 3300050507 Unclassified 2550
584 nmdc:mga05p37_30096_c1 3300050507 Bacteria 6625
585 nmdc:mga05p37_333432_c1 3300050507 Bacteria 1791
586 nmdc:mga05p37_515486_c1 3300050507 Bacteria 1369
587 nmdc:mga05p37_64576_c1 3300050507 Bacteria 4504
588 nmdc:mga05p37_89073_c1 3300050507 Bacteria 3803
589 nmdc:mga09592_14801_c1 3300050508 Bacteria 6367
590 nmdc:mga09592_806452_c1 3300050508 Bacteria 794
591 nmdc:mga09592_85492_c1 3300050508 Bacteria 2691
592 nmdc:mga0qj67_154353_c1 3300050509 Bacteria 1863
593 nmdc:mga0qj67_729159_c1 3300050509 Unclassified 787
594 nmdc:mga06r32_16706_c1 3300050510 Bacteria 6689
595 nmdc:mga06r32_261959_c1 3300050510 Bacteria 1716
596 nmdc:mga06r32_36754_c1 3300050510 Bacteria 4631
597 nmdc:mga06r32_430161_c1 3300050510 Bacteria 1301
598 nmdc:mga08y16_136982_c1 3300050511 Bacteria 2545
599 nmdc:mga08y16_169_c1 3300050511 Bacteria 57254
600 nmdc:mga08y16_6519_c1 3300050511 Bacteria 12241
601 nmdc:mga0n895_42445_c1 3300050512 Bacteria 4424
602 nmdc:mga0n895_5922_c1 3300050512 Bacteria 10279
603 nmdc:mga0n895_64261_c1 3300050512 Bacteria 3630
604 nmdc:mga0n895_690038_c1 3300050512 Bacteria 1018
605 nmdc:mga0rr50_108592_c1 3300050513 Bacteria 2192
606 nmdc:mga0rr50_1116224_c1 3300050513 Bacteria 671
607 nmdc:mga0rr50_178839_c1 3300050513 Bacteria 1733
608 nmdc:mga0rr50_281751_c1 3300050513 Bacteria 1387
609 nmdc:mga0rr50_497152_c1 3300050513 Bacteria 1037
610 nmdc:mga0rr50_555832_c1 3300050513 Unclassified 977
611 nmdc:mga0rr50_64079_c1 3300050513 Bacteria 2778
612 nmdc:mga08x19_118047_c1 3300050514 Bacteria 1775
613 nmdc:mga08x19_69981_c1 3300050514 Bacteria 2286
614 nmdc:mga0a205_17057_c1 3300050515 Bacteria 6798
615 nmdc:mga0a205_513174_c1 3300050515 Unclassified 1055
616 nmdc:mga0a205_80536_c1 3300050515 Bacteria 3146
617 Ga0495601_0009126 3300053077 Bacteria 5857
618 Ga0495601_0135053 3300053077 Bacteria 1608
619 Ga0495612_0104026 3300053078 Bacteria 1211
620 Ga0495595_0126101 3300053084 Bacteria 1249
621 Ga0495619_0066699 3300053085 Bacteria 2402
622 Ga0495619_0431678 3300053085 Bacteria 909
623 Ga0501084_0227994 3300054114 Bacteria 1572
624 Ga0587071_125604 3300060344 Bacteria 617
625 Ga0501082_0359679 3300060353 Bacteria 1269
626 Ga0530510_0261772 3300061734 Bacteria 1290
627 Ga0070698_100149419
628 Ga0006759J45824_1048008
629 Ga0006770J48903_1038478
630 Ga0006770J48903_1048694
631 Ga0007417J51691_1035169
632 Ga0007417J51691_1038443
633 Ga0007410J51695_1034363
634 Ga0007410J51695_1034818
635 Ga0007410J51695_1087691
636 Ga0007410J51695_1087692
637 Ga0007410J51695_1090899
638 Ga0007409J51694_1025113
639 Ga0007409J51694_1026055
640 Ga0007409J51694_1032282
641 Ga0007416J51690_1027157
642 Ga0007416J51690_1033067
643 Ga0032354_1059829
644 Ga0032354_1067914
645 Ga0032354_1073346
646 Ga0058859_10015082
647 Ga0058859_11607011
648 Ga0058860_12046477
649 Ga0058860_12189749
650 Ga0058862_12278606
651 Ga0065704_10439696
652 Ga0065712_10089842
653 Ga0065715_10000567
654 Ga0065715_10020705
655 Ga0065715_10107774
656 Ga0065715_10140184
657 Ga0065715_10222302
658 Ga0065707_10128601
659 Ga0065707_10243139
660 Ga0070683_100000387
