F470323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 624 | 400 | 498 | 309 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2675902999|2676199302 |
| Length | 362 |
| Sequence | GASPRPPAGHDSMIDRLGGHGSAYSGGSRCRPVLAFRDVKVTALAGGIGGARFLRGVRAALADAEVTVVGNTGDDIILHRLNISPDLDTVMYTLGGGISAERGWGREDETFTVRAELAEYGVGPAWFGLGDRDLATHLVRTQMLAAGFSLSDVTAALCQRWRPGVRLIPMSDDRVETHVVISDEAGRRAIHFQEWWLRLRAEVPAEAIVSVGAADAKPAPGVLDALAEADVVLLPPSNPVVSIGAILSVPGIRDALRETPAPVVGVSPIIGGSPVRGMADACLRAIGVETSAEAVGRHYGARRAGEGAPPGSAEGLLDGWLVDTVDAGVTVPGMRVAAHPLLMSDLDATVAIVRAALELAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 4 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 5 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 6 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 7 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 8 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 9 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 10 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 11 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 12 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 13 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 14 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 15 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 16 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 17 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 18 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 19 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 20 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 21 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 22 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 23 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 24 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 25 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 26 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 27 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 28 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 29 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 30 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 31 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 32 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 33 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 34 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 35 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 36 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 37 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 38 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 39 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 40 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 41 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 42 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 43 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 44 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 45 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 46 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 47 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 48 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 49 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 50 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 51 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 52 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 53 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 54 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 55 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 56 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 57 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 58 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 59 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 60 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 61 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 62 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 63 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 64 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 65 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 66 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 67 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 68 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 69 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 70 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 71 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 72 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 73 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 74 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 75 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 76 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 77 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 78 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 79 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 80 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 81 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 82 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 83 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 84 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 85 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 86 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 87 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 88 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 89 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 90 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 91 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 92 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 93 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 94 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 95 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 96 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 97 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 98 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 99 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 100 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 101 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 102 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 103 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 104 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 105 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 106 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 107 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 108 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 109 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 130 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 132 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 133 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 134 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 135 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 136 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 138 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 139 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 141 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 144 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 145 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 146 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 147 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 148 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 149 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 150 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 152 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 210 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 239 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 242 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 246 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 254 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 338 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 373 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 374 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 376 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 377 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 382 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 383 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 384 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 385 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 386 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 387 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 388 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 389 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 390 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 391 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 392 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 393 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 394 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 395 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 396 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 397 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 398 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 399 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 400 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.17 |
| Metatranscriptomes | 0.64 |
| Isolates | 20.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.08 |
| Nodule | 4.49 |
| Rhizoplane | 4.33 |
| Rhizosphere | 76.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10064695 | 3300001990 | Bacteria | 1097 |
| 2 | JGI24738J21930_10015961 | 3300002075 | Bacteria | 1592 |
| 3 | Ga0070658_10003040 | 3300005327 | Bacteria | 13878 |
| 4 | Ga0070658_10010374 | 3300005327 | Bacteria | 7473 |
| 5 | Ga0070658_10071648 | 3300005327 | Bacteria | 2838 |
| 6 | Ga0070683_100029310 | 3300005329 | Bacteria | 4981 |
| 7 | Ga0070683_100107321 | 3300005329 | Bacteria | 2633 |
| 8 | Ga0070680_100001163 | 3300005336 | Bacteria | 18905 |
| 9 | Ga0070680_100143865 | 3300005336 | Bacteria | 2000 |
| 10 | Ga0070680_100153934 | 3300005336 | Bacteria | 1931 |
| 11 | Ga0070682_100046186 | 3300005337 | Bacteria | 2702 |
| 12 | Ga0070682_100099099 | 3300005337 | Bacteria | 1921 |
| 13 | Ga0070674_100328344 | 3300005356 | Bacteria | 1229 |
| 14 | Ga0070709_10000450 | 3300005434 | Bacteria | 24796 |
| 15 | Ga0070714_100113833 | 3300005435 | Bacteria | 2399 |
| 16 | Ga0070714_100219426 | 3300005435 | Bacteria | 1747 |
| 17 | Ga0070714_100433885 | 3300005435 | Bacteria | 1246 |
| 18 | Ga0070713_100033102 | 3300005436 | Bacteria | 4137 |
| 19 | Ga0070713_100085821 | 3300005436 | Bacteria | 2697 |