661 Ga0070683_100036430
662 Ga0070690_100247031
663 Ga0070690_100280580
664 Ga0070670_100002891
665 Ga0070670_100032038
666 Ga0070670_100099668
667 Ga0070677_10021614
668 Ga0070677_10187243
669 Ga0070666_10019437
670 Ga0070666_10286692
671 Ga0070682_100012081
672 Ga0070682_100031516
673 Ga0068868_101831376
674 Ga0070660_100105986
675 Ga0070689_100004232
676 Ga0070689_100101380
677 Ga0070689_100812182
678 Ga0070691_10070990
679 Ga0070687_100028821
680 Ga0070687_100263903
681 Ga0070661_100047937
682 Ga0070661_101187683
683 Ga0070668_100146089
684 Ga0070669_100000810
685 Ga0070669_100128219
686 Ga0070669_101568788
687 Ga0070675_100000420
688 Ga0070675_100081989
689 Ga0070675_100748623
690 Ga0070675_100794307
691 Ga0070675_100795132
692 Ga0070675_101022436
693 Ga0070675_101321909
694 Ga0070671_100032811
695 Ga0070671_100072121
696 Ga0070671_100212485
697 Ga0070671_100914027
698 Ga0070674_100483776
699 Ga0070674_100703298
700 Ga0070673_100301968
701 Ga0070673_100461484
702 Ga0070673_100535918
703 Ga0070673_101383972
704 Ga0070688_100008399
705 Ga0070688_100105234
706 Ga0070667_100129085
707 Ga0070667_100766292
708 Ga0070709_10832414
709 Ga0070709_11098959
710 Ga0070714_101126431
711 Ga0070713_100391911
712 Ga0070713_101293629
713 Ga0070711_100003017
714 Ga0070711_100095708
715 Ga0070705_100096615
716 Ga0070700_100019727
717 Ga0070700_100802496
718 Ga0070694_100386227
719 Ga0070694_100532130
720 Ga0070708_100022009
721 Ga0070708_100482100
722 Ga0070678_100001272
723 Ga0070678_100059551
724 Ga0070678_100394176
725 Ga0070678_101288200
726 Ga0070662_100111900
727 Ga0070662_101011124
728 Ga0070681_10036083
729 Ga0070681_10472872
730 Ga0068867_100203173
731 Ga0068867_101164580
732 Ga0070685_10164672
733 Ga0070706_100052469
734 Ga0070706_100917248
735 Ga0070707_100055490
736 Ga0070698_101044680
737 Ga0070699_100008961
738 Ga0070699_100077473
739 Ga0070679_100002810
740 Ga0070679_100226828
741 Ga0070679_100346655
742 Ga0070684_100000221
743 Ga0070684_100001001
744 Ga0070684_100118201
745 Ga0070684_100780173
746 Ga0070697_100054136
747 Ga0068853_100504299
748 Ga0070672_100173723
749 Ga0070686_100009335
750 Ga0070695_100283540
751 Ga0070695_101334229
752 Ga0070696_100091211
753 Ga0070693_100002648
754 Ga0070665_100336867
755 Ga0070704_100068116
756 Ga0070704_100551548
757 Ga0068855_101599484
758 Ga0070664_100001047
759 Ga0070664_100222132
760 Ga0070664_100315229
761 Ga0068857_100012736
762 Ga0068857_100575047
763 Ga0068854_100098429
764 Ga0068854_101045688
765 Ga0068856_100022134
766 Ga0070702_100003217
767 Ga0070702_100104354
768 Ga0070702_100263804
769 Ga0068859_100008674
770 Ga0068859_100272414
771 Ga0068859_101733541
772 Ga0068864_100097809
773 Ga0068864_100416846
774 Ga0068864_100479432
775 Ga0068866_10009424
776 Ga0068861_100036162
777 Ga0068870_10073899
778 Ga0068858_100028600
779 Ga0068858_100086763
780 Ga0068858_100865100
781 Ga0068860_100063330
782 Ga0068860_101187928
783 Ga0068862_100594613
784 Ga0068862_100797276
785 Ga0068862_101287466
786 Ga0081455_10050918
787 Ga0081455_10067271
788 Ga0081455_10406872
789 Ga0081455_10533200
790 Ga0070717_10014685
791 Ga0070717_10096935
792 Ga0070717_10141296
793 Ga0070715_10126766
794 Ga0070716_100022902
795 Ga0070716_100623563
796 Ga0070716_100649508
797 Ga0070712_100006611
798 Ga0070712_100181908
799 Ga0070712_100325833
800 Ga0070712_100530575
801 Ga0075427_10051690
802 Ga0075427_10081606
803 Ga0097621_100055828
804 Ga0097621_101163528
805 Ga0097621_101304460
806 Ga0068871_100006757
807 Ga0068871_100135410
808 Ga0068871_100141108
809 Ga0068871_100187750
810 Ga0068871_100526498
811 Ga0068871_100547370
812 Ga0068871_100805477
813 Ga0075428_100080323
814 Ga0075428_100152383
815 Ga0075428_100221779
816 Ga0075428_101022195
817 Ga0075430_100004027
818 Ga0075430_100053822
819 Ga0075430_100790078
820 Ga0075430_101106700
821 Ga0075431_100017211
822 Ga0075431_100084490
823 Ga0075431_100550721
824 Ga0075431_100810757
825 Ga0075433_10009142
826 Ga0075433_10115746
827 Ga0075433_10161088
828 Ga0075433_10200684
829 Ga0075433_10398978
830 Ga0075434_100060958
831 Ga0075434_100108516
832 Ga0075434_101219871
833 Ga0075429_100060784
834 Ga0075429_100317669
835 Ga0075429_101296940
836 Ga0068865_100115529
837 Ga0068865_101058714
838 Ga0075436_100000215
839 Ga0097620_100008673
840 Ga0097620_100272410
841 Ga0097620_101733647
842 Ga0075435_100024359
843 Ga0075435_100091471
844 Ga0075435_100116199
845 Ga0075435_100223635
846 Ga0099794_10031551
847 Ga0099795_10108631
848 Ga0099795_10221254
849 Ga0105240_10063256
850 Ga0111539_10007570
851 Ga0111539_10056192
852 Ga0111539_10404118
853 Ga0111539_10632130
854 Ga0111539_10906529
855 Ga0111539_10942545
856 Ga0105245_10045161
857 Ga0105245_10372261
858 Ga0105247_10075286
859 Ga0105247_10842820
860 Ga0114129_10001078
861 Ga0114129_10003230
862 Ga0114129_10059645
863 Ga0114129_10242694
864 Ga0114129_10332440
865 Ga0114129_10656617
866 Ga0114129_10863796
867 Ga0105243_10022543
868 Ga0105243_10418493
869 Ga0105241_10075860
870 Ga0105241_10077118
871 Ga0105241_10437641
872 Ga0105242_10079873
873 Ga0105242_10188157
874 Ga0105242_10222581
875 Ga0105242_10574536
876 Ga0105242_10957294
877 Ga0105242_10996465
878 Ga0105242_11770166
879 Ga0105248_10007999
880 Ga0105248_10022095
881 Ga0105248_10243181
882 Ga0105248_10332563
883 Ga0105238_10065734
884 Ga0105238_10097055
885 Ga0105238_10524539
886 Ga0105249_11187146
887 Ga0099796_10079641
888 Ga0105239_10044932
889 Ga0105239_10398339
890 Ga0105239_10842139
891 Ga0105246_10049395
892 Ga0105246_10202127
893 Ga0105246_10376246
894 Ga0105246_10591181
895 Ga0105246_10834787
896 Ga0157371_10076615
897 Ga0157369_10036609
898 Ga0157374_10697064
899 Ga0157378_10014661
900 Ga0157378_10381227
901 Ga0157378_10670486
902 Ga0163162_10359503
903 Ga0163162_10975178
904 Ga0157372_10446852
905 Ga0157372_10968597
906 Ga0157375_10036027
907 Ga0157375_10281921
908 Ga0157375_10403684
909 Ga0157375_10988875
910 Ga0163163_10013436
911 Ga0163163_10038529
912 Ga0163163_10621912
913 Ga0163163_10692256
914 Ga0157380_10049323
915 Ga0157380_10274968
916 Ga0157380_10384571
917 Ga0157380_10806066
918 Ga0157380_12409135
919 Ga0157377_10056502
920 Ga0157377_10068989
921 Ga0157379_10015468
922 Ga0157379_10327434