| 20 | Ga0070713_100101961 | 3300005436 | Bacteria | 2487 |
| 21 | Ga0070713_100359952 | 3300005436 | Bacteria | 1352 |
| 22 | Ga0070710_10000997 | 3300005437 | Bacteria | 13477 |
| 23 | Ga0070710_10011129 | 3300005437 | Bacteria | 4438 |
| 24 | Ga0070711_100003832 | 3300005439 | Bacteria | 8829 |
| 25 | Ga0070708_100363085 | 3300005445 | Bacteria | 1365 |
| 26 | Ga0070663_100079006 | 3300005455 | Bacteria | 2413 |
| 27 | Ga0070681_10027682 | 3300005458 | Bacteria | 5698 |
| 28 | Ga0070681_10110895 | 3300005458 | Bacteria | 2683 |
| 29 | Ga0070681_10112564 | 3300005458 | Bacteria | 2661 |
| 30 | Ga0070706_100010701 | 3300005467 | Bacteria | 8515 |
| 31 | Ga0070706_100068999 | 3300005467 | Bacteria | 3270 |
| 32 | Ga0070706_100148378 | 3300005467 | Bacteria | 2189 |
| 33 | Ga0070707_100000788 | 3300005468 | Bacteria | 31321 |
| 34 | Ga0070698_100000080 | 3300005471 | Bacteria | 73829 |
| 35 | Ga0070698_100234165 | 3300005471 | Bacteria | 1769 |
| 36 | Ga0070679_100034079 | 3300005530 | Bacteria | 5045 |
| 37 | Ga0070684_100055584 | 3300005535 | Bacteria | 3452 |
| 38 | Ga0068853_100004360 | 3300005539 | Bacteria | 10951 |
| 39 | Ga0070665_100132857 | 3300005548 | Bacteria | 2490 |
| 40 | Ga0070665_100212005 | 3300005548 | Bacteria | 1938 |
| 41 | Ga0070665_100385037 | 3300005548 | Bacteria | 1410 |
| 42 | Ga0068856_100047398 | 3300005614 | Bacteria | 4233 |
| 43 | Ga0068856_100049552 | 3300005614 | Bacteria | 4139 |
| 44 | Ga0070702_100191935 | 3300005615 | Bacteria | 1345 |
| 45 | Ga0068859_100001109 | 3300005617 | Bacteria | 27473 |
| 46 | Ga0068864_100050286 | 3300005618 | Bacteria | 3587 |
| 47 | Ga0068858_100000013 | 3300005842 | Bacteria | 216466 |
| 48 | Ga0068858_100000337 | 3300005842 | Bacteria | 49725 |
| 49 | Ga0068858_100018475 | 3300005842 | Bacteria | 6527 |
| 50 | Ga0068862_100000342 | 3300005844 | Bacteria | 50403 |
| 51 | Ga0081455_10000144 | 3300005937 | Bacteria | 84406 |
| 52 | Ga0070717_10029158 | 3300006028 | Bacteria | 4424 |
| 53 | Ga0070717_10048867 | 3300006028 | Bacteria | 3471 |
| 54 | Ga0070717_10299125 | 3300006028 | Bacteria | 1430 |
| 55 | Ga0075368_10035968 | 3300006042 | Bacteria | 1934 |
| 56 | Ga0075363_100014181 | 3300006048 | Bacteria | 3886 |
| 57 | Ga0070716_100007325 | 3300006173 | Bacteria | 5430 |
| 58 | Ga0075367_10018023 | 3300006178 | Bacteria | 3888 |
| 59 | Ga0097621_100014530 | 3300006237 | Bacteria | 5895 |
| 60 | Ga0097621_100433446 | 3300006237 | Bacteria | 1182 |
| 61 | Ga0068871_100050287 | 3300006358 | Bacteria | 3371 |
| 62 | Ga0068871_100230607 | 3300006358 | Bacteria | 1607 |
| 63 | Ga0075428_100001143 | 3300006844 | Bacteria | 28380 |
| 64 | Ga0075430_100006377 | 3300006846 | Bacteria | 9947 |
| 65 | Ga0075431_100020352 | 3300006847 | Bacteria | 6778 |
| 66 | Ga0075433_10057567 | 3300006852 | Bacteria | 3398 |
| 67 | Ga0075434_100010350 | 3300006871 | Bacteria | 8741 |
| 68 | Ga0075434_100097274 | 3300006871 | Bacteria | 2948 |
| 69 | Ga0075434_100234822 | 3300006871 | Bacteria | 1853 |
| 70 | Ga0075434_100324665 | 3300006871 | Bacteria | 1559 |
| 71 | Ga0075429_100002830 | 3300006880 | Bacteria | 14682 |
| 72 | Ga0075436_100048520 | 3300006914 | Bacteria | 2929 |
| 73 | Ga0097620_100001109 | 3300006931 | Bacteria | 27473 |
| 74 | Ga0097620_100004481 | 3300006931 | Bacteria | 14254 |
| 75 | Ga0075435_100001372 | 3300007076 | Bacteria | 15726 |
| 76 | Ga0105245_10103592 | 3300009098 | Bacteria | 2637 |
| 77 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 78 | Ga0105247_10002589 | 3300009101 | Bacteria | 12243 |
| 79 | Ga0114129_10000277 | 3300009147 | Bacteria | 58538 |
| 80 | Ga0105248_10000219 | 3300009177 | Bacteria | 65828 |
| 81 | Ga0105248_10001845 | 3300009177 | Bacteria | 23471 |
| 82 | Ga0105248_10007652 | 3300009177 | Bacteria | 11870 |
| 83 | Ga0105248_10213047 | 3300009177 | Bacteria | 2177 |
| 84 | Ga0105249_10041353 | 3300009553 | Bacteria | 4190 |
| 85 | Ga0105239_10370160 | 3300010375 | Bacteria | 1619 |
| 86 | Ga0105239_10459994 | 3300010375 | Bacteria | 1444 |
| 87 | Ga0157370_10011579 | 3300013104 | Bacteria | 9205 |
| 88 | Ga0157370_10011957 | 3300013104 | Bacteria | 9047 |
| 89 | Ga0157370_10120997 | 3300013104 | Bacteria | 2444 |
| 90 | Ga0157370_10136981 | 3300013104 | Bacteria | 2281 |
| 91 | Ga0157369_10001338 | 3300013105 | Bacteria | 30437 |
| 92 | Ga0157369_10019137 | 3300013105 | Bacteria | 7664 |
| 93 | Ga0157369_10069889 | 3300013105 | Bacteria | 3772 |
| 94 | Ga0157369_10152352 | 3300013105 | Bacteria | 2444 |
| 95 | Ga0157369_10175835 | 3300013105 | Bacteria | 2254 |
| 96 | Ga0157374_10024765 | 3300013296 | Bacteria | 5382 |
| 97 | Ga0157378_10470263 | 3300013297 | Bacteria | 1251 |
| 98 | Ga0163162_10080446 | 3300013306 | Bacteria | 3326 |
| 99 | Ga0157372_10088717 | 3300013307 | Bacteria | 3512 |
| 100 | Ga0157372_10138841 | 3300013307 | Bacteria | 2799 |
| 101 | Ga0157372_10470997 | 3300013307 | Bacteria | 1464 |
| 102 | Ga0157375_10019722 | 3300013308 | Bacteria | 6142 |
| 103 | Ga0157375_10127470 | 3300013308 | Bacteria | 2662 |
| 104 | Ga0163163_10014352 | 3300014325 | Bacteria | 7282 |
| 105 | Ga0163163_10019127 | 3300014325 | Bacteria | 6427 |
| 106 | Ga0163163_10097455 | 3300014325 | Bacteria | 2961 |
| 107 | Ga0182008_10000929 | 3300014497 | Bacteria | 20392 |
| 108 | Ga0157379_10000006 | 3300014968 | Bacteria | 163550 |
| 109 | Ga0157379_10033294 | 3300014968 | Bacteria | 4596 |
| 110 | Ga0157379_10035449 | 3300014968 | Bacteria | 4448 |
| 111 | Ga0157376_10069092 | 3300014969 | Bacteria | 2994 |
| 112 | Ga0182007_10001450 | 3300015262 | Bacteria | 12722 |
| 113 | Ga0197907_11015632 | 3300020069 | Bacteria | 2303 |
| 114 | Ga0206354_11560813 | 3300020081 | Bacteria | 3438 |
| 115 | Ga0206353_10717430 | 3300020082 | Bacteria | 4298 |
| 116 | Ga0206353_11308799 | 3300020082 | Bacteria | 4140 |
| 117 | Ga0207692_10000615 | 3300025898 | Bacteria | 12549 |
| 118 | Ga0207692_10030040 | 3300025898 | Bacteria | 2588 |
| 119 | Ga0207692_10030530 | 3300025898 | Bacteria | 2571 |
| 120 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 121 | Ga0207710_10000062 | 3300025900 | Bacteria | 164192 |
| 122 | Ga0207647_10005923 | 3300025904 | Bacteria | 8914 |
| 123 | Ga0207685_10001127 | 3300025905 | Bacteria | 5320 |
| 124 | Ga0207699_10001054 | 3300025906 | Bacteria | 13009 |
| 125 | Ga0207699_10004118 | 3300025906 | Bacteria | 6968 |
| 126 | Ga0207705_10001985 | 3300025909 | Bacteria | 15905 |
| 127 | Ga0207684_10004433 | 3300025910 | Bacteria | 13229 |
| 128 | Ga0207684_10014848 | 3300025910 | Bacteria | 6703 |
| 129 | Ga0207684_10129617 | 3300025910 | Bacteria | 2165 |
| 130 | Ga0207707_10062685 | 3300025912 | Bacteria | 3235 |
| 131 | Ga0207707_10104783 | 3300025912 | Bacteria | 2472 |
| 132 | Ga0207707_10249693 | 3300025912 | Bacteria | 1541 |
| 133 | Ga0207693_10005243 | 3300025915 | Bacteria | 10847 |
| 134 | Ga0207693_10035294 | 3300025915 | Bacteria | 3942 |
| 135 | Ga0207693_10274950 | 3300025915 | Bacteria | 1320 |
| 136 | Ga0207663_10001428 | 3300025916 | Bacteria | 11093 |
| 137 | Ga0207663_10001914 | 3300025916 | Bacteria | 9858 |
| 138 | Ga0207660_10000922 | 3300025917 | Bacteria | 19398 |
| 139 | Ga0207657_10035610 | 3300025919 | Bacteria | 4462 |
| 140 | Ga0207652_10002431 | 3300025921 | Bacteria | 15721 |
| 141 | Ga0207646_10006323 | 3300025922 | Bacteria | 12271 |
| 142 | Ga0207700_10004975 | 3300025928 | Bacteria | 7901 |
| 143 | Ga0207700_10006449 | 3300025928 | Bacteria | 7086 |
| 144 | Ga0207700_10020995 | 3300025928 | Bacteria | 4449 |
| 145 | Ga0207700_10266600 | 3300025928 | Bacteria | 1468 |
| 146 | Ga0207664_10006398 | 3300025929 | Bacteria | 8101 |
| 147 | Ga0207664_10019296 | 3300025929 | Bacteria | 5036 |
| 148 | Ga0207664_10052461 | 3300025929 | Bacteria | 3225 |
| 149 | Ga0207664_10357288 | 3300025929 | Bacteria | 1294 |
| 150 | Ga0207644_10036699 | 3300025931 | Bacteria | 3443 |
| 151 | Ga0207665_10006062 | 3300025939 | Bacteria | 8028 |
| 152 | Ga0207665_10015461 | 3300025939 | Bacteria | 5009 |
| 153 | Ga0207711_10000101 | 3300025941 | Bacteria | 90693 |
| 154 | Ga0207711_10007004 | 3300025941 | Bacteria | 9459 |
| 155 | Ga0207667_10273749 | 3300025949 | Bacteria | 1726 |
| 156 | Ga0207712_10073889 | 3300025961 | Bacteria | 2460 |
| 157 | Ga0207703_10000006 | 3300026035 | Bacteria | 502351 |
| 158 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 159 | Ga0207703_10012315 | 3300026035 | Bacteria | 6667 |
| 160 | Ga0207639_10028469 | 3300026041 | Bacteria | 4080 |
| 161 | Ga0207678_10075241 | 3300026067 | Bacteria | 2892 |
| 162 | Ga0207702_10077473 | 3300026078 | Bacteria | 2875 |
| 163 | Ga0207674_10019442 | 3300026116 | Bacteria | 7355 |
| 164 | Ga0207683_10347921 | 3300026121 | Bacteria | 1360 |
| 165 | Ga0207698_10114938 | 3300026142 | Bacteria | 2265 |
| 166 | Ga0209813_10011539 | 3300027866 | Bacteria | 2312 |
| 167 | Ga0268266_10238348 | 3300028379 | Bacteria | 1678 |
| 168 | Ga0268265_10000041 | 3300028380 | Bacteria | 189918 |
| 169 | Ga0307515_10000054 | 3300028794 | Bacteria | 265489 |
| 170 | Ga0265338_10021619 | 3300028800 | Bacteria | 6699 |
| 171 | Ga0307511_10028569 | 3300030521 | Bacteria | 5058 |
| 172 | Ga0307511_10163752 | 3300030521 | Bacteria | 1240 |
| 173 | Ga0307512_10002026 | 3300030522 | Bacteria | 26815 |
| 174 | Ga0307512_10152660 | 3300030522 | Bacteria | 1376 |
| 175 | Ga0307509_10116597 | 3300031507 | Bacteria | 2660 |
| 176 | Ga0307509_10169199 | 3300031507 | Bacteria | 2068 |
| 177 | Ga0307508_10011754 | 3300031616 | Bacteria | 8001 |
| 178 | Ga0307508_10041711 | 3300031616 | Bacteria | 4117 |
| 179 | Ga0307508_10059008 | 3300031616 | Bacteria | 3394 |
| 180 | Ga0307514_10003625 | 3300031649 | Bacteria | 14660 |
| 181 | Ga0307514_10066601 | 3300031649 | Bacteria | 2723 |
| 182 | Ga0307516_10006631 | 3300031730 | Bacteria | 13535 |
| 183 | Ga0307516_10009273 | 3300031730 | Bacteria | 11003 |
| 184 | Ga0307410_10163379 | 3300031852 | Bacteria | 1671 |
| 185 | Ga0307416_100030663 | 3300032002 | Bacteria | 4037 |
| 186 | Ga0307416_100292473 | 3300032002 | Bacteria | 1613 |
| 187 | Ga0307414_10203893 | 3300032004 | Bacteria | 1611 |
| 188 | Ga0307415_100026328 | 3300032126 | Bacteria | 3666 |
| 189 | Ga0307507_10017784 | 3300033179 | Bacteria | 8136 |
| 190 | Ga0307507_10056236 | 3300033179 | Bacteria | 3720 |
| 191 | Ga0307510_10017828 | 3300033180 | Bacteria | 8364 |
| 192 | Ga0373930_0019647 | 3300034816 | Bacteria | 1309 |
| 193 | Ga0373948_0012891 | 3300034817 | Bacteria | 1500 |
| 194 | Ga0373926_0020962 | 3300035083 | Bacteria | 2260 |
| 195 | Ga0373928_0008290 | 3300035084 | Bacteria | 2015 |
| 196 | Ga0373940_0011866 | 3300035088 | Bacteria | 2078 |