923 Ga0157376_10016507
924 Ga0157376_10027645
925 Ga0157376_10146137
926 Ga0157376_10184300
927 Ga0157376_10231703
928 Ga0157376_10278178
929 Ga0182007_10139652
930 Ga0206356_10309224
931 Ga0206356_10948705
932 Ga0207682_10045988
933 Ga0207682_10070454
934 Ga0207682_10095521
935 Ga0207682_10159041
936 Ga0207692_10212009
937 Ga0207642_10008019
938 Ga0207680_10185650
939 Ga0207647_10316211
940 Ga0207685_10057441
941 Ga0207685_10168400
942 Ga0207699_10676230
943 Ga0207643_10047102
944 Ga0207643_10074136
945 Ga0207643_10080279
946 Ga0207684_10027757
947 Ga0207654_10083492
948 Ga0207654_10173971
949 Ga0207707_10070930
950 Ga0207707_10123285
951 Ga0207671_10597052
952 Ga0207693_10008944
953 Ga0207693_10057650
954 Ga0207693_10170931
955 Ga0207693_10469653
956 Ga0207663_10614302
957 Ga0207662_10108704
958 Ga0207662_10166284
959 Ga0207662_10550874
960 Ga0207657_10162847
961 Ga0207649_10067793
962 Ga0207652_10071309
963 Ga0207652_10621589
964 Ga0207646_10070303
965 Ga0207681_10003328
966 Ga0207694_10450784
967 Ga0207650_10004437
968 Ga0207650_10021599
969 Ga0207650_10533962
970 Ga0207659_10000342
971 Ga0207659_10170489
972 Ga0207659_10171401
973 Ga0207659_10554662
974 Ga0207659_10656879
975 Ga0207659_11218687
976 Ga0207687_10141111
977 Ga0207700_10017009
978 Ga0207700_10119889
979 Ga0207700_10335590
980 Ga0207644_10024515
981 Ga0207644_10153179
982 Ga0207644_10800854
983 Ga0207690_10017781
984 Ga0207706_10029989
985 Ga0207706_10441887
986 Ga0207686_10023969
987 Ga0207686_10136759
988 Ga0207709_10046757
989 Ga0207670_10025365
990 Ga0207670_10071144
991 Ga0207704_10129475
992 Ga0207665_10012814
993 Ga0207665_10618968
994 Ga0207691_10114834
995 Ga0207691_10147327
996 Ga0207711_10024965
997 Ga0207711_10074908
998 Ga0207711_10140387
999 Ga0207711_11118285
1000 Ga0207661_10005486
1001 Ga0207661_10006850
1002 Ga0207661_10016668
1003 Ga0207679_10000614
1004 Ga0207679_10060728
1005 Ga0207679_10227504
1006 Ga0207651_10083916
1007 Ga0207651_10125755
1008 Ga0207651_11082031
1009 Ga0207712_11566252
1010 Ga0207640_10705249
1011 Ga0207658_10492890
1012 Ga0207658_10697524
1013 Ga0207677_10342049
1014 Ga0207703_10019579
1015 Ga0207703_10273903
1016 Ga0207703_10625855
1017 Ga0207639_10592673
1018 Ga0207708_10314269
1019 Ga0207702_10020263
1020 Ga0207702_10118277
1021 Ga0207702_10415180
1022 Ga0207702_10558106
1023 Ga0207641_10363266
1024 Ga0207648_10034821
1025 Ga0207648_10272570
1026 Ga0207676_10073779
1027 Ga0207676_10094454
1028 Ga0207674_10018697
1029 Ga0207674_10028612
1030 Ga0207683_10000291
1031 Ga0207683_10014072
1032 Ga0207683_10101141
1033 Ga0207683_10347201
1034 Ga0207683_10506701
1035 Ga0207698_10140835
1036 Ga0209588_1043112
1037 Ga0207428_10003186
1038 Ga0207428_10099305
1039 Ga0268266_10345572
1040 Ga0268265_10019763
1041 Ga0268265_10409578
1042 Ga0268264_11105228
1043 Ga0268264_11131879
1044 Ga0307408_100001384
1045 Ga0307408_100037229
1046 Ga0307408_100244383
1047 Ga0307405_10018397
1048 Ga0307405_10322278
1049 Ga0307405_10545444
1050 Ga0307413_10472779
1051 Ga0307407_10469082
1052 Ga0307412_10286163
1053 Ga0307412_10970173
1054 Ga0307409_100823454