| 197 | Ga0373949_0002480 | 3300035090 | Bacteria | 4722 |
| 198 | Ga0373923_0002198 | 3300035111 | Bacteria | 5929 |
| 199 | Ga0373932_0065499 | 3300035112 | Bacteria | 1114 |
| 200 | Ga0373936_0007872 | 3300035113 | Bacteria | 4002 |
| 201 | Ga0373954_0113108 | 3300035118 | Bacteria | 1314 |
| 202 | Ga0373956_0010151 | 3300035119 | Bacteria | 3847 |
| 203 | Ga0373956_0028690 | 3300035119 | Bacteria | 2422 |
| 204 | Ga0373956_0033239 | 3300035119 | Bacteria | 2267 |
| 205 | Ga0373956_0125915 | 3300035119 | Bacteria | 1198 |
| 206 | Ga0373942_0019767 | 3300035207 | Bacteria | 1684 |
| 207 | Ga0373924_0111921 | 3300035410 | Bacteria | 1180 |
| 208 | Ga0373935_0104785 | 3300035692 | Bacteria | 1869 |
| 209 | Ga0373935_0132625 | 3300035692 | Bacteria | 1675 |
| 210 | Ga0373947_0104801 | 3300035725 | Bacteria | 1781 |
| 211 | Ga0373937_0213145 | 3300036401 | Bacteria | 1817 |
| 212 | Ga0373925_0000542 | 3300037068 | Bacteria | 37258 |
| 213 | Ga0373925_0029303 | 3300037068 | Bacteria | 4038 |
| 214 | Ga0395900_0352181 | 3300037418 | Bacteria | 1446 |
| 215 | Ga0395898_0015186 | 3300037466 | Bacteria | 7905 |
| 216 | Ga0395898_0035965 | 3300037466 | Bacteria | 4922 |
| 217 | Ga0395898_0039470 | 3300037466 | Bacteria | 4673 |
| 218 | Ga0395901_0070511 | 3300038443 | Bacteria | 3641 |
| 219 | Ga0439436_0000715 | 3300041404 | Bacteria | 8957 |
| 220 | Ga0439436_0001354 | 3300041404 | Bacteria | 7050 |
| 221 | Ga0451837_1287300 | 3300041494 | Bacteria | 1206 |
| 222 | Ga0451853_0626903 | 3300041512 | Bacteria | 3208 |
| 223 | Ga0451853_4094857 | 3300041512 | Bacteria | 1602 |
| 224 | Ga0439433_0002539 | 3300041999 | Bacteria | 3874 |
| 225 | Ga0439433_0005844 | 3300041999 | Bacteria | 2644 |
| 226 | Ga0439449_0000470 | 3300042007 | Bacteria | 15054 |
| 227 | Ga0439457_000081 | 3300042014 | Bacteria | 21387 |
| 228 | Ga0439457_001368 | 3300042014 | Bacteria | 7338 |
| 229 | Ga0439462_0002757 | 3300042015 | Bacteria | 4125 |
| 230 | Ga0450894_000122 | 3300042131 | Bacteria | 13464 |
| 231 | Ga0450903_000534 | 3300042138 | Bacteria | 7949 |
| 232 | Ga0450903_006394 | 3300042138 | Bacteria | 1957 |
| 233 | Ga0466972_0006575 | 3300044658 | Bacteria | 5837 |
| 234 | Ga0466972_0157447 | 3300044658 | Bacteria | 1067 |
| 235 | Ga0466965_0071319 | 3300044683 | Bacteria | 1747 |
| 236 | Ga0466965_0094684 | 3300044683 | Bacteria | 1522 |
| 237 | Ga0466966_0000217 | 3300044684 | Bacteria | 38595 |
| 238 | Ga0466966_0088827 | 3300044684 | Bacteria | 1920 |
| 239 | Ga0466966_0090306 | 3300044684 | Bacteria | 1902 |
| 240 | Ga0466961_0005247 | 3300044693 | Bacteria | 8156 |
| 241 | Ga0466961_0045463 | 3300044693 | Bacteria | 2809 |
| 242 | Ga0466961_0061464 | 3300044693 | Bacteria | 2387 |
| 243 | Ga0466961_0087464 | 3300044693 | Bacteria | 1969 |
| 244 | Ga0466963_0016065 | 3300044694 | Bacteria | 4648 |
| 245 | Ga0466963_0089772 | 3300044694 | Bacteria | 2091 |
| 246 | Ga0466964_0001247 | 3300044706 | Bacteria | 8641 |
| 247 | Ga0466964_0015375 | 3300044706 | Bacteria | 2912 |
| 248 | Ga0466964_0045741 | 3300044706 | Bacteria | 1782 |
| 249 | Ga0466964_0077842 | 3300044706 | Bacteria | 1416 |
| 250 | Ga0466971_0000341 | 3300044719 | Bacteria | 17902 |
| 251 | Ga0466971_0006344 | 3300044719 | Bacteria | 5134 |
| 252 | Ga0466968_0094657 | 3300044735 | Bacteria | 1328 |
| 253 | Ga0466970_0000466 | 3300044765 | Bacteria | 20041 |
| 254 | Ga0466970_0057726 | 3300044765 | Bacteria | 2076 |
| 255 | Ga0466970_0067967 | 3300044765 | Bacteria | 1914 |
| 256 | Ga0466957_0000214 | 3300044842 | Bacteria | 27239 |
| 257 | Ga0466960_0114624 | 3300044901 | Bacteria | 1404 |
| 258 | Ga0466960_0157659 | 3300044901 | Bacteria | 1217 |
| 259 | Ga0466959_0001039 | 3300045049 | Bacteria | 16627 |
| 260 | Ga0466959_0036113 | 3300045049 | Bacteria | 3652 |
| 261 | Ga0466959_0085849 | 3300045049 | Bacteria | 2264 |
| 262 | Ga0466959_0160949 | 3300045049 | Bacteria | 1578 |
| 263 | Ga0466958_0004329 | 3300045836 | Bacteria | 7479 |
| 264 | Ga0466958_0009130 | 3300045836 | Bacteria | 5512 |
| 265 | Ga0466958_0043457 | 3300045836 | Bacteria | 2706 |
| 266 | Ga0466967_0036607 | 3300045976 | Bacteria | 4191 |
| 267 | Ga0466967_0075672 | 3300045976 | Bacteria | 3026 |
| 268 | Ga0466967_0204825 | 3300045976 | Bacteria | 1869 |
| 269 | Ga0466967_0248969 | 3300045976 | Bacteria | 1697 |
| 270 | Ga0495592_0005585 | 3300046454 | Bacteria | 9299 |
| 271 | Ga0495592_0018516 | 3300046454 | Bacteria | 5297 |
| 272 | Ga0495592_0122960 | 3300046454 | Bacteria | 1823 |
| 273 | Ga0495603_0014669 | 3300046455 | Bacteria | 4737 |
| 274 | Ga0495603_0027768 | 3300046455 | Bacteria | 3413 |
| 275 | Ga0495629_0001149 | 3300046459 | Bacteria | 20896 |
| 276 | Ga0495629_0146887 | 3300046459 | Bacteria | 1639 |
| 277 | Ga0495641_0017379 | 3300046461 | Bacteria | 3750 |
| 278 | Ga0495651_0001081 | 3300046462 | Bacteria | 21021 |
| 279 | Ga0495651_0007864 | 3300046462 | Bacteria | 8167 |
| 280 | Ga0495651_0010218 | 3300046462 | Bacteria | 7206 |
| 281 | Ga0495651_0259011 | 3300046462 | Bacteria | 1184 |
| 282 | Ga0495653_0011295 | 3300046463 | Bacteria | 7298 |
| 283 | Ga0495580_0036373 | 3300046472 | Bacteria | 3535 |
| 284 | Ga0495639_0022056 | 3300046475 | Bacteria | 2791 |
| 285 | Ga0495662_0001125 | 3300046476 | Bacteria | 13181 |
| 286 | Ga0495662_0012229 | 3300046476 | Bacteria | 4191 |
| 287 | Ga0495662_0030807 | 3300046476 | Bacteria | 2589 |
| 288 | Ga0495662_0032519 | 3300046476 | Bacteria | 2520 |
| 289 | Ga0495664_0006458 | 3300046477 | Bacteria | 6479 |
| 290 | Ga0495664_0017243 | 3300046477 | Bacteria | 4126 |
| 291 | Ga0495664_0054255 | 3300046477 | Bacteria | 2383 |
| 292 | Ga0495664_0064155 | 3300046477 | Bacteria | 2189 |
| 293 | Ga0495664_0181362 | 3300046477 | Bacteria | 1276 |
| 294 | Ga0495585_0009078 | 3300046492 | Bacteria | 5988 |
| 295 | Ga0495594_0000163 | 3300046499 | Bacteria | 31842 |
| 296 | Ga0495594_0033409 | 3300046499 | Bacteria | 2797 |
| 297 | Ga0495607_0073808 | 3300046501 | Bacteria | 1895 |
| 298 | Ga0495583_0063341 | 3300046506 | Bacteria | 1644 |
| 299 | Ga0495608_0018852 | 3300046511 | Bacteria | 4754 |
| 300 | Ga0495608_0040534 | 3300046511 | Bacteria | 3119 |
| 301 | Ga0495618_0037473 | 3300046514 | Bacteria | 3045 |
| 302 | Ga0495618_0068165 | 3300046514 | Bacteria | 2263 |
| 303 | Ga0495628_0005062 | 3300046516 | Bacteria | 11581 |
| 304 | Ga0495628_0019788 | 3300046516 | Bacteria | 5559 |
| 305 | Ga0495628_0046615 | 3300046516 | Bacteria | 3442 |
| 306 | Ga0495630_0018508 | 3300046517 | Bacteria | 5117 |
| 307 | Ga0495630_0125903 | 3300046517 | Bacteria | 1944 |
| 308 | Ga0495643_0044441 | 3300046522 | Bacteria | 2414 |
| 309 | Ga0495648_0052340 | 3300046524 | Bacteria | 2480 |
| 310 | Ga0495666_0004555 | 3300046526 | Bacteria | 7003 |
| 311 | Ga0495666_0028708 | 3300046526 | Bacteria | 2737 |
| 312 | Ga0495652_0018511 | 3300046529 | Bacteria | 6209 |
| 313 | Ga0495652_0045461 | 3300046529 | Bacteria | 3774 |
| 314 | Ga0495652_0058387 | 3300046529 | Bacteria | 3266 |
| 315 | Ga0495652_0148484 | 3300046529 | Bacteria | 1834 |
| 316 | Ga0495665_0003532 | 3300046531 | Bacteria | 8489 |
| 317 | Ga0495665_0062895 | 3300046531 | Bacteria | 1959 |
| 318 | Ga0495640_0024632 | 3300046533 | Bacteria | 4376 |
| 319 | Ga0495640_0027229 | 3300046533 | Bacteria | 4124 |
| 320 | Ga0495640_0070581 | 3300046533 | Bacteria | 2346 |
| 321 | Ga0495640_0076066 | 3300046533 | Bacteria | 2240 |
| 322 | Ga0495640_0079904 | 3300046533 | Bacteria | 2176 |
| 323 | Ga0495586_0013171 | 3300046535 | Bacteria | 4384 |
| 324 | Ga0495586_0018187 | 3300046535 | Bacteria | 3740 |
| 325 | Ga0495587_0001121 | 3300046536 | Bacteria | 17517 |
| 326 | Ga0495587_0004877 | 3300046536 | Bacteria | 8803 |
| 327 | Ga0495587_0007689 | 3300046536 | Bacteria | 6972 |
| 328 | Ga0495587_0038458 | 3300046536 | Bacteria | 2867 |
| 329 | Ga0495645_0000713 | 3300046543 | Bacteria | 22830 |
| 330 | Ga0495645_0006917 | 3300046543 | Bacteria | 7881 |
| 331 | Ga0495645_0016162 | 3300046543 | Bacteria | 5321 |
| 332 | Ga0495645_0021659 | 3300046543 | Bacteria | 4645 |
| 333 | Ga0495645_0050854 | 3300046543 | Bacteria | 3015 |
| 334 | Ga0495645_0322887 | 3300046543 | Bacteria | 1002 |
| 335 | Ga0495622_0038241 | 3300046557 | Bacteria | 2234 |
| 336 | Ga0495667_0007290 | 3300046559 | Bacteria | 7503 |
| 337 | Ga0495667_0014283 | 3300046559 | Bacteria | 5363 |
| 338 | Ga0495667_0182224 | 3300046559 | Bacteria | 1347 |
| 339 | Ga0495634_0042148 | 3300046642 | Bacteria | 3097 |
| 340 | Ga0495634_0060547 | 3300046642 | Bacteria | 2518 |
| 341 | Ga0495634_0095676 | 3300046642 | Bacteria | 1923 |
| 342 | Ga0495634_0173065 | 3300046642 | Bacteria | 1356 |
| 343 | Ga0495625_0011317 | 3300046660 | Bacteria | 7284 |
| 344 | Ga0495635_0004210 | 3300046663 | Bacteria | 9978 |
| 345 | Ga0495635_0015754 | 3300046663 | Bacteria | 5280 |
| 346 | Ga0495635_0017883 | 3300046663 | Bacteria | 4950 |
| 347 | Ga0495635_0106593 | 3300046663 | Bacteria | 1914 |
| 348 | Ga0495588_0000781 | 3300046674 | Bacteria | 14423 |
| 349 | Ga0495588_0042715 | 3300046674 | Bacteria | 2318 |
| 350 | Ga0495657_0023461 | 3300046675 | Bacteria | 4407 |
| 351 | Ga0495657_0029030 | 3300046675 | Bacteria | 3882 |
| 352 | Ga0495599_0022905 | 3300046678 | Bacteria | 3901 |
| 353 | Ga0495599_0027934 | 3300046678 | Bacteria | 3534 |
| 354 | Ga0495599_0167066 | 3300046678 | Bacteria | 1358 |
| 355 | Ga0495623_0012742 | 3300046679 | Bacteria | 5445 |
| 356 | Ga0495623_0014060 | 3300046679 | Bacteria | 5185 |
| 357 | Ga0495623_0081349 | 3300046679 | Bacteria | 2003 |
| 358 | Ga0495623_0208047 | 3300046679 | Bacteria | 1121 |
| 359 | Ga0495646_0000644 | 3300046680 | Bacteria | 19077 |
| 360 | Ga0495646_0001196 | 3300046680 | Bacteria | 15185 |
| 361 | Ga0495646_0047834 | 3300046680 | Bacteria | 2601 |
| 362 | Ga0495646_0115954 | 3300046680 | Bacteria | 1520 |
| 363 | Ga0495647_0022019 | 3300046681 | Bacteria | 2301 |
| 364 | Ga0495658_0071839 | 3300046683 | Bacteria | 2011 |
| 365 | Ga0495658_0316707 | 3300046683 | Bacteria | 988 |
| 366 | Ga0495669_0009761 | 3300046684 | Bacteria | 4052 |
| 367 | Ga0495613_0116797 | 3300046689 | Bacteria | 1918 |
| 368 | Ga0495613_0265957 | 3300046689 | Bacteria | 1193 |
| 369 | Ga0495624_0049937 | 3300046690 | Bacteria | 2651 |
| 370 | Ga0495624_0077908 | 3300046690 | Bacteria | 2056 |
| 371 | Ga0495671_0043769 | 3300046692 | Bacteria | 2247 |
| 372 | Ga0495589_0012131 | 3300046794 | Bacteria | 4468 |
| 373 | Ga0495600_0006892 | 3300046809 | Bacteria | 6928 |
| 374 | Ga0495600_0009171 | 3300046809 | Bacteria | 6102 |
| 375 | Ga0495600_0034814 | 3300046809 | Bacteria | 3270 |
| 376 | Ga0495600_0087414 | 3300046809 | Bacteria | 2033 |
| 377 | Ga0495581_0000875 | 3300047315 | Bacteria | 16076 |
| 378 | Ga0495581_0009713 | 3300047315 | Bacteria | 5568 |
| 379 | Ga0495581_0045951 | 3300047315 | Bacteria | 2524 |
| 380 | Ga0495604_0002519 | 3300047317 | Bacteria | 14623 |
| 381 | Ga0495604_0004390 | 3300047317 | Bacteria | 11163 |
| 382 | Ga0495604_0043829 | 3300047317 | Bacteria | 3499 |
| 383 | Ga0495604_0052569 | 3300047317 | Bacteria | 3153 |
| 384 | Ga0495604_0107136 | 3300047317 | Bacteria | 2043 |
| 385 | Ga0495636_0074676 | 3300047318 | Bacteria | 1452 |
| 386 | Ga0495674_0006822 | 3300047319 | Bacteria | 10933 |
| 387 | Ga0495674_0042932 | 3300047319 | Bacteria | 4029 |
| 388 | Ga0495674_0212122 | 3300047319 | Bacteria | 1603 |
| 389 | Ga0495674_0302324 | 3300047319 | Bacteria | 1306 |
| 390 | Ga0495676_0016661 | 3300047321 | Bacteria | 6511 |
| 391 | Ga0495680_0021505 | 3300047322 | Bacteria | 5398 |
| 392 | Ga0495683_0022425 | 3300047323 | Bacteria | 3247 |
| 393 | Ga0495687_001961 | 3300047443 | Bacteria | 17573 |
| 394 | Ga0495675_0015668 | 3300047444 | Bacteria | 4792 |
| 395 | Ga0495675_0026964 | 3300047444 | Bacteria | 3662 |
| 396 | Ga0495675_0037333 | 3300047444 | Bacteria | 3094 |
| 397 | Ga0495675_0045125 | 3300047444 | Bacteria | 2806 |
| 398 | Ga0495675_0051183 | 3300047444 | Bacteria | 2624 |
| 399 | Ga0495685_009066 | 3300047447 | Bacteria | 3316 |
| 400 | Ga0495681_0000977 | 3300047470 | Bacteria | 21843 |
| 401 | Ga0495684_0058423 | 3300047471 | Bacteria | 2938 |
| 402 | Ga0495684_0066552 | 3300047471 | Bacteria | 2739 |
| 403 | Ga0495686_0015711 | 3300047472 | Bacteria | 5158 |
| 404 | Ga0495686_0185764 | 3300047472 | Bacteria | 1201 |
| 405 | Ga0495593_0011674 | 3300047673 | Bacteria | 5040 |
| 406 | Ga0495593_0024864 | 3300047673 | Bacteria | 3315 |
| 407 | Ga0495593_0066189 | 3300047673 | Bacteria | 1883 |
| 408 | Ga0495602_0027606 | 3300048088 | Bacteria | 5452 |
| 409 | Ga0495602_0030488 | 3300048088 | Bacteria | 5113 |
| 410 | Ga0495602_0086712 | 3300048088 | Bacteria | 2612 |
| 411 | Ga0495602_0293168 | 3300048088 | Bacteria | 1193 |
| 412 | Ga0496102_0029390 | 3300048905 | Bacteria | 4919 |
| 413 | Ga0496102_0194983 | 3300048905 | Bacteria | 1909 |
| 414 | Ga0496102_0312768 | 3300048905 | Bacteria | 1480 |
| 415 | Ga0496104_0035652 | 3300048907 | Bacteria | 4645 |
| 416 | Ga0496105_0008714 | 3300048908 | Bacteria | 7892 |
| 417 | Ga0496105_0282925 | 3300048908 | Bacteria | 1337 |
| 418 | Ga0496105_0328314 | 3300048908 | Bacteria | 1225 |
| 419 | Ga0496106_0038305 | 3300048909 | Bacteria | 3587 |
| 420 | Ga0496106_0065205 | 3300048909 | Bacteria | 2773 |
| 421 | Ga0496106_0136668 | 3300048909 | Bacteria | 1926 |
| 422 | Ga0496107_0013392 | 3300048910 | Bacteria | 5731 |
| 423 | Ga0496108_0015514 | 3300048911 | Bacteria | 6213 |
| 424 | Ga0496108_0120986 | 3300048911 | Bacteria | 2245 |
| 425 | Ga0496109_0098655 | 3300048912 | Bacteria | 2708 |
| 426 | Ga0496109_0208785 | 3300048912 | Bacteria | 1836 |
| 427 | Ga0496110_0016201 | 3300048913 | Bacteria | 6217 |
| 428 | Ga0496111_0012859 | 3300048914 | Bacteria | 5679 |
| 429 | Ga0496112_0041583 | 3300048915 | Bacteria | 4498 |
| 430 | Ga0496112_0098133 | 3300048915 | Bacteria | 2899 |
| 431 | Ga0496112_0131537 | 3300048915 | Bacteria | 2473 |
| 432 | Ga0496112_0144447 | 3300048915 | Bacteria | 2348 |
| 433 | Ga0496113_0014044 | 3300048916 | Bacteria | 5450 |
| 434 | Ga0496114_0062188 | 3300048917 | Bacteria | 3124 |
| 435 | Ga0496114_0167950 | 3300048917 | Bacteria | 1911 |
| 436 | Ga0496115_0014348 | 3300048918 | Bacteria | 5997 |
| 437 | Ga0496115_0033045 | 3300048918 | Bacteria | 4083 |
| 438 | Ga0496116_0004891 | 3300048919 | Bacteria | 12635 |
| 439 | Ga0496117_0020816 | 3300048920 | Bacteria | 5337 |
| 440 | Ga0496118_0009917 | 3300048921 | Bacteria | 9518 |
| 441 | Ga0496118_0071373 | 3300048921 | Bacteria | 2500 |
| 442 | Ga0496119_0002564 | 3300048922 | Bacteria | 19763 |
| 443 | Ga0496119_0019145 | 3300048922 | Bacteria | 5058 |
| 444 | Ga0496119_0020007 | 3300048922 | Bacteria | 4900 |
| 445 | Ga0496119_0085747 | 3300048922 | Bacteria | 1802 |
| 446 | Ga0496120_0000050 | 3300048923 | Bacteria | 187078 |
| 447 | Ga0496121_0029396 | 3300048924 | Bacteria | 5082 |
| 448 | Ga0496121_0057707 | 3300048924 | Bacteria | 3215 |
| 449 | Ga0496126_0000040 | 3300048929 | Bacteria | 345144 |
| 450 | Ga0496126_0238173 | 3300048929 | Bacteria | 1522 |
| 451 | Ga0496126_0364842 | 3300048929 | Bacteria | 1179 |
| 452 | Ga0501031_0106713 | 3300049568 | Bacteria | 1828 |
| 453 | Ga0501033_0001282 | 3300049570 | Bacteria | 22418 |
| 454 | Ga0501034_0034100 | 3300049571 | Bacteria | 5161 |
| 455 | Ga0501034_0167912 | 3300049571 | Bacteria | 2162 |
| 456 | Ga0501036_0004558 | 3300049572 | Bacteria | 11193 |
| 457 | Ga0501037_0029472 | 3300049573 | Bacteria | 4054 |
| 458 | Ga0501037_0089835 | 3300049573 | Bacteria | 2223 |
| 459 | Ga0501038_0159879 | 3300049574 | Bacteria | 1831 |
| 460 | Ga0501042_0145729 | 3300049578 | Bacteria | 1707 |
| 461 | Ga0501043_0058840 | 3300049579 | Bacteria | 3016 |
| 462 | Ga0501046_0124073 | 3300049580 | Bacteria | 1963 |
| 463 | Ga0501047_0013258 | 3300049581 | Bacteria | 7807 |
| 464 | Ga0501069_0002925 | 3300049585 | Bacteria | 8768 |
| 465 | Ga0501070_0002547 | 3300049586 | Bacteria | 15964 |
| 466 | Ga0501074_0054062 | 3300049590 | Bacteria | 2896 |
| 467 | Ga0501080_0002688 | 3300049742 | Bacteria | 15576 |
| 468 | Ga0501045_0109797 | 3300049824 | Bacteria | 2045 |
| 469 | Ga0501045_0125624 | 3300049824 | Bacteria | 1906 |
| 470 | nmdc:mga06z11_48775_c1 | 3300050494 | Bacteria | 2157 |
| 471 | nmdc:mga04h51_22830_c1 | 3300050495 | Bacteria | 1898 |
| 472 | nmdc:mga05p37_4314_c1 | 3300050507 | Bacteria | 16614 |
| 473 | nmdc:mga09592_33302_c1 | 3300050508 | Bacteria | 4301 |
| 474 | nmdc:mga0qj67_116034_c1 | 3300050509 | Bacteria | 2164 |
| 475 | nmdc:mga06r32_6544_c1 | 3300050510 | Bacteria | 10469 |
| 476 | nmdc:mga0n895_115037_c1 | 3300050512 | Bacteria | 2708 |
| 477 | nmdc:mga0rr50_36182_c1 | 3300050513 | Bacteria | 3553 |
| 478 | nmdc:mga08x19_66118_c1 | 3300050514 | Bacteria | 2349 |
| 479 | nmdc:mga0a205_21928_c1 | 3300050515 | Bacteria | 2504 |
| 480 | Ga0495601_0212905 | 3300053077 | Bacteria | 1262 |
| 481 | Ga0495612_0087982 | 3300053078 | Bacteria | 1312 |
| 482 | Ga0495612_0131746 | 3300053078 | Bacteria | 1080 |
| 483 | Ga0495655_0005824 | 3300053083 | Bacteria | 2201 |
| 484 | Ga0495619_0036673 | 3300053085 | Bacteria | 3193 |
| 485 | Ga0495619_0099632 | 3300053085 | Bacteria | 1976 |
| 486 | Ga0495619_0108552 | 3300053085 | Bacteria | 1894 |
| 487 | Ga0500643_000413 | 3300053087 | Bacteria | 32620 |
| 488 | Ga0500640_045372 | 3300053095 | Bacteria | 1927 |
| 489 | Ga0500641_0020262 | 3300053096 | Bacteria | 2524 |
| 490 | Ga0500560_000463 | 3300053107 | Bacteria | 5646 |
| 491 | Ga0500572_005113 | 3300053111 | Bacteria | 2967 |
| 492 | Ga0500586_081029 | 3300053145 | Bacteria | 1139 |
| 493 | Ga0500600_0096668 | 3300053149 | Bacteria | 1566 |
| 494 | Ga0590074_007776 | 3300059423 | Bacteria | 1783 |
| 495 | Ga0590075_003849 | 3300059424 | Bacteria | 3557 |
| 496 | Ga0590077_010663 | 3300059426 | Bacteria | 1891 |
| 497 | Ga0466962_0000800 | 3300061719 | Bacteria | 14178 |
| 498 | Ga0466962_0067193 | 3300061719 | Bacteria | 1711 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048088 | Ga0495602_0293168 | Ga0495602_0293168_17_811 | 242 |
| 2 | 3300005842 | Ga0068858_100018475 | Ga0068858_1000184753 | 257 |
| 3 | 3300026035 | Ga0207703_10012315 | Ga0207703_100123153 | 257 |
| 4 | 3300048909 | Ga0496106_0065205 | Ga0496106_0065205_1415_2320 | 259 |
| 5 | 3300005356 | Ga0070674_100328344 | Ga0070674_1003283442 | 267 |
| 6 | 3300044684 | Ga0466966_0088827 | Ga0466966_0088827_111_1052 | 267 |
| 7 | 3300044693 | Ga0466961_0005247 | Ga0466961_0005247_2734_3675 | 267 |
| 8 | 3300045049 | Ga0466959_0036113 | Ga0466959_0036113_1222_2163 | 267 |
| 9 | 3300033179 | Ga0307507_10017784 | Ga0307507_100177844 | 270 |
| 10 | 3300044693 | Ga0466961_0061464 | Ga0466961_0061464_412_1353 | 273 |
| 11 | 3300045049 | Ga0466959_0160949 | Ga0466959_0160949_451_1395 | 274 |
| 12 | 3300009101 | Ga0105247_10002589 | Ga0105247_100025894 | 275 |
| 13 | 3300025900 | Ga0207710_10000062 | Ga0207710_1000006268 | 275 |
| 14 | 3300025941 | Ga0207711_10000101 | Ga0207711_1000010128 | 276 |
| 15 | 3300045836 | Ga0466958_0009130 | Ga0466958_0009130_2549_3526 | 276 |
| 16 | 3300006931 | Ga0097620_100004481 | Ga0097620_1000044814 | 277 |
| 17 | 3300044694 | Ga0466963_0089772 | Ga0466963_0089772_741_1718 | 277 |
| 18 | 3300048924 | Ga0496121_0057707 | Ga0496121_0057707_1051_2142 | 277 |
| 19 | 3300005842 | Ga0068858_100000337 | Ga0068858_10000033734 | 278 |
| 20 | 3300009177 | Ga0105248_10000219 | Ga0105248_1000021947 | 278 |
| 21 | 3300026035 | Ga0207703_10000006 | Ga0207703_1000000668 | 278 |
| 22 | 3300044735 | Ga0466968_0094657 | Ga0466968_0094657_364_1305 | 278 |
| 23 | 3300048921 | Ga0496118_0071373 | Ga0496118_0071373_1252_2226 | 278 |
| 24 | 3300048922 | Ga0496119_0019145 | Ga0496119_0019145_11_1102 | 278 |
| 25 | 3300044683 | Ga0466965_0071319 | Ga0466965_0071319_287_1228 | 279 |
| 26 | 3300044694 | Ga0466963_0016065 | Ga0466963_0016065_1315_2256 | 279 |
| 27 | 3300044706 | Ga0466964_0001247 | Ga0466964_0001247_2898_3839 | 279 |
| 28 | 3300044719 | Ga0466971_0006344 | Ga0466971_0006344_203_1144 | 279 |
| 29 | 3300044765 | Ga0466970_0057726 | Ga0466970_0057726_772_1713 | 279 |
| 30 | 3300045836 | Ga0466958_0004329 | Ga0466958_0004329_3813_4754 | 279 |
| 31 | 3300045976 | Ga0466967_0204825 | Ga0466967_0204825_629_1570 | 279 |
| 32 | 3300046684 | Ga0495669_0009761 | Ga0495669_0009761_1503_2432 | 279 |
| 33 | 3300005548 | Ga0070665_100385037 | Ga0070665_1003850373 | 280 |
| 34 | 3300013105 | Ga0157369_10152352 | Ga0157369_101523523 | 280 |
| 35 | 3300032002 | Ga0307416_100030663 | Ga0307416_1000306632 | 281 |
| 36 | 3300032126 | Ga0307415_100026328 | Ga0307415_1000263284 | 281 |
| 37 | iso_pu_bacteria | 2517572101 | 2517762693 | 281 |
| 38 | 3300059423 | Ga0590074_007776 | Ga0590074_007776_368_1300 | 282 |
| 39 | 3300059424 | Ga0590075_003849 | Ga0590075_003849_2536_3468 | 282 |
| 40 | 3300059426 | Ga0590077_010663 | Ga0590077_010663_522_1454 | 282 |
| 41 | 3300009098 | Ga0105245_10103592 | Ga0105245_101035922 | 283 |
| 42 | 3300044706 | Ga0466964_0015375 | Ga0466964_0015375_494_1465 | 283 |
| 43 | iso_pu_bacteria | 2622736626 | 2623586712 | 283 |
| 44 | iso_pu_bacteria | 2855683550 | 2855684878 | 283 |
| 45 | iso_pu_bacteria | 2856858025 | 2856860627 | 283 |
| 46 | iso_pu_bacteria | 2867302475 | 2867304064 | 283 |
| 47 | iso_pu_bacteria | 2867319477 | 2867325115 | 283 |
| 48 | iso_pu_bacteria | 2867507094 | 2867509570 | 283 |