1055 Ga0307416_100004726
1056 Ga0307416_100009943
1057 Ga0307416_101311157
1058 Ga0307411_10009594
1059 Ga0307411_10313039
1060 Ga0307415_100249307
1061 Ga0373936_0021297
1062 Ga0373939_0180019
1063 Ga0373953_0386494
1064 Ga0373953_0413073
1065 Ga0373946_0108433
1066 Ga0373955_0016446
1067 Ga0373935_0007853
1068 Ga0373935_0044109
1069 Ga0373927_0075405
1070 Ga0373927_0188621
1071 Ga0373933_0164795
1072 Ga0373933_0370191
1073 Ga0373947_0023927
1074 Ga0373947_0110260
1075 Ga0373947_0186291
1076 Ga0373937_0025076
1077 Ga0373937_0099987
1078 Ga0373937_0555853
1079 Ga0373937_0899627
1080 Ga0373937_1268239
1081 Ga0373925_0225121
1082 Ga0373925_0298991
1083 Ga0373925_0963917
1084 Ga0373925_1606720
1085 Ga0395899_0020576
1086 Ga0395900_0005909
1087 Ga0395901_0000754
1088 Ga0395901_0102258
1089 Ga0439453_0003657
1090 Ga0451800_0065828
1091 Ga0439456_079310
1092 Ga0450896_009023
1093 Ga0450898_023573
1094 Ga0439435_0009223
1095 Ga0439435_0072704
1096 Ga0439444_0098686
1097 Ga0439460_0089214
1098 Ga0453683_0475238
1099 Ga0451576_0537804
1100 Ga0495603_0019466
1101 Ga0495603_0030815
1102 Ga0495603_0103022
1103 Ga0495603_0197869
1104 Ga0495629_0242021
1105 Ga0495651_0542445
1106 Ga0495580_0326173
1107 Ga0495580_0641130
1108 Ga0495582_0452543
1109 Ga0495585_0262727
1110 Ga0495607_0130566
1111 Ga0495607_0412961
1112 Ga0495630_0017888
1113 Ga0495663_0164472
1114 Ga0495652_0346401
1115 Ga0495587_0475446
1116 Ga0495621_0039491
1117 Ga0495621_0307091
1118 Ga0495645_0598273
1119 Ga0495656_0353932
1120 Ga0495588_0324249
1121 Ga0495657_0347732
1122 Ga0495647_0102766
1123 Ga0495647_0391250
1124 Ga0495658_0063650
1125 Ga0495658_0210088
1126 Ga0495669_0051038
1127 Ga0495613_0140688
1128 Ga0495624_0047992
1129 Ga0495581_0324429
1130 Ga0495604_0218009
1131 Ga0495674_0702734
1132 Ga0495676_0507312
1133 Ga0495676_0725453
1134 Ga0495680_0549679
1135 Ga0495675_0131537
1136 Ga0495614_0254387
1137 Ga0496100_0004005
1138 Ga0496100_0078907
1139 Ga0496100_0095976
1140 Ga0496100_0651279
1141 Ga0496101_0002820
1142 Ga0496101_0053995
1143 Ga0496101_0069035
1144 Ga0496101_0087938
1145 Ga0496101_0546808
1146 Ga0496102_0014207
1147 Ga0496102_0064139
1148 Ga0496102_0213397
1149 Ga0496102_0809328
1150 Ga0496103_0352022
1151 Ga0496103_0475610
1152 Ga0496104_0001980
1153 Ga0496104_0003426
1154 Ga0496104_0137031
1155 Ga0496104_0194509
1156 Ga0496104_1612564
1157 Ga0496105_0015207
1158 Ga0496105_0019418
1159 Ga0496105_0071558
1160 Ga0496105_0102008
1161 Ga0496105_0163645
1162 Ga0496106_0004159
1163 Ga0496106_0008644
1164 Ga0496106_1399911
1165 Ga0496107_0007102
1166 Ga0496107_0156709
1167 Ga0496107_0258463
1168 Ga0496108_0034334
1169 Ga0496109_0004929
1170 Ga0496109_0020110
1171 Ga0496110_0000797
1172 Ga0496110_0075638
1173 Ga0496110_0234867
1174 Ga0496110_0437832
1175 Ga0496111_0014509
1176 Ga0496111_0419724
1177 Ga0496112_0024849
1178 Ga0496112_0121395
1179 Ga0496112_0597166
1180 Ga0496112_0982621
1181 Ga0496112_1007464
1182 Ga0496113_0444761
1183 Ga0496114_0111408
1184 Ga0496114_0858705
1185 Ga0496115_0066607
1186 Ga0496115_0489759
1187 Ga0496115_0655368
1188 Ga0501305_055413