| 49 | iso_pu_bacteria | 2902582711 | 2902586114 | 283 |
| 50 | iso_pu_bacteria | 649633069 | 649811362 | 283 |
| 51 | iso_pu_bacteria | 8055412473 | 8055417330 | 283 |
| 52 | 3300041404 | Ga0439436_0001354 | Ga0439436_0001354_3006_3965 | 284 |
| 53 | 3300041999 | Ga0439433_0002539 | Ga0439433_0002539_1300_2259 | 284 |
| 54 | 3300042014 | Ga0439457_001368 | Ga0439457_001368_1172_2131 | 284 |
| 55 | 3300042015 | Ga0439462_0002757 | Ga0439462_0002757_1724_2683 | 284 |
| 56 | iso_pu_bacteria | 2506783011 | 2506865629 | 284 |
| 57 | iso_pu_bacteria | 2508501039 | 2508670465 | 284 |
| 58 | iso_pu_bacteria | 2527291627 | 2528202507 | 284 |
| 59 | iso_pu_bacteria | 2527291629 | 2528212448 | 284 |
| 60 | iso_pu_bacteria | 2546825537 | 2546947174 | 284 |
| 61 | iso_pu_bacteria | 2576861822 | 2579747324 | 284 |
| 62 | iso_pu_bacteria | 2579778521 | 2579854048 | 284 |
| 63 | iso_pu_bacteria | 2619618881 | 2619854288 | 284 |
| 64 | iso_pu_bacteria | 2619619003 | 2620350268 | 284 |
| 65 | iso_pu_bacteria | 2626541554 | 2626635984 | 284 |
| 66 | iso_pu_bacteria | 2643221690 | 2644506664 | 284 |
| 67 | iso_pu_bacteria | 2643221694 | 2644526430 | 284 |
| 68 | iso_pu_bacteria | 2643221722 | 2644671096 | 284 |
| 69 | iso_pu_bacteria | 2684623036 | 2686541328 | 284 |
| 70 | iso_pu_bacteria | 2687453737 | 2689961901 | 284 |
| 71 | iso_pu_bacteria | 2710264753 | 2710602240 | 284 |
| 72 | iso_pu_bacteria | 2773857924 | 2774868194 | 284 |
| 73 | iso_pu_bacteria | 2773857933 | 2774903559 | 284 |
| 74 | iso_pu_bacteria | 8002775197 | 8002784085 | 284 |
| 75 | iso_pu_bacteria | 8054913762 | 8054920419 | 284 |
| 76 | iso_pu_bacteria | 8054920844 | 8054927460 | 284 |
| 77 | iso_pu_bacteria | 8055157932 | 8055161559 | 284 |
| 78 | 3300005548 | Ga0070665_100132857 | Ga0070665_1001328573 | 285 |
| 79 | 3300005618 | Ga0068864_100050286 | Ga0068864_1000502862 | 285 |
| 80 | 3300006237 | Ga0097621_100014530 | Ga0097621_1000145303 | 285 |
| 81 | 3300006358 | Ga0068871_100050287 | Ga0068871_1000502873 | 285 |
| 82 | 3300006871 | Ga0075434_100324665 | Ga0075434_1003246652 | 285 |
| 83 | 3300009101 | Ga0105247_10000016 | Ga0105247_1000001667 | 285 |
| 84 | 3300009177 | Ga0105248_10007652 | Ga0105248_100076526 | 285 |
| 85 | 3300009177 | Ga0105248_10213047 | Ga0105248_102130472 | 285 |
| 86 | 3300010375 | Ga0105239_10370160 | Ga0105239_103701602 | 285 |
| 87 | 3300013104 | Ga0157370_10011957 | Ga0157370_100119572 | 285 |
| 88 | 3300013104 | Ga0157370_10136981 | Ga0157370_101369812 | 285 |
| 89 | 3300013105 | Ga0157369_10175835 | Ga0157369_101758352 | 285 |
| 90 | 3300013296 | Ga0157374_10024765 | Ga0157374_100247654 | 285 |
| 91 | 3300013297 | Ga0157378_10470263 | Ga0157378_104702631 | 285 |
| 92 | 3300013307 | Ga0157372_10138841 | Ga0157372_101388412 | 285 |
| 93 | 3300013308 | Ga0157375_10127470 | Ga0157375_101274702 | 285 |
| 94 | 3300014325 | Ga0163163_10014352 | Ga0163163_100143526 | 285 |
| 95 | 3300014325 | Ga0163163_10097455 | Ga0163163_100974553 | 285 |
| 96 | 3300014968 | Ga0157379_10033294 | Ga0157379_100332942 | 285 |
| 97 | 3300014968 | Ga0157379_10035449 | Ga0157379_100354494 | 285 |
| 98 | 3300014969 | Ga0157376_10069092 | Ga0157376_100690923 | 285 |
| 99 | 3300020069 | Ga0197907_11015632 | Ga0197907_110156322 | 285 |
| 100 | 3300025949 | Ga0207667_10273749 | Ga0207667_102737492 | 285 |
| 101 | 3300026116 | Ga0207674_10019442 | Ga0207674_100194424 | 285 |
| 102 | 3300026142 | Ga0207698_10114938 | Ga0207698_101149381 | 285 |
| 103 | 3300028379 | Ga0268266_10238348 | Ga0268266_102383482 | 285 |
| 104 | 3300044693 | Ga0466961_0045463 | Ga0466961_0045463_1218_2171 | 285 |
| 105 | 3300044693 | Ga0466961_0087464 | Ga0466961_0087464_565_1545 | 285 |
| 106 | 3300045976 | Ga0466967_0248969 | Ga0466967_0248969_488_1468 | 285 |
| 107 | 3300046477 | Ga0495664_0181362 | Ga0495664_0181362_291_1241 | 285 |
| 108 | 3300048905 | Ga0496102_0029390 | Ga0496102_0029390_1434_2393 | 285 |
| 109 | 3300048905 | Ga0496102_0194983 | Ga0496102_0194983_42_992 | 285 |
| 110 | 3300048907 | Ga0496104_0035652 | Ga0496104_0035652_817_1767 | 285 |
| 111 | 3300048908 | Ga0496105_0008714 | Ga0496105_0008714_1328_2278 | 285 |
| 112 | 3300048909 | Ga0496106_0136668 | Ga0496106_0136668_360_1310 | 285 |
| 113 | 3300048911 | Ga0496108_0120986 | Ga0496108_0120986_468_1418 | 285 |
| 114 | 3300048913 | Ga0496110_0016201 | Ga0496110_0016201_982_1932 | 285 |
| 115 | 3300048915 | Ga0496112_0144447 | Ga0496112_0144447_1342_2292 | 285 |
| 116 | 3300048917 | Ga0496114_0167950 | Ga0496114_0167950_348_1298 | 285 |
| 117 | 3300048919 | Ga0496116_0004891 | Ga0496116_0004891_6907_7866 | 285 |
| 118 | 3300048920 | Ga0496117_0020816 | Ga0496117_0020816_1696_2655 | 285 |
| 119 | 3300048921 | Ga0496118_0009917 | Ga0496118_0009917_1679_2638 | 285 |
| 120 | 3300048922 | Ga0496119_0002564 | Ga0496119_0002564_11670_12632 | 285 |
| 121 | 3300048922 | Ga0496119_0020007 | Ga0496119_0020007_2199_3158 | 285 |
| 122 | 3300048923 | Ga0496120_0000050 | Ga0496120_0000050_79380_80342 | 285 |
| 123 | iso_pu_bacteria | 8001781756 | 8001784878 | 285 |
| 124 | 3300005327 | Ga0070658_10003040 | Ga0070658_1000304010 | 286 |
| 125 | 3300005327 | Ga0070658_10010374 | Ga0070658_100103742 | 286 |
| 126 | 3300005336 | Ga0070680_100001163 | Ga0070680_10000116312 | 286 |
| 127 | 3300005458 | Ga0070681_10027682 | Ga0070681_100276825 | 286 |
| 128 | 3300005530 | Ga0070679_100034079 | Ga0070679_1000340792 | 286 |
| 129 | 3300005842 | Ga0068858_100000013 | Ga0068858_100000013198 | 286 |
| 130 | 3300009177 | Ga0105248_10001845 | Ga0105248_100018453 | 286 |
| 131 | 3300013306 | Ga0163162_10080446 | Ga0163162_100804461 | 286 |
| 132 | 3300013308 | Ga0157375_10019722 | Ga0157375_100197223 | 286 |
| 133 | 3300014968 | Ga0157379_10000006 | Ga0157379_1000000675 | 286 |
| 134 | 3300020081 | Ga0206354_11560813 | Ga0206354_115608132 | 286 |
| 135 | 3300020082 | Ga0206353_10717430 | Ga0206353_107174303 | 286 |
| 136 | 3300025909 | Ga0207705_10001985 | Ga0207705_100019852 | 286 |
| 137 | 3300025912 | Ga0207707_10249693 | Ga0207707_102496932 | 286 |
| 138 | 3300025917 | Ga0207660_10000922 | Ga0207660_1000092212 | 286 |
| 139 | 3300025921 | Ga0207652_10002431 | Ga0207652_100024316 | 286 |
| 140 | 3300026035 | Ga0207703_10000009 | Ga0207703_10000009196 | 286 |
| 141 | 3300026121 | Ga0207683_10347921 | Ga0207683_103479212 | 286 |
| 142 | 3300044765 | Ga0466970_0067967 | Ga0466970_0067967_112_1053 | 286 |
| 143 | 3300045049 | Ga0466959_0085849 | Ga0466959_0085849_883_1824 | 286 |
| 144 | 3300048908 | Ga0496105_0282925 | Ga0496105_0282925_152_1174 | 286 |
| 145 | 3300048911 | Ga0496108_0015514 | Ga0496108_0015514_1504_2526 | 286 |
| 146 | 3300048912 | Ga0496109_0098655 | Ga0496109_0098655_189_1211 | 286 |
| 147 | 3300048914 | Ga0496111_0012859 | Ga0496111_0012859_669_1691 | 286 |
| 148 | 3300048915 | Ga0496112_0131537 | Ga0496112_0131537_514_1536 | 286 |
| 149 | 3300048916 | Ga0496113_0014044 | Ga0496113_0014044_664_1686 | 286 |
| 150 | 3300048924 | Ga0496121_0029396 | Ga0496121_0029396_2179_3183 | 286 |
| 151 | iso_pu_bacteria | 2501939600 | 2501943229 | 286 |
| 152 | iso_pu_bacteria | 2671180195 | 2671839327 | 286 |
| 153 | iso_pu_bacteria | 2684623035 | 2686537618 | 286 |
| 154 | iso_pu_bacteria | 2687453743 | 2689996243 | 286 |
| 155 | iso_pu_bacteria | 2773857922 | 2774857483 | 286 |
| 156 | iso_pu_bacteria | 2895880812 | 2895885098 | 286 |
| 157 | 3300005329 | Ga0070683_100107321 | Ga0070683_1001073212 | 287 |
| 158 | 3300025900 | Ga0207710_10000017 | Ga0207710_10000017265 | 287 |
| 159 | 3300025941 | Ga0207711_10007004 | Ga0207711_100070046 | 287 |
| 160 | 3300048908 | Ga0496105_0328314 | Ga0496105_0328314_195_1166 | 287 |
| 161 | 3300048929 | Ga0496126_0364842 | Ga0496126_0364842_140_1141 | 287 |
| 162 | 3300053087 | Ga0500643_000413 | Ga0500643_000413_16963_17931 | 287 |
| 163 | iso_pu_bacteria | 2884994152 | 2884994971 | 287 |
| 164 | iso_pu_bacteria | 2891395885 | 2891401554 | 287 |
| 165 | iso_pu_bacteria | 2891554331 | 2891555124 | 287 |
| 166 | iso_pu_bacteria | 8002784119 | 8002785884 | 287 |
| 167 | iso_pu_bacteria | 8056060235 | 8056063791 | 287 |
| 168 | 3300005336 | Ga0070680_100153934 | Ga0070680_1001539342 | 288 |
| 169 | 3300005436 | Ga0070713_100359952 | Ga0070713_1003599521 | 288 |
| 170 | 3300005458 | Ga0070681_10110895 | Ga0070681_101108952 | 288 |
| 171 | 3300005467 | Ga0070706_100148378 | Ga0070706_1001483781 | 288 |
| 172 | 3300005617 | Ga0068859_100001109 | Ga0068859_1000011096 | 288 |
| 173 | 3300005844 | Ga0068862_100000342 | Ga0068862_1000003425 | 288 |
| 174 | 3300006931 | Ga0097620_100001109 | Ga0097620_1000011096 | 288 |
| 175 | 3300009553 | Ga0105249_10041353 | Ga0105249_100413533 | 288 |
| 176 | 3300014325 | Ga0163163_10019127 | Ga0163163_100191274 | 288 |
| 177 | 3300025910 | Ga0207684_10129617 | Ga0207684_101296173 | 288 |
| 178 | 3300025912 | Ga0207707_10104783 | Ga0207707_101047832 | 288 |
| 179 | 3300025961 | Ga0207712_10073889 | Ga0207712_100738892 | 288 |
| 180 | 3300028380 | Ga0268265_10000041 | Ga0268265_1000004134 | 288 |
| 181 | 3300035083 | Ga0373926_0020962 | Ga0373926_0020962_1090_2040 | 288 |
| 182 | 3300035119 | Ga0373956_0125915 | Ga0373956_0125915_181_1131 | 288 |
| 183 | 3300035410 | Ga0373924_0111921 | Ga0373924_0111921_183_1133 | 288 |
| 184 | 3300037068 | Ga0373925_0000542 | Ga0373925_0000542_3609_4547 | 288 |
| 185 | 3300046454 | Ga0495592_0122960 | Ga0495592_0122960_639_1589 | 288 |
| 186 | 3300046462 | Ga0495651_0007864 | Ga0495651_0007864_5458_6408 | 288 |
| 187 | 3300046511 | Ga0495608_0018852 | Ga0495608_0018852_415_1365 | 288 |
| 188 | 3300046516 | Ga0495628_0019788 | Ga0495628_0019788_3717_4667 | 288 |
| 189 | 3300046517 | Ga0495630_0125903 | Ga0495630_0125903_262_1212 | 288 |
| 190 | 3300046524 | Ga0495648_0052340 | Ga0495648_0052340_1250_2284 | 288 |
| 191 | 3300046529 | Ga0495652_0058387 | Ga0495652_0058387_416_1366 | 288 |
| 192 | 3300046529 | Ga0495652_0148484 | Ga0495652_0148484_386_1336 | 288 |
| 193 | 3300046533 | Ga0495640_0027229 | Ga0495640_0027229_2902_3852 | 288 |
| 194 | 3300046536 | Ga0495587_0001121 | Ga0495587_0001121_10434_11384 | 288 |
| 195 | 3300046543 | Ga0495645_0322887 | Ga0495645_0322887_40_990 | 288 |
| 196 | 3300046559 | Ga0495667_0014283 | Ga0495667_0014283_1223_2173 | 288 |
| 197 | 3300046663 | Ga0495635_0106593 | Ga0495635_0106593_737_1687 | 288 |
| 198 | 3300046675 | Ga0495657_0029030 | Ga0495657_0029030_1886_2836 | 288 |
| 199 | 3300046678 | Ga0495599_0022905 | Ga0495599_0022905_75_1025 | 288 |
| 200 | 3300046678 | Ga0495599_0167066 | Ga0495599_0167066_48_998 | 288 |
| 201 | 3300046679 | Ga0495623_0081349 | Ga0495623_0081349_506_1456 | 288 |
| 202 | 3300046680 | Ga0495646_0047834 | Ga0495646_0047834_1157_2107 | 288 |
| 203 | 3300046680 | Ga0495646_0115954 | Ga0495646_0115954_279_1229 | 288 |
| 204 | 3300046681 | Ga0495647_0022019 | Ga0495647_0022019_948_1898 | 288 |
| 205 | 3300046683 | Ga0495658_0316707 | Ga0495658_0316707_26_976 | 288 |
| 206 | 3300046689 | Ga0495613_0265957 | Ga0495613_0265957_15_965 | 288 |
| 207 | 3300046690 | Ga0495624_0049937 | Ga0495624_0049937_1293_2243 | 288 |
| 208 | 3300046809 | Ga0495600_0034814 | Ga0495600_0034814_203_1153 | 288 |
| 209 | 3300047315 | Ga0495581_0045951 | Ga0495581_0045951_667_1617 | 288 |
| 210 | 3300047317 | Ga0495604_0043829 | Ga0495604_0043829_914_1864 | 288 |
| 211 | 3300047319 | Ga0495674_0212122 | Ga0495674_0212122_312_1262 | 288 |
| 212 | 3300047319 | Ga0495674_0302324 | Ga0495674_0302324_311_1261 | 288 |
| 213 | 3300047322 | Ga0495680_0021505 | Ga0495680_0021505_849_1799 | 288 |
| 214 | 3300047444 | Ga0495675_0015668 | Ga0495675_0015668_386_1336 | 288 |
| 215 | 3300047471 | Ga0495684_0058423 | Ga0495684_0058423_942_1892 | 288 |
| 216 | 3300048088 | Ga0495602_0086712 | Ga0495602_0086712_1550_2500 | 288 |
| 217 | 3300049585 | Ga0501069_0002925 | Ga0501069_0002925_5968_6942 | 288 |
| 218 | 3300049586 | Ga0501070_0002547 | Ga0501070_0002547_7891_8865 | 288 |
| 219 | 3300049590 | Ga0501074_0054062 | Ga0501074_0054062_219_1193 | 288 |
| 220 | 3300049742 | Ga0501080_0002688 | Ga0501080_0002688_4847_5821 | 288 |
| 221 | 3300053077 | Ga0495601_0212905 | Ga0495601_0212905_269_1219 | 288 |
| 222 | 3300053078 | Ga0495612_0087982 | Ga0495612_0087982_333_1283 | 288 |
| 223 | 3300053083 | Ga0495655_0005824 | Ga0495655_0005824_692_1723 | 288 |
| 224 | 3300053085 | Ga0495619_0099632 | Ga0495619_0099632_144_1094 | 288 |
| 225 | iso_pu_bacteria | 2675902999 | 2676199302 | 288 |
| 226 | iso_pu_bacteria | 2773857921 | 2774843880 | 288 |
| 227 | iso_pu_bacteria | 637000116 | 637878075 | 288 |
| 228 | 3300005327 | Ga0070658_10071648 | Ga0070658_100716482 | 289 |
| 229 | 3300005329 | Ga0070683_100029310 | Ga0070683_1000293103 | 289 |
| 230 | 3300005337 | Ga0070682_100099099 | Ga0070682_1000990992 | 289 |
| 231 | 3300005435 | Ga0070714_100113833 | Ga0070714_1001138331 | 289 |
| 232 | 3300005455 | Ga0070663_100079006 | Ga0070663_1000790062 | 289 |
| 233 | 3300005458 | Ga0070681_10112564 | Ga0070681_101125643 | 289 |
| 234 | 3300005535 | Ga0070684_100055584 | Ga0070684_1000555841 | 289 |
| 235 | 3300005548 | Ga0070665_100212005 | Ga0070665_1002120052 | 289 |
| 236 | 3300013104 | Ga0157370_10011579 | Ga0157370_100115793 | 289 |
| 237 | 3300013104 | Ga0157370_10120997 | Ga0157370_101209972 | 289 |
| 238 | 3300013105 | Ga0157369_10001338 | Ga0157369_100013382 | 289 |
| 239 | 3300013105 | Ga0157369_10069889 | Ga0157369_100698893 | 289 |
| 240 | 3300020082 | Ga0206353_11308799 | Ga0206353_113087991 | 289 |
| 241 | 3300025912 | Ga0207707_10062685 | Ga0207707_100626853 | 289 |
| 242 | 3300025919 | Ga0207657_10035610 | Ga0207657_100356102 | 289 |
| 243 | 3300026067 | Ga0207678_10075241 | Ga0207678_100752412 | 289 |
| 244 | 3300032004 | Ga0307414_10203893 | Ga0307414_102038932 | 289 |
| 245 | 3300037466 | Ga0395898_0039470 | Ga0395898_0039470_46_1002 | 289 |
| 246 | 3300044684 | Ga0466966_0090306 | Ga0466966_0090306_92_1042 | 289 |
| 247 | 3300045976 | Ga0466967_0075672 | Ga0466967_0075672_1394_2350 | 289 |
| 248 | 3300048905 | Ga0496102_0312768 | Ga0496102_0312768_479_1432 | 289 |
| 249 | 3300048915 | Ga0496112_0041583 | Ga0496112_0041583_286_1242 | 289 |
| 250 | 3300048922 | Ga0496119_0085747 | Ga0496119_0085747_487_1440 | 289 |
| 251 | 3300048929 | Ga0496126_0000040 | Ga0496126_0000040_88583_89581 | 289 |
| 252 | 3300005435 | Ga0070714_100219426 | Ga0070714_1002194262 | 290 |
| 253 | 3300031507 | Ga0307509_10169199 | Ga0307509_101691992 | 290 |
| 254 | 3300044706 | Ga0466964_0045741 | Ga0466964_0045741_423_1376 | 290 |
| 255 | iso_pu_bacteria | 2728369276 | 2729908546 | 290 |
| 256 | 3300005437 | Ga0070710_10011129 | Ga0070710_100111293 | 291 |
| 257 | 3300005937 | Ga0081455_10000144 | Ga0081455_1000014465 | 291 |
| 258 | 3300006844 | Ga0075428_100001143 | Ga0075428_10000114319 | 291 |
| 259 | 3300006846 | Ga0075430_100006377 | Ga0075430_1000063774 | 291 |
| 260 | 3300006847 | Ga0075431_100020352 | Ga0075431_1000203527 | 291 |
| 261 | 3300006880 | Ga0075429_100002830 | Ga0075429_1000028307 | 291 |
| 262 | 3300009147 | Ga0114129_10000277 | Ga0114129_1000027753 | 291 |
| 263 | 3300025898 | Ga0207692_10030040 | Ga0207692_100300403 | 291 |
| 264 | 3300046462 | Ga0495651_0010218 | Ga0495651_0010218_4926_5894 | 291 |
| 265 | 3300046463 | Ga0495653_0011295 | Ga0495653_0011295_5518_6486 | 291 |
| 266 | 3300046472 | Ga0495580_0036373 | Ga0495580_0036373_1773_2741 | 291 |
| 267 | 3300046476 | Ga0495662_0001125 | Ga0495662_0001125_6395_7363 | 291 |
| 268 | 3300046477 | Ga0495664_0017243 | Ga0495664_0017243_2474_3442 | 291 |
| 269 | 3300046511 | Ga0495608_0040534 | Ga0495608_0040534_1467_2435 | 291 |
| 270 | 3300046514 | Ga0495618_0068165 | Ga0495618_0068165_812_1780 | 291 |
| 271 | 3300046516 | Ga0495628_0005062 | Ga0495628_0005062_9274_10242 | 291 |
| 272 | 3300046517 | Ga0495630_0018508 | Ga0495630_0018508_1802_2770 | 291 |
| 273 | 3300046526 | Ga0495666_0004555 | Ga0495666_0004555_5060_6028 | 291 |
| 274 | 3300046529 | Ga0495652_0018511 | Ga0495652_0018511_3801_4769 | 291 |
| 275 | 3300046531 | Ga0495665_0003532 | Ga0495665_0003532_1244_2212 | 291 |
| 276 | 3300046533 | Ga0495640_0024632 | Ga0495640_0024632_2050_3018 | 291 |
| 277 | 3300046535 | Ga0495586_0018187 | Ga0495586_0018187_2484_3452 | 291 |
| 278 | 3300046536 | Ga0495587_0038458 | Ga0495587_0038458_1104_2072 | 291 |
| 279 | 3300046543 | Ga0495645_0000713 | Ga0495645_0000713_4675_5643 | 291 |
| 280 | 3300046559 | Ga0495667_0007290 | Ga0495667_0007290_385_1353 | 291 |
| 281 | 3300046642 | Ga0495634_0042148 | Ga0495634_0042148_813_1781 | 291 |
| 282 | 3300046663 | Ga0495635_0015754 | Ga0495635_0015754_3779_4747 | 291 |
| 283 | 3300046678 | Ga0495599_0027934 | Ga0495599_0027934_685_1653 | 291 |
| 284 | 3300046679 | Ga0495623_0012742 | Ga0495623_0012742_2367_3326 | 291 |
| 285 | 3300046679 | Ga0495623_0014060 | Ga0495623_0014060_685_1653 | 291 |
| 286 | 3300046680 | Ga0495646_0000644 | Ga0495646_0000644_14863_15831 | 291 |
| 287 | 3300046689 | Ga0495613_0116797 | Ga0495613_0116797_385_1353 | 291 |
| 288 | 3300046809 | Ga0495600_0009171 | Ga0495600_0009171_3818_4786 | 291 |
| 289 | 3300047315 | Ga0495581_0009713 | Ga0495581_0009713_3171_4139 | 291 |
| 290 | 3300047317 | Ga0495604_0002519 | Ga0495604_0002519_7748_8707 | 291 |
| 291 | 3300047317 | Ga0495604_0004390 | Ga0495604_0004390_6395_7363 | 291 |
| 292 | 3300047444 | Ga0495675_0026964 | Ga0495675_0026964_813_1781 | 291 |
| 293 | 3300047444 | Ga0495675_0045125 | Ga0495675_0045125_1101_2060 | 291 |
| 294 | 3300047471 | Ga0495684_0066552 | Ga0495684_0066552_796_1764 | 291 |
| 295 | 3300047673 | Ga0495593_0024864 | Ga0495593_0024864_982_1950 | 291 |
| 296 | 3300048088 | Ga0495602_0027606 | Ga0495602_0027606_3800_4768 | 291 |
| 297 | 3300050507 | nmdc:mga05p37_4314_c1 | nmdc:mga05p37_4314_c1_14959_15924 | 291 |
| 298 | 3300050508 | nmdc:mga09592_33302_c1 | nmdc:mga09592_33302_c1_896_1861 | 291 |
| 299 | 3300050509 | nmdc:mga0qj67_116034_c1 | nmdc:mga0qj67_116034_c1_366_1331 | 291 |
| 300 | 3300050510 | nmdc:mga06r32_6544_c1 | nmdc:mga06r32_6544_c1_7650_8615 | 291 |
| 301 | 3300053085 | Ga0495619_0108552 | Ga0495619_0108552_393_1361 | 291 |
| 302 | iso_pu_bacteria | 2818991472 | 2819742494 | 291 |
| 303 | iso_pu_bacteria | 3006486233 | 3006486502 | 291 |
| 304 | iso_pu_bacteria | 2554235005 | 2554258204 | 292 |
| 305 | iso_pu_bacteria | 2616644941 | 2616905027 | 292 |
| 306 | iso_pu_bacteria | 2643221548 | 2643765552 | 292 |
| 307 | iso_pu_bacteria | 2643221578 | 2643898691 | 292 |
| 308 | iso_pu_bacteria | 2643221673 | 2644406608 | 292 |
| 309 | iso_pu_bacteria | 2643221682 | 2644459665 | 292 |
| 310 | iso_pu_bacteria | 2802429296 | 2804847414 | 292 |
| 311 | iso_pu_bacteria | 2818991463 | 2819697792 | 292 |
| 312 | iso_pu_bacteria | 2862178590 | 2862184383 | 292 |
| 313 | iso_pu_bacteria | 2862574272 | 2862579531 | 292 |
| 314 | iso_pu_bacteria | 2873151551 | 2873156086 | 292 |
| 315 | iso_pu_bacteria | 2875391855 | 2875394216 | 292 |
| 316 | iso_pu_bacteria | 2912757875 | 2912760346 | 292 |
| 317 | iso_pu_bacteria | 2946045630 | 2946050383 | 292 |
| 318 | iso_pu_bacteria | 2966598605 | 2966602860 | 292 |
| 319 | iso_pu_bacteria | 2997451912 | 2997454460 | 292 |
| 320 | iso_pu_bacteria | 3006321560 | 3006324378 | 292 |
| 321 | iso_pu_bacteria | 8025413630 | 8025416841 | 292 |
| 322 | iso_pu_bacteria | 8033684223 | 8033691030 | 292 |
| 323 | 3300005336 | Ga0070680_100143865 | Ga0070680_1001438652 | 293 |
| 324 | 3300005337 | Ga0070682_100046186 | Ga0070682_1000461862 | 293 |
| 325 | 3300005435 | Ga0070714_100433885 | Ga0070714_1004338852 | 293 |
| 326 | 3300005445 | Ga0070708_100363085 | Ga0070708_1003630852 | 293 |
| 327 | 3300005614 | Ga0068856_100049552 | Ga0068856_1000495522 | 293 |
| 328 | 3300005615 | Ga0070702_100191935 | Ga0070702_1001919351 | 293 |
| 329 | 3300006237 | Ga0097621_100433446 | Ga0097621_1004334461 | 293 |
| 330 | 3300006358 | Ga0068871_100230607 | Ga0068871_1002306072 | 293 |
| 331 | 3300006871 | Ga0075434_100097274 | Ga0075434_1000972743 | 293 |
| 332 | 3300006914 | Ga0075436_100048520 | Ga0075436_1000485203 | 293 |
| 333 | 3300013105 | Ga0157369_10019137 | Ga0157369_100191373 | 293 |
| 334 | 3300013307 | Ga0157372_10470997 | Ga0157372_104709971 | 293 |
| 335 | 3300025898 | Ga0207692_10030530 | Ga0207692_100305303 | 293 |
| 336 | 3300025905 | Ga0207685_10001127 | Ga0207685_100011273 | 293 |
| 337 | 3300025906 | Ga0207699_10001054 | Ga0207699_100010547 | 293 |
| 338 | 3300025915 | Ga0207693_10005243 | Ga0207693_100052436 | 293 |
| 339 | 3300025916 | Ga0207663_10001914 | Ga0207663_100019144 | 293 |
| 340 | 3300025928 | Ga0207700_10004975 | Ga0207700_100049754 | 293 |
| 341 | 3300025929 | Ga0207664_10019296 | Ga0207664_100192963 | 293 |
| 342 | 3300025929 | Ga0207664_10357288 | Ga0207664_103572881 | 293 |
| 343 | 3300025931 | Ga0207644_10036699 | Ga0207644_100366992 | 293 |
| 344 | 3300025939 | Ga0207665_10015461 | Ga0207665_100154612 | 293 |
| 345 | 3300034816 | Ga0373930_0019647 | Ga0373930_0019647_21_968 | 293 |
| 346 | 3300034817 | Ga0373948_0012891 | Ga0373948_0012891_89_1036 | 293 |
| 347 | 3300035084 | Ga0373928_0008290 | Ga0373928_0008290_946_1893 | 293 |
| 348 | 3300035088 | Ga0373940_0011866 | Ga0373940_0011866_204_1151 | 293 |
| 349 | 3300035090 | Ga0373949_0002480 | Ga0373949_0002480_801_1748 | 293 |
| 350 | 3300035112 | Ga0373932_0065499 | Ga0373932_0065499_48_995 | 293 |