1189 Ga0501307_046486
1190 Ga0501299_026119
1191 Ga0501300_072741
1192 Ga0501031_0411319
1193 Ga0501034_0001733
1194 Ga0501036_0092148
1195 Ga0501040_0179710
1196 Ga0501041_0852576
1197 Ga0501071_0043370
1198 Ga0501073_0069074
1199 Ga0501075_0120098
1200 Ga0501076_0273318
1201 Ga0501076_0800859
1202 Ga0501077_0176615
1203 Ga0501077_0805469
1204 Ga0501227_224638
1205 Ga0501249_017583
1206 Ga0501079_0051697
1207 Ga0501081_0253928
1208 nmdc:mga05p37_10252_c1
1209 nmdc:mga05p37_182856_c1
1210 nmdc:mga05p37_30096_c1
1211 nmdc:mga05p37_333432_c1
1212 nmdc:mga05p37_515486_c1
1213 nmdc:mga05p37_64576_c1
1214 nmdc:mga05p37_89073_c1
1215 nmdc:mga09592_14801_c1
1216 nmdc:mga09592_806452_c1
1217 nmdc:mga09592_85492_c1
1218 nmdc:mga0qj67_154353_c1
1219 nmdc:mga0qj67_729159_c1
1220 nmdc:mga06r32_16706_c1
1221 nmdc:mga06r32_261959_c1
1222 nmdc:mga06r32_36754_c1
1223 nmdc:mga06r32_430161_c1
1224 nmdc:mga08y16_136982_c1
1225 nmdc:mga08y16_169_c1
1226 nmdc:mga08y16_6519_c1
1227 nmdc:mga0n895_42445_c1
1228 nmdc:mga0n895_5922_c1
1229 nmdc:mga0n895_64261_c1
1230 nmdc:mga0n895_690038_c1
1231 nmdc:mga0rr50_108592_c1
1232 nmdc:mga0rr50_1116224_c1
1233 nmdc:mga0rr50_178839_c1
1234 nmdc:mga0rr50_281751_c1
1235 nmdc:mga0rr50_497152_c1
1236 nmdc:mga0rr50_555832_c1
1237 nmdc:mga0rr50_64079_c1
1238 nmdc:mga08x19_118047_c1
1239 nmdc:mga08x19_69981_c1
1240 nmdc:mga0a205_17057_c1
1241 nmdc:mga0a205_513174_c1
1242 nmdc:mga0a205_80536_c1
1243 Ga0495601_0009126
1244 Ga0495601_0135053
1245 Ga0495612_0104026
1246 Ga0495595_0126101
1247 Ga0495619_0066699
1248 Ga0495619_0431678
1249 Ga0501084_0227994
1250 Ga0587071_125604
1251 Ga0501082_0359679
1252 Ga0530510_0261772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

33

149

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tv4-assembly1.cif.gz_C-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9522 2 150
3v4h-assembly1.cif.gz_B crystal structure of a type vi secretion system effector from yersinia pestis 0.9517 4 143
1y12-assembly1.cif.gz_A structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9499 2 150
1y12-assembly2.cif.gz_B structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9493 2 150
1y12-assembly1.cif.gz_C structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9474 2 150
ID Description Score Start End Superfamily
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.921 2 150 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9113 4 149 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8976 4 149 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8871 2 150 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8758 2 150 2.30.110.20
ID Description Score Start End GO Terms
AF-A0A3N5TH31-F1-model_v4 Type VI secretion system tube protein Hcp 0.9701 1 148
AF-A0A7H0GLC9-F1-model_v4 Type VI secretion system tube protein Hcp 0.9672 2 148
AF-A0A0N1LC31-F1-model_v4 Hcp1 family type VI secretion system effector 0.9663 1 148
AF-A0A3M3AT51-F1-model_v4 Putative type VI secretion system effector, Hcp1 family 0.965 46 150
AF-A0A0P9MGK8-F1-model_v4 Type VI secretion system effector, Hcp1 family 0.9626 50 150

Map