| 351 | 3300035207 | Ga0373942_0019767 | Ga0373942_0019767_40_987 | 293 |
| 352 | 3300047444 | Ga0495675_0037333 | Ga0495675_0037333_611_1573 | 293 |
| 353 | 3300048909 | Ga0496106_0038305 | Ga0496106_0038305_167_1114 | 293 |
| 354 | 3300048910 | Ga0496107_0013392 | Ga0496107_0013392_686_1633 | 293 |
| 355 | 3300048912 | Ga0496109_0208785 | Ga0496109_0208785_801_1748 | 293 |
| 356 | 3300048915 | Ga0496112_0098133 | Ga0496112_0098133_1091_2038 | 293 |
| 357 | 3300048917 | Ga0496114_0062188 | Ga0496114_0062188_917_1864 | 293 |
| 358 | 3300048918 | Ga0496115_0014348 | Ga0496115_0014348_3311_4258 | 293 |
| 359 | 3300048918 | Ga0496115_0033045 | Ga0496115_0033045_2222_3187 | 293 |
| 360 | 3300048929 | Ga0496126_0238173 | Ga0496126_0238173_541_1506 | 293 |
| 361 | 3300050512 | nmdc:mga0n895_115037_c1 | nmdc:mga0n895_115037_c1_1276_2223 | 293 |
| 362 | 3300050513 | nmdc:mga0rr50_36182_c1 | nmdc:mga0rr50_36182_c1_1800_2747 | 293 |
| 363 | 3300050514 | nmdc:mga08x19_66118_c1 | nmdc:mga08x19_66118_c1_524_1471 | 293 |
| 364 | iso_pu_bacteria | 2547132111 | 2547412908 | 293 |
| 365 | iso_pu_bacteria | 2582581313 | 2585310341 | 293 |
| 366 | iso_pu_bacteria | 2582581314 | 2585319713 | 293 |
| 367 | iso_pu_bacteria | 2616644814 | 2616695462 | 293 |
| 368 | iso_pu_bacteria | 2643221647 | 2644265240 | 293 |
| 369 | iso_pu_bacteria | 2643221678 | 2644436836 | 293 |
| 370 | iso_pu_bacteria | 2643221714 | 2644628573 | 293 |
| 371 | iso_pu_bacteria | 2784132148 | 2784588305 | 293 |
| 372 | iso_pu_bacteria | 2784746763 | 2785343710 | 293 |
| 373 | iso_pu_bacteria | 2784746768 | 2785369117 | 293 |
| 374 | iso_pu_bacteria | 2786546132 | 2786670264 | 293 |
| 375 | iso_pu_bacteria | 2808606359 | 2808841732 | 293 |
| 376 | iso_pu_bacteria | 2808606375 | 2808920263 | 293 |
| 377 | iso_pu_bacteria | 2808606448 | 2809231919 | 293 |
| 378 | iso_pu_bacteria | 2811994879 | 2812358520 | 293 |
| 379 | iso_pu_bacteria | 2811994917 | 2812480844 | 293 |
| 380 | iso_pu_bacteria | 2837268691 | 2837269348 | 293 |
| 381 | iso_pu_bacteria | 2852635781 | 2852637012 | 293 |
| 382 | iso_pu_bacteria | 2862281513 | 2862285160 | 293 |
| 383 | iso_pu_bacteria | 2862382967 | 2862387322 | 293 |
| 384 | iso_pu_bacteria | 2862507626 | 2862509710 | 293 |
| 385 | iso_pu_bacteria | 2863404153 | 2863405041 | 293 |
| 386 | iso_pu_bacteria | 2867369537 | 2867371602 | 293 |
| 387 | iso_pu_bacteria | 2867428634 | 2867430782 | 293 |
| 388 | iso_pu_bacteria | 2877676314 | 2877681428 | 293 |
| 389 | iso_pu_bacteria | 2912715099 | 2912720405 | 293 |
| 390 | iso_pu_bacteria | 2912723979 | 2912724606 | 293 |
| 391 | iso_pu_bacteria | 2919468124 | 2919475249 | 293 |
| 392 | iso_pu_bacteria | 2946064051 | 2946067358 | 293 |
| 393 | iso_pu_bacteria | 2946072368 | 2946075617 | 293 |
| 394 | iso_pu_bacteria | 2947224130 | 2947229878 | 293 |
| 395 | iso_pu_bacteria | 2954002825 | 2954007865 | 293 |
| 396 | iso_pu_bacteria | 2954380949 | 2954386572 | 293 |
| 397 | iso_pu_bacteria | 2954673503 | 2954676606 | 293 |
| 398 | iso_pu_bacteria | 2954682443 | 2954687561 | 293 |
| 399 | iso_pu_bacteria | 2954691527 | 2954697384 | 293 |
| 400 | iso_pu_bacteria | 2954701450 | 2954704887 | 293 |
| 401 | iso_pu_bacteria | 2954711539 | 2954716550 | 293 |
| 402 | iso_pu_bacteria | 2954721474 | 2954726495 | 293 |
| 403 | iso_pu_bacteria | 2954731030 | 2954735312 | 293 |
| 404 | iso_pu_bacteria | 2954740390 | 2954745420 | 293 |
| 405 | iso_pu_bacteria | 2954749733 | 2954754168 | 293 |
| 406 | iso_pu_bacteria | 2954759201 | 2954764394 | 293 |
| 407 | iso_pu_bacteria | 2990059506 | 2990067532 | 293 |
| 408 | iso_pu_bacteria | 2990088156 | 2990093451 | 293 |
| 409 | iso_pu_bacteria | 3006393351 | 3006398454 | 293 |
| 410 | iso_pu_bacteria | 3006493962 | 3006499768 | 293 |
| 411 | iso_pu_bacteria | 8008558824 | 8008567964 | 293 |
| 412 | iso_pu_bacteria | 8008574985 | 8008579145 | 293 |
| 413 | iso_pu_bacteria | 8023623736 | 8023631157 | 293 |
| 414 | iso_pu_bacteria | 8025478263 | 8025482136 | 293 |
| 415 | iso_pu_bacteria | 8048406513 | 8048408231 | 293 |
| 416 | iso_pu_bacteria | 8056667051 | 8056671470 | 293 |
| 417 | iso_pu_bacteria | 8056829672 | 8056835341 | 293 |
| 418 | 3300005436 | Ga0070713_100101961 | Ga0070713_1001019612 | 294 |
| 419 | 3300005467 | Ga0070706_100010701 | Ga0070706_1000107016 | 294 |
| 420 | 3300005467 | Ga0070706_100068999 | Ga0070706_1000689991 | 294 |
| 421 | 3300005468 | Ga0070707_100000788 | Ga0070707_1000007886 | 294 |
| 422 | 3300005471 | Ga0070698_100000080 | Ga0070698_10000008046 | 294 |
| 423 | 3300005471 | Ga0070698_100234165 | Ga0070698_1002341651 | 294 |
| 424 | 3300006028 | Ga0070717_10029158 | Ga0070717_100291583 | 294 |
| 425 | 3300006852 | Ga0075433_10057567 | Ga0075433_100575672 | 294 |
| 426 | 3300006871 | Ga0075434_100010350 | Ga0075434_1000103508 | 294 |
| 427 | 3300006871 | Ga0075434_100234822 | Ga0075434_1002348222 | 294 |
| 428 | 3300007076 | Ga0075435_100001372 | Ga0075435_10000137210 | 294 |
| 429 | 3300025910 | Ga0207684_10004433 | Ga0207684_100044333 | 294 |
| 430 | 3300025910 | Ga0207684_10014848 | Ga0207684_100148482 | 294 |
| 431 | 3300025915 | Ga0207693_10274950 | Ga0207693_102749502 | 294 |
| 432 | 3300025922 | Ga0207646_10006323 | Ga0207646_100063236 | 294 |
| 433 | 3300025928 | Ga0207700_10266600 | Ga0207700_102666002 | 294 |
| 434 | 3300035118 | Ga0373954_0113108 | Ga0373954_0113108_243_1193 | 294 |
| 435 | 3300035119 | Ga0373956_0028690 | Ga0373956_0028690_251_1201 | 294 |
| 436 | 3300035119 | Ga0373956_0033239 | Ga0373956_0033239_141_1091 | 294 |
| 437 | 3300035692 | Ga0373935_0104785 | Ga0373935_0104785_453_1403 | 294 |
| 438 | 3300035692 | Ga0373935_0132625 | Ga0373935_0132625_458_1408 | 294 |
| 439 | 3300035725 | Ga0373947_0104801 | Ga0373947_0104801_414_1364 | 294 |
| 440 | 3300036401 | Ga0373937_0213145 | Ga0373937_0213145_252_1202 | 294 |
| 441 | 3300037068 | Ga0373925_0029303 | Ga0373925_0029303_669_1619 | 294 |
| 442 | 3300046462 | Ga0495651_0259011 | Ga0495651_0259011_212_1162 | 294 |
| 443 | 3300046475 | Ga0495639_0022056 | Ga0495639_0022056_576_1526 | 294 |
| 444 | 3300046476 | Ga0495662_0030807 | Ga0495662_0030807_1335_2285 | 294 |
| 445 | 3300046476 | Ga0495662_0032519 | Ga0495662_0032519_1102_2052 | 294 |
| 446 | 3300046477 | Ga0495664_0054255 | Ga0495664_0054255_465_1415 | 294 |
| 447 | 3300046516 | Ga0495628_0046615 | Ga0495628_0046615_767_1717 | 294 |
| 448 | 3300046526 | Ga0495666_0028708 | Ga0495666_0028708_1313_2263 | 294 |
| 449 | 3300046531 | Ga0495665_0062895 | Ga0495665_0062895_336_1286 | 294 |
| 450 | 3300046533 | Ga0495640_0070581 | Ga0495640_0070581_211_1161 | 294 |
| 451 | 3300046533 | Ga0495640_0076066 | Ga0495640_0076066_908_1858 | 294 |
| 452 | 3300046535 | Ga0495586_0013171 | Ga0495586_0013171_3001_3951 | 294 |
| 453 | 3300046543 | Ga0495645_0016162 | Ga0495645_0016162_3215_4165 | 294 |
| 454 | 3300046642 | Ga0495634_0173065 | Ga0495634_0173065_270_1220 | 294 |
| 455 | 3300046679 | Ga0495623_0208047 | Ga0495623_0208047_29_979 | 294 |
| 456 | 3300046683 | Ga0495658_0071839 | Ga0495658_0071839_630_1580 | 294 |
| 457 | 3300047315 | Ga0495581_0000875 | Ga0495581_0000875_5381_6331 | 294 |
| 458 | 3300047319 | Ga0495674_0006822 | Ga0495674_0006822_5412_6362 | 294 |
| 459 | 3300050515 | nmdc:mga0a205_21928_c1 | nmdc:mga0a205_21928_c1_938_1888 | 294 |
| 460 | iso_pu_bacteria | 2767802112 | 2768647424 | 294 |
| 461 | iso_pu_bacteria | 2867346516 | 2867349650 | 294 |
| 462 | 3300005434 | Ga0070709_10000450 | Ga0070709_1000045010 | 295 |
| 463 | 3300005436 | Ga0070713_100033102 | Ga0070713_1000331021 | 295 |
| 464 | 3300005436 | Ga0070713_100085821 | Ga0070713_1000858213 | 295 |
| 465 | 3300005437 | Ga0070710_10000997 | Ga0070710_1000099710 | 295 |
| 466 | 3300005439 | Ga0070711_100003832 | Ga0070711_1000038323 | 295 |
| 467 | 3300006028 | Ga0070717_10048867 | Ga0070717_100488671 | 295 |
| 468 | 3300006028 | Ga0070717_10299125 | Ga0070717_102991252 | 295 |
| 469 | 3300006042 | Ga0075368_10035968 | Ga0075368_100359682 | 295 |
| 470 | 3300006173 | Ga0070716_100007325 | Ga0070716_1000073255 | 295 |
| 471 | 3300006178 | Ga0075367_10018023 | Ga0075367_100180232 | 295 |
| 472 | 3300025898 | Ga0207692_10000615 | Ga0207692_1000061510 | 295 |
| 473 | 3300025906 | Ga0207699_10004118 | Ga0207699_100041186 | 295 |
| 474 | 3300025915 | Ga0207693_10035294 | Ga0207693_100352945 | 295 |
| 475 | 3300025916 | Ga0207663_10001428 | Ga0207663_100014285 | 295 |
| 476 | 3300025928 | Ga0207700_10006449 | Ga0207700_100064496 | 295 |
| 477 | 3300025928 | Ga0207700_10020995 | Ga0207700_100209952 | 295 |
| 478 | 3300025929 | Ga0207664_10006398 | Ga0207664_100063987 | 295 |
| 479 | 3300025929 | Ga0207664_10052461 | Ga0207664_100524613 | 295 |
| 480 | 3300025939 | Ga0207665_10006062 | Ga0207665_100060623 | 295 |
| 481 | 3300027866 | Ga0209813_10011539 | Ga0209813_100115392 | 295 |
| 482 | 3300028800 | Ga0265338_10021619 | Ga0265338_100216193 | 295 |
| 483 | 3300031616 | Ga0307508_10011754 | Ga0307508_100117545 | 295 |
| 484 | 3300031616 | Ga0307508_10059008 | Ga0307508_100590083 | 295 |
| 485 | 3300031649 | Ga0307514_10066601 | Ga0307514_100666012 | 295 |
| 486 | 3300032002 | Ga0307416_100292473 | Ga0307416_1002924732 | 295 |
| 487 | 3300035111 | Ga0373923_0002198 | Ga0373923_0002198_951_1940 | 295 |
| 488 | 3300035113 | Ga0373936_0007872 | Ga0373936_0007872_2549_3538 | 295 |
| 489 | 3300035119 | Ga0373956_0010151 | Ga0373956_0010151_2036_3025 | 295 |
| 490 | 3300042007 | Ga0439449_0000470 | Ga0439449_0000470_13930_14889 | 295 |
| 491 | 3300046454 | Ga0495592_0005585 | Ga0495592_0005585_7811_8800 | 295 |
| 492 | 3300046455 | Ga0495603_0014669 | Ga0495603_0014669_1190_2149 | 295 |
| 493 | 3300046455 | Ga0495603_0027768 | Ga0495603_0027768_67_1023 | 295 |
| 494 | 3300046459 | Ga0495629_0001149 | Ga0495629_0001149_8450_9406 | 295 |
| 495 | 3300046459 | Ga0495629_0146887 | Ga0495629_0146887_566_1555 | 295 |
| 496 | 3300046461 | Ga0495641_0017379 | Ga0495641_0017379_2046_3035 | 295 |
| 497 | 3300046477 | Ga0495664_0064155 | Ga0495664_0064155_480_1469 | 295 |
| 498 | 3300046492 | Ga0495585_0009078 | Ga0495585_0009078_2524_3483 | 295 |
| 499 | 3300046499 | Ga0495594_0000163 | Ga0495594_0000163_7605_8561 | 295 |
| 500 | 3300046499 | Ga0495594_0033409 | Ga0495594_0033409_643_1602 | 295 |
| 501 | 3300046501 | Ga0495607_0073808 | Ga0495607_0073808_432_1391 | 295 |
| 502 | 3300046536 | Ga0495587_0007689 | Ga0495587_0007689_5573_6562 | 295 |
| 503 | 3300046543 | Ga0495645_0021659 | Ga0495645_0021659_2391_3380 | 295 |
| 504 | 3300046543 | Ga0495645_0050854 | Ga0495645_0050854_651_1640 | 295 |
| 505 | 3300046642 | Ga0495634_0095676 | Ga0495634_0095676_524_1513 | 295 |
| 506 | 3300046663 | Ga0495635_0017883 | Ga0495635_0017883_337_1326 | 295 |
| 507 | 3300046674 | Ga0495588_0042715 | Ga0495588_0042715_978_1934 | 295 |
| 508 | 3300046794 | Ga0495589_0012131 | Ga0495589_0012131_2694_3653 | 295 |
| 509 | 3300046809 | Ga0495600_0006892 | Ga0495600_0006892_3823_4812 | 295 |
| 510 | 3300047317 | Ga0495604_0107136 | Ga0495604_0107136_328_1317 | 295 |
| 511 | 3300047321 | Ga0495676_0016661 | Ga0495676_0016661_5489_6445 | 295 |
| 512 | 3300047323 | Ga0495683_0022425 | Ga0495683_0022425_1500_2459 | 295 |
| 513 | 3300047447 | Ga0495685_009066 | Ga0495685_009066_640_1599 | 295 |
| 514 | 3300047472 | Ga0495686_0015711 | Ga0495686_0015711_2393_3352 | 295 |
| 515 | 3300047673 | Ga0495593_0066189 | Ga0495593_0066189_278_1267 | 295 |
| 516 | 3300048088 | Ga0495602_0030488 | Ga0495602_0030488_3625_4614 | 295 |
| 517 | 3300050494 | nmdc:mga06z11_48775_c1 | nmdc:mga06z11_48775_c1_1069_2028 | 295 |
| 518 | 3300050495 | nmdc:mga04h51_22830_c1 | nmdc:mga04h51_22830_c1_285_1244 | 295 |
| 519 | 3300053085 | Ga0495619_0036673 | Ga0495619_0036673_625_1614 | 295 |
| 520 | 3300053096 | Ga0500641_0020262 | Ga0500641_0020262_1000_1959 | 295 |
| 521 | 3300053149 | Ga0500600_0096668 | Ga0500600_0096668_596_1555 | 295 |
| 522 | 3300006048 | Ga0075363_100014181 | Ga0075363_1000141813 | 296 |
| 523 | 3300014497 | Ga0182008_10000929 | Ga0182008_100009298 | 296 |
| 524 | 3300015262 | Ga0182007_10001450 | Ga0182007_100014508 | 296 |
| 525 | 3300030521 | Ga0307511_10028569 | Ga0307511_100285692 | 296 |
| 526 | 3300030521 | Ga0307511_10163752 | Ga0307511_101637521 | 296 |
| 527 | 3300030522 | Ga0307512_10002026 | Ga0307512_1000202617 | 296 |
| 528 | 3300031616 | Ga0307508_10041711 | Ga0307508_100417112 | 296 |
| 529 | 3300031649 | Ga0307514_10003625 | Ga0307514_1000362511 | 296 |
| 530 | 3300031730 | Ga0307516_10006631 | Ga0307516_1000663110 | 296 |
| 531 | 3300031730 | Ga0307516_10009273 | Ga0307516_100092733 | 296 |
| 532 | 3300031852 | Ga0307410_10163379 | Ga0307410_101633792 | 296 |
| 533 | 3300033179 | Ga0307507_10056236 | Ga0307507_100562363 | 296 |
| 534 | 3300033180 | Ga0307510_10017828 | Ga0307510_100178286 | 296 |
| 535 | 3300037418 | Ga0395900_0352181 | Ga0395900_0352181_320_1279 | 296 |
| 536 | 3300037466 | Ga0395898_0015186 | Ga0395898_0015186_915_1874 | 296 |
| 537 | 3300037466 | Ga0395898_0035965 | Ga0395898_0035965_1281_2249 | 296 |
| 538 | 3300038443 | Ga0395901_0070511 | Ga0395901_0070511_2534_3493 | 296 |
| 539 | 3300041404 | Ga0439436_0000715 | Ga0439436_0000715_6746_7705 | 296 |
| 540 | 3300041494 | Ga0451837_1287300 | Ga0451837_1287300_98_1057 | 296 |
| 541 | 3300041512 | Ga0451853_0626903 | Ga0451853_0626903_781_1764 | 296 |
| 542 | 3300041512 | Ga0451853_4094857 | Ga0451853_4094857_134_1093 | 296 |
| 543 | 3300041999 | Ga0439433_0005844 | Ga0439433_0005844_866_1825 | 296 |
| 544 | 3300042014 | Ga0439457_000081 | Ga0439457_000081_17892_18851 | 296 |
| 545 | 3300042131 | Ga0450894_000122 | Ga0450894_000122_10187_11212 | 296 |
| 546 | 3300042138 | Ga0450903_000534 | Ga0450903_000534_4404_5363 | 296 |
| 547 | 3300042138 | Ga0450903_006394 | Ga0450903_006394_873_1832 | 296 |
| 548 | 3300044658 | Ga0466972_0006575 | Ga0466972_0006575_2657_3616 | 296 |
| 549 | 3300044683 | Ga0466965_0094684 | Ga0466965_0094684_493_1476 | 296 |
| 550 | 3300044684 | Ga0466966_0000217 | Ga0466966_0000217_13687_14670 | 296 |
| 551 | 3300044706 | Ga0466964_0077842 | Ga0466964_0077842_348_1331 | 296 |
| 552 | 3300044719 | Ga0466971_0000341 | Ga0466971_0000341_5027_6010 | 296 |
| 553 | 3300044765 | Ga0466970_0000466 | Ga0466970_0000466_4809_5792 | 296 |
| 554 | 3300044842 | Ga0466957_0000214 | Ga0466957_0000214_11403_12386 | 296 |
| 555 | 3300044901 | Ga0466960_0114624 | Ga0466960_0114624_324_1283 | 296 |
| 556 | 3300044901 | Ga0466960_0157659 | Ga0466960_0157659_43_1002 | 296 |
| 557 | 3300045049 | Ga0466959_0001039 | Ga0466959_0001039_358_1341 | 296 |
| 558 | 3300045836 | Ga0466958_0043457 | Ga0466958_0043457_682_1665 | 296 |
| 559 | 3300045976 | Ga0466967_0036607 | Ga0466967_0036607_1244_2227 | 296 |
| 560 | 3300046454 | Ga0495592_0018516 | Ga0495592_0018516_3178_4137 | 296 |
| 561 | 3300046462 | Ga0495651_0001081 | Ga0495651_0001081_18489_19448 | 296 |
| 562 | 3300046476 | Ga0495662_0012229 | Ga0495662_0012229_2567_3526 | 296 |
| 563 | 3300046477 | Ga0495664_0006458 | Ga0495664_0006458_2454_3413 | 296 |
| 564 | 3300046506 | Ga0495583_0063341 | Ga0495583_0063341_106_1065 | 296 |
| 565 | 3300046514 | Ga0495618_0037473 | Ga0495618_0037473_1539_2498 | 296 |
| 566 | 3300046522 | Ga0495643_0044441 | Ga0495643_0044441_954_1913 | 296 |
| 567 | 3300046529 | Ga0495652_0045461 | Ga0495652_0045461_1242_2201 | 296 |
| 568 | 3300046533 | Ga0495640_0079904 | Ga0495640_0079904_772_1731 | 296 |
| 569 | 3300046536 | Ga0495587_0004877 | Ga0495587_0004877_2918_3877 | 296 |
| 570 | 3300046543 | Ga0495645_0006917 | Ga0495645_0006917_1041_2000 | 296 |
| 571 | 3300046557 | Ga0495622_0038241 | Ga0495622_0038241_1219_2178 | 296 |
| 572 | 3300046559 | Ga0495667_0182224 | Ga0495667_0182224_356_1315 | 296 |
| 573 | 3300046642 | Ga0495634_0060547 | Ga0495634_0060547_667_1626 | 296 |
| 574 | 3300046663 | Ga0495635_0004210 | Ga0495635_0004210_8220_9179 | 296 |
| 575 | 3300046675 | Ga0495657_0023461 | Ga0495657_0023461_33_992 | 296 |
| 576 | 3300046680 | Ga0495646_0001196 | Ga0495646_0001196_6875_7834 | 296 |
| 577 | 3300046690 | Ga0495624_0077908 | Ga0495624_0077908_901_1860 | 296 |
| 578 | 3300046809 | Ga0495600_0087414 | Ga0495600_0087414_33_992 | 296 |
| 579 | 3300047317 | Ga0495604_0052569 | Ga0495604_0052569_1302_2261 | 296 |
| 580 | 3300047319 | Ga0495674_0042932 | Ga0495674_0042932_755_1714 | 296 |
| 581 | 3300047443 | Ga0495687_001961 | Ga0495687_001961_956_1915 | 296 |
| 582 | 3300047444 | Ga0495675_0051183 | Ga0495675_0051183_1038_1997 | 296 |
| 583 | 3300047673 | Ga0495593_0011674 | Ga0495593_0011674_784_1743 | 296 |
| 584 | 3300049568 | Ga0501031_0106713 | Ga0501031_0106713_98_1057 | 296 |
| 585 | 3300049571 | Ga0501034_0167912 | Ga0501034_0167912_374_1333 | 296 |
| 586 | 3300049573 | Ga0501037_0029472 | Ga0501037_0029472_1784_2743 | 296 |
| 587 | 3300049573 | Ga0501037_0089835 | Ga0501037_0089835_706_1665 | 296 |
| 588 | 3300049578 | Ga0501042_0145729 | Ga0501042_0145729_514_1473 | 296 |
| 589 | 3300049579 | Ga0501043_0058840 | Ga0501043_0058840_1077_2036 | 296 |
| 590 | 3300049580 | Ga0501046_0124073 | Ga0501046_0124073_417_1376 | 296 |
| 591 | 3300049581 | Ga0501047_0013258 | Ga0501047_0013258_3708_4667 | 296 |
| 592 | 3300049824 | Ga0501045_0109797 | Ga0501045_0109797_664_1623 | 296 |
| 593 | 3300049824 | Ga0501045_0125624 | Ga0501045_0125624_68_1027 | 296 |
| 594 | 3300053078 | Ga0495612_0131746 | Ga0495612_0131746_32_991 | 296 |
| 595 | 3300053095 | Ga0500640_045372 | Ga0500640_045372_516_1475 | 296 |
| 596 | 3300053111 | Ga0500572_005113 | Ga0500572_005113_38_997 | 296 |
| 597 | 3300053145 | Ga0500586_081029 | Ga0500586_081029_49_1008 | 296 |
| 598 | 3300061719 | Ga0466962_0000800 | Ga0466962_0000800_11893_12876 | 296 |
| 599 | iso_pu_bacteria | 8025530807 | 8025536787 | 296 |
| 600 | 3300001990 | JGI24737J22298_10064695 | JGI24737J22298_100646952 | 297 |
| 601 | 3300002075 | JGI24738J21930_10015961 | JGI24738J21930_100159612 | 297 |
| 602 | 3300005539 | Ga0068853_100004360 | Ga0068853_1000043605 | 297 |
| 603 | 3300005614 | Ga0068856_100047398 | Ga0068856_1000473985 | 297 |
| 604 | 3300010375 | Ga0105239_10459994 | Ga0105239_104599942 | 297 |
| 605 | 3300013307 | Ga0157372_10088717 | Ga0157372_100887174 | 297 |
| 606 | 3300025904 | Ga0207647_10005923 | Ga0207647_100059234 | 297 |
| 607 | 3300026041 | Ga0207639_10028469 | Ga0207639_100284692 | 297 |
| 608 | 3300026078 | Ga0207702_10077473 | Ga0207702_100774732 | 297 |
| 609 | 3300028794 | Ga0307515_10000054 | Ga0307515_1000005417 | 297 |
| 610 | 3300030522 | Ga0307512_10152660 | Ga0307512_101526602 | 297 |
| 611 | 3300031507 | Ga0307509_10116597 | Ga0307509_101165972 | 297 |
| 612 | 3300044658 | Ga0466972_0157447 | Ga0466972_0157447_63_1022 | 297 |
| 613 | 3300046660 | Ga0495625_0011317 | Ga0495625_0011317_3073_4032 | 297 |
| 614 | 3300046674 | Ga0495588_0000781 | Ga0495588_0000781_12902_13861 | 297 |
| 615 | 3300046692 | Ga0495671_0043769 | Ga0495671_0043769_1275_2234 | 297 |
| 616 | 3300047318 | Ga0495636_0074676 | Ga0495636_0074676_21_1010 | 297 |
| 617 | 3300047470 | Ga0495681_0000977 | Ga0495681_0000977_15777_16736 | 297 |
| 618 | 3300047472 | Ga0495686_0185764 | Ga0495686_0185764_170_1129 | 297 |
| 619 | 3300049570 | Ga0501033_0001282 | Ga0501033_0001282_4607_5566 | 297 |
| 620 | 3300049571 | Ga0501034_0034100 | Ga0501034_0034100_1981_2940 | 297 |
| 621 | 3300049572 | Ga0501036_0004558 | Ga0501036_0004558_8706_9665 | 297 |
| 622 | 3300049574 | Ga0501038_0159879 | Ga0501038_0159879_229_1188 | 297 |
| 623 | 3300053107 | Ga0500560_000463 | Ga0500560_000463_2615_3574 | 297 |
| 624 | 3300061719 | Ga0466962_0067193 | Ga0466962_0067193_182_1141 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uw7-assembly1.cif.gz_B | the crystal structure of fbia from mycobacterium smegmatis, dehydro-f420-0 bound form | 0.9414 | 1 | 292 |
| 6uvx-assembly1.cif.gz_B | the crystal structure of fbia from mycobacterium smegmatis, apo state | 0.9338 | 1 | 292 |
| 6uw7-assembly1.cif.gz_B | the crystal structure of fbia from mycobacterium smegmatis, dehydro-f420-0 bound form | 0.9229 | 1 | 292 |
| 6uw1-assembly1.cif.gz_B | the crystal structure of fbia from mycobacterium smegmatis, fo bound form | 0.9219 | 1 | 292 |
| 3c3e-assembly2.cif.gz_D | crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46 | 0.9188 | 4 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ffeA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;CofD-like domain | 0.9328 | 37 | 124 | 1.10.8.240 |
| 2ffeA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;CofD-like domain | 0.9125 | 37 | 124 | 1.10.8.240 |
| 3c3eA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains | 0.8349 | 5 | 290 | 3.40.50.10680 |
| 3c3eA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains | 0.816 | 5 | 290 | 3.40.50.10680 |
| 1nhrA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8027 | 1 | 31 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A428ZBI4-F1-model_v4 | deleted | 0.9955 | 220 | 297 |
|
| AF-A0A656TIL7-F1-model_v4 | deleted | 0.9911 | 1 | 133 |
|
| AF-A0A656TIL7-F1-model_v4 | deleted | 0.9838 | 1 | 133 |
|
| AF-D6K2W5-F1-model_v4 | Phosphoenolpyruvate transferase (EC 2.7.8.28) (EPPG:FO PEP transferase) | 0.98 | 1 | 297 |
GO:0000287
GO:0043743 GO:0052645 |
| AF-A0A849BUL1-F1-model_v4 | 2-phospho-L-lactate transferase | 0.9782 | 1 | 180 |
GO:0000287
GO:0043743 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar