F470179

General Info

Members Datasets Scaffolds Average Seq Length
623 368 611 465

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10081548|Ga0075433_100815481
Length 480
Sequence MRGLRFARRGRQNHFMIPITTFAGKKVAVFGLGSSGLLAARALKEGGADVVVFDDDGKKTAEAQAAGLQAHDLHDIEWRKISSLVLTPGVPLTHPTPHWTVALARNANVEVIGDIELFCRERAKSGRECPLIAITGTNGKSTTTALTAHLLKSAGRDAQMGGNIGVPVLALEPFRPGRAYVLEASSYQIDLAPSLKPTVGVLLNVSEDHIDRHGSIENYSAIKERVPANVEQGGAAVIDVDDVYTRAAAERIEHAGKNVVRVSVESSLTDGYFSEGSHILRAARGKTHPVAELAGLGSLRGVHNAQNAACAVAACVALGIDLPAIQKGLRSFPGLAHRMQQVGHKGNVLFVNDSKATNADSASKALASFYDIFWIAGGKPKTGGINSLAEFFPRIRKAYLIGEATKEFAQTLDGKVAYEIDGVLSAAISAATRDAEASGLKEPVVLLSPACASFDQYPNFEVRGKAFIDAVMAISGVTEI

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
6 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
7 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
8 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
9 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
10 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
361 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
367 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
368 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 1.28
Rhizoplane 6.42
Rhizosphere 88.12
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214797992 2209111006 Bacteria 2098
2 ARSoilOldRDRAFT_c000230 3300000044 Bacteria 8490
3 ARCol0yngRDRAFT_1000425 3300000652 Bacteria 5410
4 JGI24739J22299_10037514 3300001989 Bacteria 1632
5 JGI24737J22298_10002225 3300001990 Bacteria 6917
6 JGI24745J21846_1000036 3300002073 Bacteria 9023
7 JGI24738J21930_10002861 3300002075 Bacteria 4423
8 JGI24749J21850_1005252 3300002076 Bacteria 1817
9 JGI24744J21845_10001136 3300002077 Bacteria 5178
10 JGI24742J22300_10000210 3300002244 Bacteria 8662
11 JGI24751J29686_10012561 3300002459 Bacteria 1746
12 Ga0065712_10001033 3300005290 Bacteria 10330
13 Ga0065715_10000973 3300005293 Bacteria 7498
14 Ga0065715_10095332 3300005293 Bacteria 4107
15 Ga0070658_10153847 3300005327 Bacteria 1927
16 Ga0070676_10000499 3300005328 Bacteria 18707
17 Ga0070683_100000265 3300005329 Bacteria 36059
18 Ga0070690_100000718 3300005330 Bacteria 16997
19 Ga0070690_100064430 3300005330 Bacteria 2367
20 Ga0070670_100082630 3300005331 Bacteria 2760
21 Ga0070677_10001854 3300005333 Bacteria 6684
22 Ga0068869_100000414 3300005334 Bacteria 23258
23 Ga0070666_10020782 3300005335 Bacteria 4247
24 Ga0070666_10020803 3300005335 Bacteria 4245
25 Ga0070680_100001359 3300005336 Bacteria 17686
26 Ga0070680_100201724 3300005336 Bacteria 1678
27 Ga0070682_100000745 3300005337 Bacteria 19431
28 Ga0068868_100008743 3300005338 Bacteria 7253
29 Ga0070660_100000136 3300005339 Bacteria 46892
30 Ga0070689_100000722 3300005340 Bacteria 20157
31 Ga0070691_10000148 3300005341 Bacteria 22373
32 Ga0070687_100000080 3300005343 Bacteria 31259
33 Ga0070687_100034617 3300005343 Bacteria 2501
34 Ga0070661_100000425 3300005344 Bacteria 32302
35 Ga0070692_10000893 3300005345 Bacteria 10102
36 Ga0070668_100005857 3300005347 Bacteria 9111
37 Ga0070669_100000276 3300005353 Bacteria 41366
38 Ga0070669_100002660 3300005353 Bacteria 12871
39 Ga0070675_100000271 3300005354 Bacteria 34156
40 Ga0070675_100008544 3300005354 Bacteria 7949
41 Ga0070671_100000389 3300005355 Bacteria 30190
42 Ga0070671_100012096 3300005355 Bacteria 6944
43 Ga0070674_100000928 3300005356 Bacteria 15290
44 Ga0070673_100001722 3300005364 Bacteria 13004
45 Ga0070688_100001089 3300005365 Bacteria 13567
46 Ga0070659_100008795 3300005366 Bacteria 7396
47 Ga0070659_100190426 3300005366 Bacteria 1686
48 Ga0070667_100001569 3300005367 Bacteria 20471
49 Ga0070667_100055063 3300005367 Bacteria 3359
50 Ga0070703_10004879 3300005406 Bacteria 3747
51 Ga0070709_10104430 3300005434 Bacteria 1893
52 Ga0070710_10002708 3300005437 Bacteria 8421
53 Ga0070701_10000457 3300005438 Bacteria 13932
54 Ga0070705_100000579 3300005440 Bacteria 21266
55 Ga0070700_100000515 3300005441 Bacteria 19292
56 Ga0070700_100030715 3300005441 Bacteria 3214
57 Ga0070694_100001641 3300005444 Bacteria 13154
58 Ga0070708_100027296 3300005445 Bacteria 4897
59 Ga0070708_100148472 3300005445 Bacteria 2179
60 Ga0070663_100000580 3300005455 Bacteria 19553
61 Ga0070678_100000016 3300005456 Bacteria 53269
62 Ga0070678_100008371 3300005456 Bacteria 6195
63 Ga0070662_100001325 3300005457 Bacteria 15215
64 Ga0070681_10001764 3300005458 Bacteria 19392
65 Ga0068867_100002288 3300005459 Bacteria 13466
66 Ga0070685_10000344 3300005466 Bacteria 28550
67 Ga0070685_10059463 3300005466 Bacteria 2231
68 Ga0070679_100001267 3300005530 Bacteria 22298
69 Ga0070684_100002476 3300005535 Bacteria 13600
70 Ga0070684_100033334 3300005535 Bacteria 4396
71 Ga0068853_100001111 3300005539 Bacteria 19042
72 Ga0068853_100021373 3300005539 Bacteria 5395
73 Ga0070672_100000233 3300005543 Bacteria 31143
74 Ga0070672_100018746 3300005543 Bacteria 5011
75 Ga0070686_100000699 3300005544 Bacteria 19478
76 Ga0070686_100129693 3300005544 Bacteria 1742
77 Ga0070695_100001478 3300005545 Bacteria 13043
78 Ga0070696_100001198 3300005546 Bacteria 16816
79 Ga0070693_100000594 3300005547 Bacteria 16031
80 Ga0070665_100176101 3300005548 Bacteria 2140
81 Ga0070704_100000112 3300005549 Bacteria 28583
82 Ga0070704_100001736 3300005549 Bacteria 11901
83 Ga0068855_100007243 3300005563 Bacteria 13453
84 Ga0070664_100071641 3300005564 Bacteria 2970
85 Ga0070664_100191044 3300005564 Bacteria 1824
86 Ga0068857_100000371 3300005577 Bacteria 31431
87 Ga0068854_100000735 3300005578 Bacteria 19431
88 Ga0068856_100000520 3300005614 Bacteria 42483
89 Ga0068856_100164064 3300005614 Bacteria 2233
90 Ga0068856_100235815 3300005614 Bacteria 1845
91 Ga0070702_100000122 3300005615 Bacteria 23858
92 Ga0068859_100019554 3300005617 Bacteria 6804
93 Ga0068864_100000333 3300005618 Bacteria 41669
94 Ga0068864_100207791 3300005618 Bacteria 1801
95 Ga0068861_100000417 3300005719 Bacteria 24695
96 Ga0068870_10000113 3300005840 Bacteria 27642
97 Ga0068863_100004693 3300005841 Bacteria 13466
98 Ga0068858_100000975 3300005842 Bacteria 29622
99 Ga0068860_100001740 3300005843 Bacteria 23200
100 Ga0081455_10000110 3300005937 Bacteria 92459
101 Ga0081455_10007679 3300005937 Bacteria 11320
102 Ga0081540_1003272 3300005983 Bacteria 12881
103 Ga0081540_1036865 3300005983 Bacteria 2601
104 Ga0070717_10002936 3300006028 Bacteria 12106
105 Ga0070717_10092207 3300006028 Bacteria 2559
106 Ga0075432_10040263 3300006058 Bacteria 1631
107 Ga0070712_100008568 3300006175 Bacteria 6435
108 Ga0070712_100048251 3300006175 Bacteria 2951
109 Ga0075427_10002058 3300006194 Bacteria 2661
110 Ga0097621_100000203 3300006237 Bacteria 38745
111 Ga0097621_100049459 3300006237 Bacteria 3415
112 Ga0075370_10018625 3300006353 Bacteria 3768
113 Ga0068871_100000575 3300006358 Bacteria 25171
114 Ga0068871_100192678 3300006358 Bacteria 1756
115 Ga0075428_100008481 3300006844 Bacteria 11403
116 Ga0075430_100000012 3300006846 Bacteria 94359
117 Ga0075431_100003622 3300006847 Bacteria 14964
118 Ga0075433_10014382 3300006852 Bacteria 6464
119 Ga0075433_10081548 3300006852 Bacteria 2852
120 Ga0075434_100000114 3300006871 Bacteria 46406
121 Ga0075434_100020042 3300006871 Bacteria 6479
122 Ga0075434_100030889 3300006871 Bacteria 5279
123 Ga0075434_100052011 3300006871 Bacteria 4070
124 Ga0075429_100002694 3300006880 Bacteria 14964
125 Ga0068865_100000654 3300006881 Bacteria 19602
126 Ga0097620_100019554 3300006931 Bacteria 6804
127 Ga0075435_100019420 3300007076 Bacteria 5191
128 Ga0075435_100023780 3300007076 Bacteria 4746
129 Ga0105240_10246481 3300009093 Bacteria 2069
130 Ga0111539_10000581 3300009094 Bacteria 47068
131 Ga0111539_10002232 3300009094 Bacteria 25871
132 Ga0111539_10004022 3300009094 Bacteria 19301
133 Ga0105245_10000230 3300009098 Bacteria 53225
134 Ga0105245_10022871 3300009098 Bacteria 5484
135 Ga0105247_10009917 3300009101 Bacteria 5769
136 Ga0114129_10008877 3300009147 Bacteria 14335
137 Ga0114129_10010926 3300009147 Bacteria 12938
138 Ga0105243_10002755 3300009148 Bacteria 14611
139 Ga0105243_10021104 3300009148 Bacteria 4943
140 Ga0105243_10043053 3300009148 Bacteria 3538
141 Ga0105241_10001308 3300009174 Bacteria 18957
142 Ga0105242_10000696 3300009176 Bacteria 26370
143 Ga0105242_10012804 3300009176 Bacteria 6461
144 Ga0105248_10001593 3300009177 Bacteria 25250
145 Ga0105248_10009030 3300009177 Bacteria 10965
146 Ga0105248_10098683 3300009177 Bacteria 3291
147 Ga0105237_10113575 3300009545 Bacteria 2701
148 Ga0105238_10030898 3300009551 Bacteria 5451
149 Ga0105249_10001642 3300009553 Bacteria 19605
150 Ga0105249_10102158 3300009553 Bacteria 2698
151 Ga0105249_10118547 3300009553 Bacteria 2512
152 Ga0105239_10009048 3300010375 Bacteria 11275
153 Ga0105246_10000550 3300011119 Bacteria 20662
154 Ga0105246_10122940 3300011119 Bacteria 1926
155 Ga0157373_10011542 3300013100 Bacteria 6492
156 Ga0157371_10029473 3300013102 Bacteria 3968
157 Ga0157370_10062178 3300013104 Bacteria 3542
158 Ga0157374_10002125 3300013296 Bacteria 16679
159 Ga0157378_10000864 3300013297 Bacteria 28028
160 Ga0157378_10181280 3300013297 Bacteria 1981
161 Ga0163162_10000420 3300013306 Bacteria 39042
162 Ga0163162_10016129 3300013306 Bacteria 7303
163 Ga0157372_10003944 3300013307 Bacteria 15940
164 Ga0157372_10005907 3300013307 Bacteria 13032
165 Ga0157375_10001626 3300013308 Bacteria 19334
166 Ga0157375_10061566 3300013308 Bacteria 3727
167 Ga0157375_10235618 3300013308 Bacteria 1989
168 Ga0163163_10003284 3300014325 Bacteria 13715
169 Ga0163163_10081470 3300014325 Bacteria 3238
170 Ga0157380_10000511 3300014326 Bacteria 23725
171 Ga0157377_10000053 3300014745 Bacteria 89091
172 Ga0157379_10001333 3300014968 Bacteria 20150
173 Ga0157379_10024669 3300014968 Bacteria 5337
174 Ga0157379_10075180 3300014968 Bacteria 3024
175 Ga0157376_10000436 3300014969 Bacteria 26857
176 Ga0163161_10000555 3300017792 Bacteria 30093
177 Ga0207666_1000014 3300025271 Bacteria 41355
178 Ga0209758_1010107 3300025297 Bacteria 5715
179 Ga0207697_10000672 3300025315 Bacteria 19436
180 Ga0207653_10007649 3300025885 Bacteria 3371
181 Ga0207682_10000154 3300025893 Bacteria 31265
182 Ga0207710_10001145 3300025900 Bacteria 13506
183 Ga0207710_10033844 3300025900 Bacteria 2243
184 Ga0207688_10001479 3300025901 Bacteria 12310
185 Ga0207680_10022307 3300025903 Bacteria 3440
186 Ga0207685_10011949 3300025905 Bacteria 2633
187 Ga0207645_10000182 3300025907 Bacteria 50129
188 Ga0207643_10000405 3300025908 Bacteria 28698
189 Ga0207705_10100274 3300025909 Bacteria 2130
190 Ga0207654_10008238 3300025911 Bacteria 5261
191 Ga0207707_10001762 3300025912 Bacteria 19871
192 Ga0207695_10162560 3300025913 Bacteria 2163
193 Ga0207693_10007487 3300025915 Bacteria 8977
194 Ga0207660_10000007 3300025917 Bacteria 102878
195 Ga0207662_10000913 3300025918 Bacteria 13677
196 Ga0207662_10027211 3300025918 Bacteria 3301
197 Ga0207662_10041211 3300025918 Bacteria 2718
198 Ga0207657_10005343 3300025919 Bacteria 13456
199 Ga0207649_10000143 3300025920 Bacteria 59962
200 Ga0207649_10081042 3300025920 Bacteria 2101
201 Ga0207652_10000459 3300025921 Bacteria 42058
202 Ga0207652_10143839 3300025921 Bacteria 2133
203 Ga0207681_10000506 3300025923 Bacteria 27118
204 Ga0207650_10009331 3300025925 Bacteria 6705
205 Ga0207659_10000015 3300025926 Bacteria 168475
206 Ga0207687_10000357 3300025927 Bacteria 30477
207 Ga0207687_10018417 3300025927 Bacteria 4609
208 Ga0207687_10025228 3300025927 Bacteria 3977
209 Ga0207700_10001137 3300025928 Bacteria 15268
210 Ga0207700_10133441 3300025928 Bacteria 2031
211 Ga0207664_10027404 3300025929 Bacteria 4319
212 Ga0207664_10086611 3300025929 Bacteria 2559
213 Ga0207644_10000251 3300025931 Bacteria 36497
214 Ga0207644_10005542 3300025931 Bacteria 8213
215 Ga0207706_10002583 3300025933 Bacteria 17644
216 Ga0207706_10021896 3300025933 Bacteria 5737
217 Ga0207686_10000234 3300025934 Bacteria 42207
218 Ga0207686_10012409 3300025934 Bacteria 4687
219 Ga0207709_10000081 3300025935 Bacteria 164427
220 Ga0207709_10018748 3300025935 Bacteria 3880
221 Ga0207670_10000620 3300025936 Bacteria 19095
222 Ga0207670_10018819 3300025936 Bacteria 4207
223 Ga0207669_10000008 3300025937 Bacteria 168213
224 Ga0207704_10002142 3300025938 Bacteria 8851
225 Ga0207665_10001484 3300025939 Bacteria 15767
226 Ga0207691_10002588 3300025940 Bacteria 17682
227 Ga0207691_10106091 3300025940 Bacteria 2502
228 Ga0207711_10001662 3300025941 Bacteria 20503
229 Ga0207711_10043909 3300025941 Bacteria 3814
230 Ga0207711_10129229 3300025941 Bacteria 2263
231 Ga0207689_10000749 3300025942 Bacteria 31134
232 Ga0207661_10000170 3300025944 Bacteria 41868
233 Ga0207661_10216292 3300025944 Bacteria 1691
234 Ga0207679_10000046 3300025945 Bacteria 119975
235 Ga0207667_10010820 3300025949 Bacteria 10639
236 Ga0207651_10000200 3300025960 Bacteria 26185
237 Ga0207712_10000555 3300025961 Bacteria 30178
238 Ga0207712_10011089 3300025961 Bacteria 5739
239 Ga0207668_10000133 3300025972 Bacteria 52202
240 Ga0207640_10000191 3300025981 Bacteria 43590
241 Ga0207658_10000535 3300025986 Bacteria 34617
242 Ga0207658_10131348 3300025986 Bacteria 2012
243 Ga0207658_10238082 3300025986 Bacteria 1540
244 Ga0207677_10001779 3300026023 Bacteria 11377
245 Ga0207703_10003074 3300026035 Bacteria 14117
246 Ga0207703_10012070 3300026035 Bacteria 6731
247 Ga0207639_10001004 3300026041 Bacteria 19189
248 Ga0207678_10001859 3300026067 Bacteria 19293
249 Ga0207678_10016738 3300026067 Bacteria 6439
250 Ga0207678_10042909 3300026067 Bacteria 3915
251 Ga0207708_10002476 3300026075 Bacteria 13580
252 Ga0207708_10002480 3300026075 Bacteria 13573
253 Ga0207702_10003065 3300026078 Bacteria 15534
254 Ga0207702_10142938 3300026078 Bacteria 2168
255 Ga0207641_10000593 3300026088 Bacteria 39825
256 Ga0207648_10002417 3300026089 Bacteria 20105
257 Ga0207676_10002520 3300026095 Bacteria 13061
258 Ga0207676_10259756 3300026095 Bacteria 1567
259 Ga0207674_10003381 3300026116 Bacteria 19581
260 Ga0207674_10058980 3300026116 Bacteria 3886
261 Ga0207675_100002182 3300026118 Bacteria 19438
262 Ga0207675_100050415 3300026118 Bacteria 3884
263 Ga0207675_100095986 3300026118 Bacteria 2790
264 Ga0207683_10000002 3300026121 Bacteria 258441
265 Ga0207683_10006919 3300026121 Bacteria 9710
266 Ga0207683_10026216 3300026121 Bacteria 5031
267 Ga0207698_10000545 3300026142 Bacteria 21874
268 Ga0210002_1003424 3300027617 Bacteria 2335
269 Ga0209998_10001951 3300027717 Bacteria 4843
270 Ga0209974_10000944 3300027876 Bacteria 10160
271 Ga0207428_10000011 3300027907 Bacteria 354388
272 Ga0207428_10000046 3300027907 Bacteria 191032
273 Ga0207428_10000058 3300027907 Bacteria 158579
274 Ga0207428_10001276 3300027907 Bacteria 26949
275 Ga0268266_10030112 3300028379 Bacteria 4611
276 Ga0268265_10011194 3300028380 Bacteria 6062
277 Ga0268264_10000340 3300028381 Bacteria 71850
278 Ga0307517_10000085 3300028786 Bacteria 131200
279 Ga0265325_10005052 3300031241 Bacteria 8209
280 Ga0265325_10008083 3300031241 Bacteria 6236
281 Ga0265325_10024983 3300031241 Bacteria 3245
282 Ga0265339_10000450 3300031249 Bacteria 32195
283 Ga0265316_10077382 3300031344 Bacteria 2555
284 Ga0307513_10194768 3300031456 Bacteria 1874
285 Ga0265313_10000340 3300031595 Bacteria 50703
286 Ga0265313_10005637 3300031595 Bacteria 9149
287 Ga0265313_10043711 3300031595 Bacteria 2192
288 Ga0265314_10001245 3300031711 Bacteria 29069
289 Ga0265314_10011444 3300031711 Bacteria 7323
290 Ga0265342_10000211 3300031712 Bacteria 65440
291 Ga0265342_10015086 3300031712 Bacteria 5097
292 Ga0265342_10037879 3300031712 Bacteria 2939
293 Ga0307516_10019297 3300031730 Bacteria 7063
294 Ga0373948_0000050 3300034817 Bacteria 12553
295 Ga0373950_0000879 3300034818 Bacteria 3794
296 Ga0373958_0000097 3300034819 Bacteria 9234
297 Ga0373958_0001146 3300034819 Bacteria 3507
298 Ga0373959_0000255 3300034820 Bacteria 11614
299 Ga0373938_0000032 3300034957 Bacteria 17872
300 Ga0373938_0002417 3300034957 Bacteria 3009
301 Ga0373928_0000973 3300035084 Bacteria 5617
302 Ga0373929_0001646 3300035085 Bacteria 4239
303 Ga0373929_0002085 3300035085 Bacteria 3718
304 Ga0373934_0038799 3300035086 Bacteria 1876
305 Ga0373940_0000828 3300035088 Bacteria 5149
306 Ga0373949_0001084 3300035090 Bacteria 8306
307 Ga0373951_0000472 3300035091 Bacteria 11551
308 Ga0373952_0000189 3300035092 Bacteria 9680
309 Ga0373952_0003514 3300035092 Bacteria 2827
310 Ga0373923_0028891 3300035111 Bacteria 2220
311 Ga0373932_0000180 3300035112 Bacteria 18517
312 Ga0373932_0003067 3300035112 Bacteria 4078
313 Ga0373936_0011822 3300035113 Bacteria 3311
314 Ga0373939_0000151 3300035114 Bacteria 19559
315 Ga0373939_0001945 3300035114 Bacteria 4940
316 Ga0373941_0001114 3300035115 Bacteria 5600
317 Ga0373941_0004341 3300035115 Bacteria 3268
318 Ga0373945_0032196 3300035116 Bacteria 1857
319 Ga0373953_0006108 3300035117 Bacteria 3951
320 Ga0373953_0008982 3300035117 Bacteria 3416
321 Ga0373954_0001664 3300035118 Bacteria 9102
322 Ga0373954_0015167 3300035118 Bacteria 3442
323 Ga0373954_0037497 3300035118 Bacteria 2253
324 Ga0373956_0015521 3300035119 Bacteria 3190
325 Ga0373960_0000156 3300035121 Bacteria 11721
326 Ga0373960_0000184 3300035121 Bacteria 11160
327 Ga0373960_0002802 3300035121 Bacteria 3950
328 Ga0373943_0008581 3300035170 Bacteria 4581
329 Ga0373946_0003393 3300035171 Bacteria 5654
330 Ga0373946_0019208 3300035171 Bacteria 2632
331 Ga0373955_0008032 3300035172 Bacteria 4878
332 Ga0373955_0008697 3300035172 Bacteria 4725
333 Ga0373942_0000457 3300035207 Bacteria 11506
334 Ga0373961_0002408 3300035241 Bacteria 4861
335 Ga0373962_0000113 3300035242 Bacteria 16882
336 Ga0373962_0000251 3300035242 Bacteria 11401
337 Ga0373962_0002284 3300035242 Bacteria 4578
338 Ga0373924_0002329 3300035410 Bacteria 6375
339 Ga0373924_0003763 3300035410 Bacteria 5243
340 Ga0373931_0000290 3300035691 Bacteria 21067
341 Ga0373931_0001559 3300035691 Bacteria 9897
342 Ga0373935_0000185 3300035692 Bacteria 29355
343 Ga0373927_0019298 3300035695 Bacteria 4472
344 Ga0373933_0037195 3300035724 Bacteria 2854
345 Ga0373947_0011703 3300035725 Bacteria 5030
346 Ga0373937_0000068 3300036401 Bacteria 94138
347 Ga0373937_0003441 3300036401 Bacteria 13290
348 Ga0373937_0037814 3300036401 Bacteria 4399
349 Ga0373925_0000913 3300037068 Bacteria 26960
350 Ga0373925_0025581 3300037068 Bacteria 4313
351 Ga0395898_0018149 3300037466 Bacteria 7181
352 Ga0436364_1425617 3300037853 Bacteria 2815
353 Ga0436365_1010704 3300039437 Bacteria 15340
354 Ga0436365_1829810 3300039437 Bacteria 2316
355 Ga0436361_0303370 3300039447 Bacteria 1717
356 Ga0466963_0074916 3300044694 Bacteria 2283
357 Ga0466964_0082769 3300044706 Bacteria 1381
358 Ga0453684_0113196 3300044712 Bacteria 3292
359 Ga0451576_0027624 3300045051 Bacteria 6091
360 Ga0466967_0107623 3300045976 Bacteria 2557
361 Ga0495617_004301 3300046452 Bacteria 5192
362 Ga0495592_0000488 3300046454 Bacteria 28883
363 Ga0495603_0010478 3300046455 Bacteria 5617
364 Ga0495603_0023619 3300046455 Bacteria 3719
365 Ga0495603_0037648 3300046455 Bacteria 2902
366 Ga0495629_0001536 3300046459 Bacteria 18162
367 Ga0495638_0032117 3300046460 Bacteria 3368
368 Ga0495651_0001053 3300046462 Bacteria 21347
369 Ga0495651_0002415 3300046462 Bacteria 14429
370 Ga0495651_0059789 3300046462 Bacteria 2921
371 Ga0495653_0000199 3300046463 Bacteria 48763
372 Ga0495653_0006680 3300046463 Bacteria 9465
373 Ga0495582_0001755 3300046473 Bacteria 12244
374 Ga0495605_0059715 3300046474 Bacteria 1830
375 Ga0495639_0010278 3300046475 Bacteria 4026
376 Ga0495662_0002942 3300046476 Bacteria 8598
377 Ga0495664_0000105 3300046477 Bacteria 41914
378 Ga0495664_0014203 3300046477 Bacteria 4511
379 Ga0495594_0036774 3300046499 Bacteria 2671
380 Ga0495594_0115956 3300046499 Bacteria 1512
381 Ga0495608_0000020 3300046511 Bacteria 169036
382 Ga0495608_0008586 3300046511 Bacteria 7155
383 Ga0495618_0000225 3300046514 Bacteria 41236
384 Ga0495628_0000005 3300046516 Bacteria 420969
385 Ga0495628_0020292 3300046516 Bacteria 5484
386 Ga0495628_0047505 3300046516 Bacteria 3405
387 Ga0495628_0090506 3300046516 Bacteria 2369
388 Ga0495630_0005536 3300046517 Bacteria 8914
389 Ga0495630_0271954 3300046517 Bacteria 1294
390 Ga0495652_0000001 3300046529 Bacteria 1045081
391 Ga0495665_0017692 3300046531 Bacteria 3832
392 Ga0495640_0000027 3300046533 Bacteria 90638
393 Ga0495587_0000017 3300046536 Bacteria 172923
394 Ga0495587_0004533 3300046536 Bacteria 9126
395 Ga0495609_0034479 3300046538 Bacteria 2294
396 Ga0495645_0000212 3300046543 Bacteria 41774
397 Ga0495645_0024148 3300046543 Bacteria 4409
398 Ga0495667_0000031 3300046559 Bacteria 147377
399 Ga0495667_0015229 3300046559 Bacteria 5191
400 Ga0495667_0080327 3300046559 Bacteria 2120
401 Ga0495656_0059117 3300046615 Bacteria 1666
402 Ga0495668_0018111 3300046616 Bacteria 4074
403 Ga0495634_0000006 3300046642 Bacteria 172775
404 Ga0495634_0022747 3300046642 Bacteria 4415
405 Ga0495634_0115184 3300046642 Bacteria 1725
406 Ga0495611_0030654 3300046648 Bacteria 2366
407 Ga0495635_0000154 3300046663 Bacteria 41886
408 Ga0495635_0008349 3300046663 Bacteria 7231
409 Ga0495635_0055138 3300046663 Bacteria 2738
410 Ga0495635_0143797 3300046663 Bacteria 1624
411 Ga0495657_0000828 3300046675 Bacteria 27353
412 Ga0495657_0005789 3300046675 Bacteria 9736
413 Ga0495599_0000051 3300046678 Bacteria 81853
414 Ga0495599_0013640 3300046678 Bacteria 5021
415 Ga0495623_0001373 3300046679 Bacteria 16526
416 Ga0495623_0003197 3300046679 Bacteria 10822
417 Ga0495646_0000102 3300046680 Bacteria 41798
418 Ga0495646_0004146 3300046680 Bacteria 9100
419 Ga0495647_0001979 3300046681 Bacteria 6401
420 Ga0495658_0004872 3300046683 Bacteria 6586
421 Ga0495669_0003877 3300046684 Bacteria 6153
422 Ga0495613_0003386 3300046689 Bacteria 11918
423 Ga0495613_0008152 3300046689 Bacteria 7791
424 Ga0495624_0017557 3300046690 Bacteria 4802
425 Ga0495600_0000069 3300046809 Bacteria 58754
426 Ga0495600_0010128 3300046809 Bacteria 5845
427 Ga0495581_0015179 3300047315 Bacteria 4471
428 Ga0495604_0000007 3300047317 Bacteria 412174
429 Ga0495674_0000001 3300047319 Bacteria 778665
430 Ga0495674_0059656 3300047319 Bacteria 3331
431 Ga0495674_0153002 3300047319 Bacteria 1934
432 Ga0495676_0153822 3300047321 Bacteria 1634
433 Ga0495680_0000216 3300047322 Bacteria 62986
434 Ga0495680_0007202 3300047322 Bacteria 10242
435 Ga0495680_0014111 3300047322 Bacteria 6938
436 Ga0495680_0103326 3300047322 Bacteria 2121
437 Ga0495675_0000216 3300047444 Bacteria 41783
438 Ga0495675_0005926 3300047444 Bacteria 7468
439 Ga0495684_0000009 3300047471 Bacteria 199436
440 Ga0495684_0003057 3300047471 Bacteria 13153
441 Ga0495593_0005967 3300047673 Bacteria 7174
442 Ga0495593_0012056 3300047673 Bacteria 4954
443 Ga0495602_0000373 3300048088 Bacteria 41729
444 Ga0495602_0037977 3300048088 Bacteria 4459
445 Ga0496100_0000171 3300048903 Bacteria 35989
446 Ga0496100_0049649 3300048903 Bacteria 2714
447 Ga0496101_0000246 3300048904 Bacteria 39478
448 Ga0496101_0055775 3300048904 Bacteria 2855
449 Ga0496102_0045863 3300048905 Bacteria 3968
450 Ga0496102_0052855 3300048905 Bacteria 3702
451 Ga0496103_0000753 3300048906 Bacteria 23863
452 Ga0496103_0013775 3300048906 Bacteria 4800
453 Ga0496103_0024347 3300048906 Bacteria 3654
454 Ga0496103_0067269 3300048906 Bacteria 2237
455 Ga0496104_0088059 3300048907 Bacteria 2966
456 Ga0496105_0009322 3300048908 Bacteria 7672
457 Ga0496105_0036145 3300048908 Bacteria 4068
458 Ga0496106_0000183 3300048909 Bacteria 45053
459 Ga0496106_0026194 3300048909 Bacteria 4339
460 Ga0496107_0001430 3300048910 Bacteria 14748
461 Ga0496107_0008995 3300048910 Bacteria 6922
462 Ga0496107_0024819 3300048910 Bacteria 4242
463 Ga0496107_0083401 3300048910 Bacteria 2331
464 Ga0496108_0001856 3300048911 Bacteria 16893
465 Ga0496108_0003772 3300048911 Bacteria 12130
466 Ga0496108_0047949 3300048911 Bacteria 3571
467 Ga0496109_0004054 3300048912 Bacteria 12240
468 Ga0496109_0004165 3300048912 Bacteria 12074
469 Ga0496109_0098648 3300048912 Bacteria 2708
470 Ga0496109_0183964 3300048912 Bacteria 1963
471 Ga0496109_0186624 3300048912 Bacteria 1948
472 Ga0496110_0007624 3300048913 Bacteria 8654
473 Ga0496110_0085718 3300048913 Bacteria 2812
474 Ga0496111_0036865 3300048914 Bacteria 3497
475 Ga0496112_0002096 3300048915 Bacteria 15835
476 Ga0496112_0247025 3300048915 Bacteria 1736
477 Ga0496113_0003761 3300048916 Bacteria 9157
478 Ga0496113_0017451 3300048916 Bacteria 4983
479 Ga0496113_0039473 3300048916 Bacteria 3475
480 Ga0496114_0002224 3300048917 Bacteria 14788
481 Ga0496115_0020141 3300048918 Bacteria 5142
482 Ga0496115_0026952 3300048918 Bacteria 4491
483 Ga0496115_0143410 3300048918 Bacteria 1970
484 Ga0496115_0168462 3300048918 Bacteria 1811
485 Ga0496121_0001497 3300048924 Bacteria 39336
486 Ga0496121_0003089 3300048924 Bacteria 24095
487 Ga0496125_0000154 3300048928 Bacteria 152240
488 Ga0496126_0074904 3300048929 Bacteria 3005
489 Ga0501032_0008293 3300049569 Bacteria 7571
490 Ga0501032_0019777 3300049569 Bacteria 4702
491 Ga0501032_0020626 3300049569 Bacteria 4587
492 Ga0501033_0033897 3300049570 Bacteria 3832
493 Ga0501033_0049039 3300049570 Bacteria 3135
494 Ga0501033_0079355 3300049570 Bacteria 2408
495 Ga0501033_0123341 3300049570 Bacteria 1879
496 Ga0501034_0000197 3300049571 Bacteria 114088
497 Ga0501034_0003303 3300049571 Bacteria 18422
498 Ga0501034_0013393 3300049571 Bacteria 8442
499 Ga0501034_0019841 3300049571 Bacteria 6868
500 Ga0501034_0021364 3300049571 Bacteria 6599
501 Ga0501034_0031012 3300049571 Bacteria 5433
502 Ga0501034_0087578 3300049571 Bacteria 3113
503 Ga0501034_0101010 3300049571 Bacteria 2878
504 Ga0501034_0120692 3300049571 Bacteria 2607
505 Ga0501034_0161491 3300049571 Bacteria 2211
506 Ga0501036_0001894 3300049572 Bacteria 16266
507 Ga0501036_0048563 3300049572 Bacteria 3593
508 Ga0501036_0051873 3300049572 Bacteria 3473
509 Ga0501036_0057570 3300049572 Bacteria 3292
510 Ga0501036_0068612 3300049572 Bacteria 3000
511 Ga0501036_0156118 3300049572 Bacteria 1924
512 Ga0501036_0181148 3300049572 Bacteria 1773
513 Ga0501037_0043649 3300049573 Bacteria 3294
514 Ga0501037_0044025 3300049573 Bacteria 3279
515 Ga0501038_0022795 3300049574 Bacteria 5604
516 Ga0501038_0052938 3300049574 Bacteria 3497
517 Ga0501038_0070121 3300049574 Bacteria 2977
518 Ga0501038_0209242 3300049574 Bacteria 1561
519 Ga0501039_0034296 3300049575 Bacteria 3916
520 Ga0501039_0044517 3300049575 Bacteria 3428
521 Ga0501040_0111273 3300049576 Bacteria 1915
522 Ga0501043_0003514 3300049579 Bacteria 12892
523 Ga0501043_0016234 3300049579 Bacteria 5840
524 Ga0501043_0024770 3300049579 Bacteria 4707
525 Ga0501043_0042646 3300049579 Bacteria 3565
526 Ga0501043_0050714 3300049579 Bacteria 3261
527 Ga0501043_0101567 3300049579 Bacteria 2260
528 Ga0501046_0008812 3300049580 Bacteria 8763
529 Ga0501046_0027889 3300049580 Bacteria 4603
530 Ga0501046_0047163 3300049580 Bacteria 3416
531 Ga0501047_0000688 3300049581 Bacteria 35266
532 Ga0501047_0003823 3300049581 Bacteria 14152
533 Ga0501047_0009938 3300049581 Bacteria 8998
534 Ga0501047_0077104 3300049581 Bacteria 3207
535 Ga0501047_0100572 3300049581 Bacteria 2770
536 Ga0501047_0130238 3300049581 Bacteria 2396
537 Ga0501047_0173479 3300049581 Bacteria 2025
538 Ga0501048_0000044 3300049582 Bacteria 60933
539 Ga0501048_0002575 3300049582 Bacteria 13870
540 Ga0501048_0077651 3300049582 Bacteria 2343
541 Ga0501068_0036118 3300049584 Bacteria 2953
542 Ga0501068_0147920 3300049584 Bacteria 1475
543 Ga0501069_0014126 3300049585 Bacteria 4263
544 Ga0501070_0006200 3300049586 Bacteria 10187
545 Ga0501070_0020220 3300049586 Bacteria 5584
546 Ga0501070_0046667 3300049586 Bacteria 3602
547 Ga0501070_0089611 3300049586 Bacteria 2546
548 Ga0501070_0185396 3300049586 Bacteria 1711
549 Ga0501071_0025123 3300049587 Bacteria 4171
550 Ga0501072_0058455 3300049588 Bacteria 3039
551 Ga0501073_0031621 3300049589 Bacteria 3776
552 Ga0501073_0043244 3300049589 Bacteria 3176
553 Ga0501073_0048730 3300049589 Bacteria 2973
554 Ga0501074_0040108 3300049590 Bacteria 3391
555 Ga0501077_0065796 3300049593 Bacteria 2299
556 Ga0501079_0098241 3300049741 Bacteria 2270
557 Ga0501080_0000153 3300049742 Bacteria 49231
558 Ga0501080_0080916 3300049742 Bacteria 3018
559 Ga0501083_0003065 3300049744 Bacteria 11615
560 Ga0501083_0022198 3300049744 Bacteria 4405
561 Ga0501083_0074383 3300049744 Bacteria 2257
562 Ga0501083_0081607 3300049744 Bacteria 2143
563 Ga0501083_0113885 3300049744 Bacteria 1777
564 Ga0501035_0011386 3300049822 Bacteria 8244
565 Ga0501035_0066183 3300049822 Bacteria 3207
566 Ga0501035_0103055 3300049822 Bacteria 2503
567 Ga0501035_0172862 3300049822 Bacteria 1865
568 Ga0501044_0007955 3300049823 Bacteria 11650
569 Ga0501044_0030717 3300049823 Bacteria 5660
570 Ga0501044_0057298 3300049823 Bacteria 3998
571 nmdc:mga07m45_24549_c1 3300050496 Bacteria 3304
572 nmdc:mga05p37_17666_c1 3300050507 Bacteria 8607
573 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
574 nmdc:mga09592_813_c1 3300050508 Bacteria 24096
575 nmdc:mga0qj67_1453_c1 3300050509 Bacteria 16598
576 nmdc:mga06r32_4634_c1 3300050510 Bacteria 12334
577 nmdc:mga08y16_1715_c1 3300050511 Bacteria 22248
578 nmdc:mga08y16_9096_c1 3300050511 Bacteria 10430
579 nmdc:mga0n895_1392_c1 3300050512 Bacteria 18016
580 nmdc:mga0n895_169721_c1 3300050512 Bacteria 2214
581 nmdc:mga0n895_46203_c1 3300050512 Bacteria 4252
582 nmdc:mga0n895_6890_c1 3300050512 Bacteria 9707
583 nmdc:mga0n895_971_c1 3300050512 Bacteria 20812
584 nmdc:mga0rr50_12087_c1 3300050513 Bacteria 5561
585 nmdc:mga0rr50_55713_c1 3300050513 Bacteria 2951
586 nmdc:mga0a205_1026_c1 3300050515 Bacteria 23240
587 nmdc:mga0a205_687_c1 3300050515 Bacteria 27032
588 Ga0495601_0000020 3300053077 Bacteria 160011
589 Ga0495601_0005819 3300053077 Bacteria 7188
590 Ga0495601_0041647 3300053077 Bacteria 2880
591 Ga0495612_0000030 3300053078 Bacteria 81917
592 Ga0495612_0015054 3300053078 Bacteria 3101
593 Ga0495612_0027973 3300053078 Bacteria 2268
594 Ga0495612_0029945 3300053078 Bacteria 2193
595 Ga0495595_0000125 3300053084 Bacteria 33101
596 Ga0495595_0001470 3300053084 Bacteria 9200
597 Ga0495619_0000151 3300053085 Bacteria 51364
598 Ga0495619_0000216 3300053085 Bacteria 41892
599 Ga0495619_0000419 3300053085 Bacteria 28779
600 Ga0495619_0022205 3300053085 Bacteria 4058
601 Ga0500643_003281 3300053087 Bacteria 7866
602 Ga0500644_0000314 3300053088 Bacteria 25311
603 Ga0500651_0053949 3300053093 Bacteria 2521
604 Ga0500641_0004097 3300053096 Bacteria 5148
605 Ga0500641_0041519 3300053096 Bacteria 1861
606 Ga0500595_000024 3300053119 Bacteria 144160
607 Ga0500652_000011 3300053131 Bacteria 160704
608 Ga0500616_0000001 3300053153 Bacteria 1986011
609 Ga0500645_000122 3300053730 Bacteria 61591
610 Ga0501084_0099209 3300054114 Bacteria 2446
611 Ga0501082_0157164 3300060353 Bacteria 1975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1425617 Ga0436364_1425617_22_1233 398
2 3300046517 Ga0495630_0271954 Ga0495630_0271954_16_1269 417
3 3300046680 Ga0495646_0004146 Ga0495646_0004146_14_1267 417
4 3300002076 JGI24749J21850_1005252 JGI24749J21850_10052522 424
5 3300005445 Ga0070708_100148472 Ga0070708_1001484722 427
6 3300035117 Ga0373953_0006108 Ga0373953_0006108_1560_2957 429
7 3300036401 Ga0373937_0003441 Ga0373937_0003441_11729_13126 429
8 3300005335 Ga0070666_10020782 Ga0070666_100207823 437
9 3300005456 Ga0070678_100008371 Ga0070678_1000083715 437
10 3300006237 Ga0097621_100049459 Ga0097621_1000494593 437
11 3300007076 Ga0075435_100023780 Ga0075435_1000237804 437
12 3300025900 Ga0207710_10033844 Ga0207710_100338442 437
13 3300025905 Ga0207685_10011949 Ga0207685_100119492 437
14 3300025927 Ga0207687_10018417 Ga0207687_100184173 437
15 3300025934 Ga0207686_10012409 Ga0207686_100124092 437
16 3300044706 Ga0466964_0082769 Ga0466964_0082769_15_1358 437
17 3300046462 Ga0495651_0059789 Ga0495651_0059789_939_2252 437
18 3300046516 Ga0495628_0047505 Ga0495628_0047505_223_1536 437
19 3300053078 Ga0495612_0027973 Ga0495612_0027973_546_1859 437
20 3300006175 Ga0070712_100008568 Ga0070712_1000085682 442
21 3300039437 Ga0436365_1010704 Ga0436365_1010704_162_1565 443
22 3300048928 Ga0496125_0000154 Ga0496125_0000154_48415_49815 444
23 3300049584 Ga0501068_0147920 Ga0501068_0147920_71_1405 444
24 3300049742 Ga0501080_0080916 Ga0501080_0080916_107_1501 444
25 3300049576 Ga0501040_0111273 Ga0501040_0111273_172_1584 446
26 3300049579 Ga0501043_0024770 Ga0501043_0024770_1295_2695 448
27 3300035114 Ga0373939_0001945 Ga0373939_0001945_2373_3785 449
28 3300006353 Ga0075370_10018625 Ga0075370_100186252 451
29 3300049571 Ga0501034_0019841 Ga0501034_0019841_1044_2444 451
30 3300050496 nmdc:mga07m45_24549_c1 nmdc:mga07m45_24549_c1_1209_2654 451
31 3300039447 Ga0436361_0303370 Ga0436361_0303370_142_1557 452
32 3300046499 Ga0495594_0115956 Ga0495594_0115956_101_1477 452
33 3300005327 Ga0070658_10153847 Ga0070658_101538472 453
34 3300025909 Ga0207705_10100274 Ga0207705_101002742 453
35 3300039437 Ga0436365_1829810 Ga0436365_1829810_581_1981 453
36 3300031241 Ga0265325_10008083 Ga0265325_100080833 454
37 3300049569 Ga0501032_0020626 Ga0501032_0020626_408_1805 454
38 3300049570 Ga0501033_0079355 Ga0501033_0079355_887_2284 454
39 3300049571 Ga0501034_0013393 Ga0501034_0013393_2293_3690 454
40 3300049572 Ga0501036_0048563 Ga0501036_0048563_2056_3453 454
41 3300049573 Ga0501037_0043649 Ga0501037_0043649_199_1596 454
42 3300049579 Ga0501043_0042646 Ga0501043_0042646_310_1707 454
43 3300049580 Ga0501046_0008812 Ga0501046_0008812_540_1937 454
44 3300049581 Ga0501047_0009938 Ga0501047_0009938_537_1934 454
45 3300049571 Ga0501034_0120692 Ga0501034_0120692_965_2377 455
46 3300049572 Ga0501036_0181148 Ga0501036_0181148_71_1483 455
47 3300049579 Ga0501043_0101567 Ga0501043_0101567_167_1579 455
48 3300049586 Ga0501070_0185396 Ga0501070_0185396_224_1636 455
49 3300005367 Ga0070667_100055063 Ga0070667_1000550633 456
50 3300005614 Ga0068856_100164064 Ga0068856_1001640642 456
51 3300009177 Ga0105248_10009030 Ga0105248_100090303 456
52 3300009177 Ga0105248_10098683 Ga0105248_100986832 456
53 3300014325 Ga0163163_10003284 Ga0163163_100032845 456
54 3300014968 Ga0157379_10024669 Ga0157379_100246692 456
55 3300025927 Ga0207687_10025228 Ga0207687_100252283 456
56 3300025928 Ga0207700_10133441 Ga0207700_101334412 456
57 3300025929 Ga0207664_10086611 Ga0207664_100866112 456
58 3300025941 Ga0207711_10129229 Ga0207711_101292291 456
59 3300026121 Ga0207683_10026216 Ga0207683_100262162 456
60 3300048903 Ga0496100_0049649 Ga0496100_0049649_419_1828 456
61 3300048905 Ga0496102_0052855 Ga0496102_0052855_2193_3602 456
62 3300048906 Ga0496103_0067269 Ga0496103_0067269_779_2188 456
63 3300048908 Ga0496105_0009322 Ga0496105_0009322_5715_7124 456
64 3300048911 Ga0496108_0003772 Ga0496108_0003772_8245_9690 456
65 3300048912 Ga0496109_0004165 Ga0496109_0004165_5980_7425 456
66 3300048912 Ga0496109_0183964 Ga0496109_0183964_165_1574 456
67 3300048915 Ga0496112_0002096 Ga0496112_0002096_10028_11473 456
68 3300048916 Ga0496113_0003761 Ga0496113_0003761_836_2281 456
69 3300048918 Ga0496115_0026952 Ga0496115_0026952_510_1919 456
70 3300048924 Ga0496121_0001497 Ga0496121_0001497_24153_25550 456
71 3300048929 Ga0496126_0074904 Ga0496126_0074904_1291_2688 456
72 3300049822 Ga0501035_0011386 Ga0501035_0011386_3916_5316 456
73 3300049572 Ga0501036_0057570 Ga0501036_0057570_402_1802 457
74 3300049579 Ga0501043_0016234 Ga0501043_0016234_3792_5192 457
75 3300053131 Ga0500652_000011 Ga0500652_000011_11366_12772 457
76 3300049570 Ga0501033_0033897 Ga0501033_0033897_1027_2442 460
77 3300049572 Ga0501036_0068612 Ga0501036_0068612_993_2408 460
78 3300031344 Ga0265316_10077382 Ga0265316_100773822 461
79 3300031712 Ga0265342_10037879 Ga0265342_100378792 461
80 3300048910 Ga0496107_0083401 Ga0496107_0083401_440_1837 461
81 3300053077 Ga0495601_0041647 Ga0495601_0041647_77_1474 461
82 iso_pu_bacteria 2513237101 2513697437 462
83 iso_pu_bacteria 2643221547 2643755165 462
84 iso_pu_bacteria 2721755755 2723843070 462
85 iso_pu_bacteria 2791355199 2793079521 462
86 iso_pu_bacteria 2874604998 2874612598 462
87 iso_pu_bacteria 2879110137 2879118037 462
88 iso_pu_bacteria 2889033259 2889033628 462
89 iso_pu_bacteria 2922361189 2922366994 462
90 iso_pu_bacteria 2922386360 2922390223 462
91 iso_pu_bacteria 8006964411 8006966530 462
92 iso_pu_bacteria 8006984368 8006989359 462
93 iso_pu_bacteria 8006994254 8006997842 462
94 3300037466 Ga0395898_0018149 Ga0395898_0018149_2559_3974 463
95 3300049571 Ga0501034_0021364 Ga0501034_0021364_2391_3806 463
96 3300049581 Ga0501047_0077104 Ga0501047_0077104_960_2375 463
97 3300049581 Ga0501047_0173479 Ga0501047_0173479_297_1712 463
98 3300049582 Ga0501048_0000044 Ga0501048_0000044_2386_3801 463
99 3300049586 Ga0501070_0089611 Ga0501070_0089611_507_1922 463
100 3300005331 Ga0070670_100082630 Ga0070670_1000826302 464
101 3300005434 Ga0070709_10104430 Ga0070709_101044302 464
102 3300005437 Ga0070710_10002708 Ga0070710_100027087 464
103 3300005441 Ga0070700_100030715 Ga0070700_1000307152 464
104 3300005535 Ga0070684_100033334 Ga0070684_1000333344 464
105 3300005564 Ga0070664_100071641 Ga0070664_1000716412 464
106 3300005618 Ga0068864_100207791 Ga0068864_1002077912 464
107 3300006028 Ga0070717_10002936 Ga0070717_100029369 464
108 3300006028 Ga0070717_10092207 Ga0070717_100922072 464
109 3300006175 Ga0070712_100048251 Ga0070712_1000482513 464
110 3300006871 Ga0075434_100052011 Ga0075434_1000520112 464
111 3300009148 Ga0105243_10043053 Ga0105243_100430532 464
112 3300009176 Ga0105242_10012804 Ga0105242_100128045 464
113 3300009553 Ga0105249_10118547 Ga0105249_101185472 464
114 3300013308 Ga0157375_10235618 Ga0157375_102356182 464
115 3300014968 Ga0157379_10075180 Ga0157379_100751802 464
116 3300025915 Ga0207693_10007487 Ga0207693_100074875 464
117 3300025918 Ga0207662_10027211 Ga0207662_100272112 464
118 3300025925 Ga0207650_10009331 Ga0207650_100093316 464
119 3300025928 Ga0207700_10001137 Ga0207700_1000113710 464
120 3300025929 Ga0207664_10027404 Ga0207664_100274044 464
121 3300025931 Ga0207644_10005542 Ga0207644_100055426 464
122 3300025935 Ga0207709_10018748 Ga0207709_100187482 464
123 3300025939 Ga0207665_10001484 Ga0207665_100014849 464
124 3300025941 Ga0207711_10043909 Ga0207711_100439092 464
125 3300025944 Ga0207661_10216292 Ga0207661_102162922 464
126 3300025986 Ga0207658_10238082 Ga0207658_102380821 464
127 3300026035 Ga0207703_10012070 Ga0207703_100120705 464
128 3300026067 Ga0207678_10016738 Ga0207678_100167382 464
129 3300026095 Ga0207676_10259756 Ga0207676_102597561 464
130 3300026121 Ga0207683_10006919 Ga0207683_100069192 464
131 3300035085 Ga0373929_0002085 Ga0373929_0002085_1867_3261 464
132 3300035121 Ga0373960_0002802 Ga0373960_0002802_1766_3160 464
133 3300035171 Ga0373946_0019208 Ga0373946_0019208_1074_2468 464
134 3300035242 Ga0373962_0002284 Ga0373962_0002284_2622_4016 464
135 3300035691 Ga0373931_0001559 Ga0373931_0001559_266_1660 464
136 3300046455 Ga0495603_0010478 Ga0495603_0010478_3155_4549 464
137 3300046459 Ga0495629_0001536 Ga0495629_0001536_1691_3085 464
138 3300046473 Ga0495582_0001755 Ga0495582_0001755_890_2284 464
139 3300046681 Ga0495647_0001979 Ga0495647_0001979_1065_2459 464
140 3300046683 Ga0495658_0004872 Ga0495658_0004872_1486_2880 464
141 3300046689 Ga0495613_0003386 Ga0495613_0003386_9677_11071 464
142 3300047321 Ga0495676_0153822 Ga0495676_0153822_49_1443 464
143 3300047322 Ga0495680_0007202 Ga0495680_0007202_819_2213 464
144 3300048904 Ga0496101_0055775 Ga0496101_0055775_442_1836 464
145 3300048905 Ga0496102_0045863 Ga0496102_0045863_329_1723 464
146 3300048906 Ga0496103_0013775 Ga0496103_0013775_1155_2549 464
147 3300048907 Ga0496104_0088059 Ga0496104_0088059_1192_2586 464
148 3300048910 Ga0496107_0008995 Ga0496107_0008995_4371_5765 464
149 3300048911 Ga0496108_0047949 Ga0496108_0047949_1104_2498 464
150 3300048912 Ga0496109_0098648 Ga0496109_0098648_1207_2601 464
151 3300050512 nmdc:mga0n895_169721_c1 nmdc:mga0n895_169721_c1_490_1884 464
152 3300050512 nmdc:mga0n895_46203_c1 nmdc:mga0n895_46203_c1_660_2054 464
153 3300053085 Ga0495619_0000419 Ga0495619_0000419_16059_17453 464
154 3300053087 Ga0500643_003281 Ga0500643_003281_5593_6999 464
155 3300053088 Ga0500644_0000314 Ga0500644_0000314_14411_15817 464
156 3300053093 Ga0500651_0053949 Ga0500651_0053949_1077_2483 464
157 3300053119 Ga0500595_000024 Ga0500595_000024_117977_119383 464
158 3300053153 Ga0500616_0000001 Ga0500616_0000001_51816_53222 464
159 3300053730 Ga0500645_000122 Ga0500645_000122_51359_52765 464
160 3300005336 Ga0070680_100201724 Ga0070680_1002017242 465
161 3300006194 Ga0075427_10002058 Ga0075427_100020583 465
162 3300006844 Ga0075428_100008481 Ga0075428_1000084817 465
163 3300006846 Ga0075430_100000012 Ga0075430_10000001212 465
164 3300006847 Ga0075431_100003622 Ga0075431_1000036228 465
165 3300006852 Ga0075433_10014382 Ga0075433_100143825 465
166 3300006852 Ga0075433_10081548 Ga0075433_100815481 465
167 3300006871 Ga0075434_100000114 Ga0075434_10000011444 465
168 3300006871 Ga0075434_100020042 Ga0075434_1000200422 465
169 3300006880 Ga0075429_100002694 Ga0075429_1000026948 465
170 3300007076 Ga0075435_100019420 Ga0075435_1000194202 465
171 3300009094 Ga0111539_10002232 Ga0111539_100022325 465
172 3300009147 Ga0114129_10008877 Ga0114129_100088775 465
173 3300009147 Ga0114129_10010926 Ga0114129_100109265 465
174 3300027907 Ga0207428_10000058 Ga0207428_1000005874 465
175 3300031241 Ga0265325_10005052 Ga0265325_100050524 465
176 3300031249 Ga0265339_10000450 Ga0265339_1000045018 465
177 3300031595 Ga0265313_10005637 Ga0265313_100056374 465
178 3300031711 Ga0265314_10001245 Ga0265314_100012456 465
179 3300031711 Ga0265314_10011444 Ga0265314_100114442 465
180 3300031712 Ga0265342_10000211 Ga0265342_1000021120 465
181 3300031712 Ga0265342_10015086 Ga0265342_100150863 465
182 3300044694 Ga0466963_0074916 Ga0466963_0074916_638_2035 465
183 3300045976 Ga0466967_0107623 Ga0466967_0107623_608_2005 465
184 3300049570 Ga0501033_0123341 Ga0501033_0123341_269_1666 465
185 3300049744 Ga0501083_0022198 Ga0501083_0022198_2807_4228 465
186 3300050507 nmdc:mga05p37_17666_c1 nmdc:mga05p37_17666_c1_4301_5698 465
187 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_43107_44504 465
188 3300050508 nmdc:mga09592_813_c1 nmdc:mga09592_813_c1_7935_9332 465
189 3300050509 nmdc:mga0qj67_1453_c1 nmdc:mga0qj67_1453_c1_7963_9360 465
190 3300050510 nmdc:mga06r32_4634_c1 nmdc:mga06r32_4634_c1_3265_4662 465
191 3300050511 nmdc:mga08y16_1715_c1 nmdc:mga08y16_1715_c1_12029_13426 465
192 3300050512 nmdc:mga0n895_1392_c1 nmdc:mga0n895_1392_c1_8616_10013 465
193 3300050512 nmdc:mga0n895_6890_c1 nmdc:mga0n895_6890_c1_1074_2471 465
194 3300050513 nmdc:mga0rr50_12087_c1 nmdc:mga0rr50_12087_c1_556_1953 465
195 3300050513 nmdc:mga0rr50_55713_c1 nmdc:mga0rr50_55713_c1_1006_2403 465
196 3300050515 nmdc:mga0a205_687_c1 nmdc:mga0a205_687_c1_17816_19213 465
197 3300005366 Ga0070659_100190426 Ga0070659_1001904262 466
198 3300005544 Ga0070686_100129693 Ga0070686_1001296931 466
199 3300005614 Ga0068856_100235815 Ga0068856_1002358152 466
200 3300005983 Ga0081540_1003272 Ga0081540_100327211 466
201 3300005983 Ga0081540_1036865 Ga0081540_10368652 466
202 3300006871 Ga0075434_100030889 Ga0075434_1000308893 466
203 3300009553 Ga0105249_10102158 Ga0105249_101021581 466
204 3300013307 Ga0157372_10003944 Ga0157372_1000394416 466
205 3300013307 Ga0157372_10005907 Ga0157372_100059072 466
206 3300025297 Ga0209758_1010107 Ga0209758_10101073 466
207 3300025933 Ga0207706_10021896 Ga0207706_100218961 466
208 3300025940 Ga0207691_10106091 Ga0207691_101060912 466
209 3300026078 Ga0207702_10142938 Ga0207702_101429382 466
210 3300026118 Ga0207675_100095986 Ga0207675_1000959862 466
211 3300028379 Ga0268266_10030112 Ga0268266_100301122 466
212 3300028786 Ga0307517_10000085 Ga0307517_10000085117 466
213 3300031241 Ga0265325_10024983 Ga0265325_100249832 466
214 3300031456 Ga0307513_10194768 Ga0307513_101947682 466
215 3300031595 Ga0265313_10000340 Ga0265313_1000034023 466
216 3300031595 Ga0265313_10043711 Ga0265313_100437111 466
217 3300031730 Ga0307516_10019297 Ga0307516_100192978 466
218 3300035086 Ga0373934_0038799 Ga0373934_0038799_185_1585 466
219 3300035113 Ga0373936_0011822 Ga0373936_0011822_334_1734 466
220 3300035115 Ga0373941_0004341 Ga0373941_0004341_1381_2781 466
221 3300035117 Ga0373953_0008982 Ga0373953_0008982_1164_2564 466
222 3300035118 Ga0373954_0001664 Ga0373954_0001664_358_1758 466
223 3300035118 Ga0373954_0037497 Ga0373954_0037497_645_2045 466
224 3300035119 Ga0373956_0015521 Ga0373956_0015521_216_1616 466
225 3300035170 Ga0373943_0008581 Ga0373943_0008581_2617_4017 466
226 3300035171 Ga0373946_0003393 Ga0373946_0003393_3169_4569 466
227 3300035172 Ga0373955_0008697 Ga0373955_0008697_3287_4687 466
228 3300035410 Ga0373924_0002329 Ga0373924_0002329_4761_6161 466
229 3300035692 Ga0373935_0000185 Ga0373935_0000185_17450_18850 466
230 3300035695 Ga0373927_0019298 Ga0373927_0019298_594_1994 466
231 3300035724 Ga0373933_0037195 Ga0373933_0037195_1082_2482 466
232 3300035725 Ga0373947_0011703 Ga0373947_0011703_179_1579 466
233 3300036401 Ga0373937_0000068 Ga0373937_0000068_72923_74323 466
234 3300037068 Ga0373925_0000913 Ga0373925_0000913_20627_22027 466
235 3300037068 Ga0373925_0025581 Ga0373925_0025581_176_1576 466
236 3300046452 Ga0495617_004301 Ga0495617_004301_2455_3855 466
237 3300046454 Ga0495592_0000488 Ga0495592_0000488_7918_9318 466
238 3300046455 Ga0495603_0023619 Ga0495603_0023619_1352_2752 466
239 3300046460 Ga0495638_0032117 Ga0495638_0032117_125_1525 466
240 3300046462 Ga0495651_0002415 Ga0495651_0002415_34_1434 466
241 3300046463 Ga0495653_0000199 Ga0495653_0000199_9590_10990 466
242 3300046474 Ga0495605_0059715 Ga0495605_0059715_44_1444 466
243 3300046475 Ga0495639_0010278 Ga0495639_0010278_1082_2482 466
244 3300046476 Ga0495662_0002942 Ga0495662_0002942_4674_6074 466
245 3300046477 Ga0495664_0000105 Ga0495664_0000105_19822_21222 466
246 3300046477 Ga0495664_0014203 Ga0495664_0014203_2390_3790 466
247 3300046499 Ga0495594_0036774 Ga0495594_0036774_1174_2574 466
248 3300046511 Ga0495608_0000020 Ga0495608_0000020_19557_20957 466
249 3300046514 Ga0495618_0000225 Ga0495618_0000225_1217_2617 466
250 3300046516 Ga0495628_0000005 Ga0495628_0000005_72753_74153 466
251 3300046516 Ga0495628_0090506 Ga0495628_0090506_33_1433 466
252 3300046517 Ga0495630_0005536 Ga0495630_0005536_1147_2547 466
253 3300046529 Ga0495652_0000001 Ga0495652_0000001_1004991_1006391 466
254 3300046531 Ga0495665_0017692 Ga0495665_0017692_726_2126 466
255 3300046533 Ga0495640_0000027 Ga0495640_0000027_69495_70895 466
256 3300046536 Ga0495587_0000017 Ga0495587_0000017_21948_23348 466
257 3300046538 Ga0495609_0034479 Ga0495609_0034479_334_1734 466
258 3300046543 Ga0495645_0000212 Ga0495645_0000212_20617_22017 466
259 3300046559 Ga0495667_0000031 Ga0495667_0000031_125330_126730 466
260 3300046559 Ga0495667_0080327 Ga0495667_0080327_606_2006 466
261 3300046615 Ga0495656_0059117 Ga0495656_0059117_226_1626 466
262 3300046616 Ga0495668_0018111 Ga0495668_0018111_1542_2942 466
263 3300046642 Ga0495634_0000006 Ga0495634_0000006_132783_134183 466
264 3300046642 Ga0495634_0022747 Ga0495634_0022747_103_1503 466
265 3300046648 Ga0495611_0030654 Ga0495611_0030654_60_1460 466
266 3300046663 Ga0495635_0000154 Ga0495635_0000154_19829_21229 466
267 3300046663 Ga0495635_0055138 Ga0495635_0055138_328_1728 466
268 3300046675 Ga0495657_0000828 Ga0495657_0000828_19697_21097 466
269 3300046678 Ga0495599_0000051 Ga0495599_0000051_19741_21141 466
270 3300046679 Ga0495623_0001373 Ga0495623_0001373_13818_15218 466
271 3300046680 Ga0495646_0000102 Ga0495646_0000102_19760_21160 466
272 3300046684 Ga0495669_0003877 Ga0495669_0003877_4723_6123 466
273 3300046689 Ga0495613_0008152 Ga0495613_0008152_5809_7209 466
274 3300046690 Ga0495624_0017557 Ga0495624_0017557_3201_4601 466
275 3300046809 Ga0495600_0000069 Ga0495600_0000069_37443_38843 466
276 3300047315 Ga0495581_0015179 Ga0495581_0015179_863_2263 466
277 3300047317 Ga0495604_0000007 Ga0495604_0000007_372125_373525 466
278 3300047319 Ga0495674_0000001 Ga0495674_0000001_20657_22057 466
279 3300047319 Ga0495674_0059656 Ga0495674_0059656_158_1558 466
280 3300047322 Ga0495680_0000216 Ga0495680_0000216_60703_62103 466
281 3300047444 Ga0495675_0000216 Ga0495675_0000216_19697_21097 466
282 3300047471 Ga0495684_0000009 Ga0495684_0000009_38642_40042 466
283 3300047471 Ga0495684_0003057 Ga0495684_0003057_7761_9161 466
284 3300047673 Ga0495593_0005967 Ga0495593_0005967_5673_7073 466
285 3300047673 Ga0495593_0012056 Ga0495593_0012056_1730_3130 466
286 3300048088 Ga0495602_0000373 Ga0495602_0000373_19751_21151 466
287 3300048924 Ga0496121_0003089 Ga0496121_0003089_10742_12142 466
288 3300049569 Ga0501032_0008293 Ga0501032_0008293_45_1445 466
289 3300049569 Ga0501032_0019777 Ga0501032_0019777_3010_4422 466
290 3300049570 Ga0501033_0049039 Ga0501033_0049039_606_2018 466
291 3300049571 Ga0501034_0000197 Ga0501034_0000197_57383_58783 466
292 3300049571 Ga0501034_0003303 Ga0501034_0003303_8200_9600 466
293 3300049571 Ga0501034_0031012 Ga0501034_0031012_3596_4996 466
294 3300049571 Ga0501034_0087578 Ga0501034_0087578_77_1477 466
295 3300049571 Ga0501034_0101010 Ga0501034_0101010_697_2109 466
296 3300049571 Ga0501034_0161491 Ga0501034_0161491_767_2167 466
297 3300049572 Ga0501036_0001894 Ga0501036_0001894_9854_11254 466
298 3300049572 Ga0501036_0051873 Ga0501036_0051873_1332_2744 466
299 3300049572 Ga0501036_0156118 Ga0501036_0156118_233_1636 466
300 3300049573 Ga0501037_0044025 Ga0501037_0044025_1739_3139 466
301 3300049574 Ga0501038_0022795 Ga0501038_0022795_3109_4509 466
302 3300049574 Ga0501038_0052938 Ga0501038_0052938_60_1472 466
303 3300049574 Ga0501038_0070121 Ga0501038_0070121_269_1672 466
304 3300049574 Ga0501038_0209242 Ga0501038_0209242_61_1461 466
305 3300049575 Ga0501039_0034296 Ga0501039_0034296_425_1837 466
306 3300049575 Ga0501039_0044517 Ga0501039_0044517_1964_3364 466
307 3300049579 Ga0501043_0003514 Ga0501043_0003514_4697_6097 466
308 3300049579 Ga0501043_0050714 Ga0501043_0050714_1118_2530 466
309 3300049580 Ga0501046_0027889 Ga0501046_0027889_1953_3353 466
310 3300049580 Ga0501046_0047163 Ga0501046_0047163_839_2251 466
311 3300049581 Ga0501047_0000688 Ga0501047_0000688_22814_24214 466
312 3300049581 Ga0501047_0003823 Ga0501047_0003823_3989_5389 466
313 3300049581 Ga0501047_0100572 Ga0501047_0100572_808_2220 466
314 3300049581 Ga0501047_0130238 Ga0501047_0130238_607_2007 466
315 3300049582 Ga0501048_0002575 Ga0501048_0002575_4486_5886 466
316 3300049582 Ga0501048_0077651 Ga0501048_0077651_513_1925 466
317 3300049584 Ga0501068_0036118 Ga0501068_0036118_744_2156 466
318 3300049585 Ga0501069_0014126 Ga0501069_0014126_2752_4164 466
319 3300049586 Ga0501070_0006200 Ga0501070_0006200_6472_7884 466
320 3300049586 Ga0501070_0020220 Ga0501070_0020220_2608_4008 466
321 3300049586 Ga0501070_0046667 Ga0501070_0046667_1137_2540 466
322 3300049587 Ga0501071_0025123 Ga0501071_0025123_1602_3014 466
323 3300049588 Ga0501072_0058455 Ga0501072_0058455_299_1711 466
324 3300049589 Ga0501073_0031621 Ga0501073_0031621_1308_2708 466
325 3300049589 Ga0501073_0043244 Ga0501073_0043244_599_2011 466
326 3300049589 Ga0501073_0048730 Ga0501073_0048730_461_1861 466
327 3300049590 Ga0501074_0040108 Ga0501074_0040108_1850_3250 466
328 3300049742 Ga0501080_0000153 Ga0501080_0000153_37844_39244 466
329 3300049744 Ga0501083_0003065 Ga0501083_0003065_1040_2440 466
330 3300049744 Ga0501083_0074383 Ga0501083_0074383_653_2053 466
331 3300049744 Ga0501083_0081607 Ga0501083_0081607_319_1731 466
332 3300049822 Ga0501035_0066183 Ga0501035_0066183_1016_2428 466
333 3300049822 Ga0501035_0103055 Ga0501035_0103055_827_2227 466
334 3300049822 Ga0501035_0172862 Ga0501035_0172862_347_1747 466
335 3300049823 Ga0501044_0007955 Ga0501044_0007955_1005_2405 466
336 3300049823 Ga0501044_0030717 Ga0501044_0030717_346_1749 466
337 3300049823 Ga0501044_0057298 Ga0501044_0057298_1855_3267 466
338 3300053077 Ga0495601_0000020 Ga0495601_0000020_137968_139368 466
339 3300053078 Ga0495612_0000030 Ga0495612_0000030_60720_62120 466
340 3300053084 Ga0495595_0000125 Ga0495595_0000125_11871_13271 466
341 3300053085 Ga0495619_0000216 Ga0495619_0000216_20666_22066 466
342 3300053096 Ga0500641_0004097 Ga0500641_0004097_2376_3776 466
343 3300053096 Ga0500641_0041519 Ga0500641_0041519_402_1802 466
344 3300060353 Ga0501082_0157164 Ga0501082_0157164_394_1794 466
345 3300005343 Ga0070687_100034617 Ga0070687_1000346171 468
346 3300005354 Ga0070675_100008544 Ga0070675_1000085444 468
347 3300009551 Ga0105238_10030898 Ga0105238_100308982 468
348 3300026116 Ga0207674_10058980 Ga0207674_100589802 468
349 3300048916 Ga0496113_0039473 Ga0496113_0039473_1275_2681 468
350 2209111006 2214797992 2213826281 469
351 3300000044 ARSoilOldRDRAFT_c000230 ARSoilOldRDRAFT_0002302 469
352 3300000652 ARCol0yngRDRAFT_1000425 ARCol0yngRDRAFT_10004254 469
353 3300001989 JGI24739J22299_10037514 JGI24739J22299_100375142 469
354 3300001990 JGI24737J22298_10002225 JGI24737J22298_100022254 469
355 3300002073 JGI24745J21846_1000036 JGI24745J21846_10000365 469
356 3300002075 JGI24738J21930_10002861 JGI24738J21930_100028612 469
357 3300002077 JGI24744J21845_10001136 JGI24744J21845_100011364 469
358 3300002244 JGI24742J22300_10000210 JGI24742J22300_100002105 469
359 3300002459 JGI24751J29686_10012561 JGI24751J29686_100125611 469
360 3300005290 Ga0065712_10001033 Ga0065712_100010334 469
361 3300005293 Ga0065715_10000973 Ga0065715_100009733 469
362 3300005293 Ga0065715_10095332 Ga0065715_100953323 469
363 3300005328 Ga0070676_10000499 Ga0070676_1000049910 469
364 3300005329 Ga0070683_100000265 Ga0070683_10000026517 469
365 3300005330 Ga0070690_100000718 Ga0070690_1000007186 469
366 3300005330 Ga0070690_100064430 Ga0070690_1000644302 469
367 3300005333 Ga0070677_10001854 Ga0070677_100018545 469
368 3300005334 Ga0068869_100000414 Ga0068869_1000004143 469
369 3300005335 Ga0070666_10020803 Ga0070666_100208033 469
370 3300005336 Ga0070680_100001359 Ga0070680_1000013597 469
371 3300005337 Ga0070682_100000745 Ga0070682_10000074510 469
372 3300005338 Ga0068868_100008743 Ga0068868_1000087433 469
373 3300005339 Ga0070660_100000136 Ga0070660_10000013635 469
374 3300005340 Ga0070689_100000722 Ga0070689_10000072210 469
375 3300005341 Ga0070691_10000148 Ga0070691_1000014810 469
376 3300005343 Ga0070687_100000080 Ga0070687_10000008010 469
377 3300005344 Ga0070661_100000425 Ga0070661_1000004258 469
378 3300005345 Ga0070692_10000893 Ga0070692_100008939 469
379 3300005347 Ga0070668_100005857 Ga0070668_1000058574 469
380 3300005353 Ga0070669_100000276 Ga0070669_10000027617 469
381 3300005353 Ga0070669_100002660 Ga0070669_1000026605 469
382 3300005354 Ga0070675_100000271 Ga0070675_10000027110 469
383 3300005355 Ga0070671_100000389 Ga0070671_10000038910 469
384 3300005355 Ga0070671_100012096 Ga0070671_1000120964 469
385 3300005356 Ga0070674_100000928 Ga0070674_10000092810 469
386 3300005364 Ga0070673_100001722 Ga0070673_1000017224 469
387 3300005365 Ga0070688_100001089 Ga0070688_1000010893 469
388 3300005366 Ga0070659_100008795 Ga0070659_1000087955 469
389 3300005367 Ga0070667_100001569 Ga0070667_10000156910 469
390 3300005406 Ga0070703_10004879 Ga0070703_100048793 469
391 3300005438 Ga0070701_10000457 Ga0070701_100004574 469
392 3300005440 Ga0070705_100000579 Ga0070705_1000005799 469
393 3300005441 Ga0070700_100000515 Ga0070700_1000005158 469
394 3300005444 Ga0070694_100001641 Ga0070694_1000016413 469
395 3300005445 Ga0070708_100027296 Ga0070708_1000272962 469
396 3300005455 Ga0070663_100000580 Ga0070663_10000058010 469
397 3300005456 Ga0070678_100000016 Ga0070678_10000001616 469
398 3300005457 Ga0070662_100001325 Ga0070662_10000132510 469
399 3300005458 Ga0070681_10001764 Ga0070681_1000176410 469
400 3300005459 Ga0068867_100002288 Ga0068867_10000228810 469
401 3300005466 Ga0070685_10000344 Ga0070685_1000034419 469
402 3300005466 Ga0070685_10059463 Ga0070685_100594631 469
403 3300005530 Ga0070679_100001267 Ga0070679_10000126710 469
404 3300005535 Ga0070684_100002476 Ga0070684_10000247610 469
405 3300005539 Ga0068853_100001111 Ga0068853_10000111111 469
406 3300005539 Ga0068853_100021373 Ga0068853_1000213731 469
407 3300005543 Ga0070672_100000233 Ga0070672_10000023310 469
408 3300005543 Ga0070672_100018746 Ga0070672_1000187463 469
409 3300005544 Ga0070686_100000699 Ga0070686_1000006998 469
410 3300005545 Ga0070695_100001478 Ga0070695_10000147810 469
411 3300005546 Ga0070696_100001198 Ga0070696_1000011987 469
412 3300005547 Ga0070693_100000594 Ga0070693_1000005948 469
413 3300005548 Ga0070665_100176101 Ga0070665_1001761012 469
414 3300005549 Ga0070704_100000112 Ga0070704_10000011217 469
415 3300005549 Ga0070704_100001736 Ga0070704_1000017368 469
416 3300005563 Ga0068855_100007243 Ga0068855_1000072434 469
417 3300005564 Ga0070664_100191044 Ga0070664_1001910441 469
418 3300005577 Ga0068857_100000371 Ga0068857_10000037126 469
419 3300005578 Ga0068854_100000735 Ga0068854_10000073510 469
420 3300005614 Ga0068856_100000520 Ga0068856_10000052034 469
421 3300005615 Ga0070702_100000122 Ga0070702_1000001223 469
422 3300005617 Ga0068859_100019554 Ga0068859_1000195544 469
423 3300005618 Ga0068864_100000333 Ga0068864_10000033329 469
424 3300005719 Ga0068861_100000417 Ga0068861_10000041710 469
425 3300005840 Ga0068870_10000113 Ga0068870_1000011314 469
426 3300005841 Ga0068863_100004693 Ga0068863_10000469310 469
427 3300005842 Ga0068858_100000975 Ga0068858_10000097518 469
428 3300005843 Ga0068860_100001740 Ga0068860_1000017404 469
429 3300005937 Ga0081455_10000110 Ga0081455_1000011048 469
430 3300005937 Ga0081455_10007679 Ga0081455_100076795 469
431 3300006058 Ga0075432_10040263 Ga0075432_100402631 469
432 3300006237 Ga0097621_100000203 Ga0097621_1000002038 469
433 3300006358 Ga0068871_100000575 Ga0068871_1000005755 469
434 3300006358 Ga0068871_100192678 Ga0068871_1001926781 469
435 3300006881 Ga0068865_100000654 Ga0068865_10000065410 469
436 3300006931 Ga0097620_100019554 Ga0097620_1000195543 469
437 3300009093 Ga0105240_10246481 Ga0105240_102464812 469
438 3300009094 Ga0111539_10000581 Ga0111539_1000058110 469
439 3300009094 Ga0111539_10004022 Ga0111539_1000402210 469
440 3300009098 Ga0105245_10000230 Ga0105245_1000023033 469
441 3300009098 Ga0105245_10022871 Ga0105245_100228713 469
442 3300009101 Ga0105247_10009917 Ga0105247_100099173 469
443 3300009148 Ga0105243_10002755 Ga0105243_100027558 469
444 3300009148 Ga0105243_10021104 Ga0105243_100211043 469
445 3300009174 Ga0105241_10001308 Ga0105241_100013088 469
446 3300009176 Ga0105242_10000696 Ga0105242_1000069616 469
447 3300009177 Ga0105248_10001593 Ga0105248_1000159316 469
448 3300009545 Ga0105237_10113575 Ga0105237_101135752 469
449 3300009553 Ga0105249_10001642 Ga0105249_1000164210 469
450 3300010375 Ga0105239_10009048 Ga0105239_100090484 469
451 3300011119 Ga0105246_10000550 Ga0105246_100005509 469
452 3300011119 Ga0105246_10122940 Ga0105246_101229402 469
453 3300013100 Ga0157373_10011542 Ga0157373_100115424 469
454 3300013102 Ga0157371_10029473 Ga0157371_100294732 469
455 3300013104 Ga0157370_10062178 Ga0157370_100621781 469
456 3300013296 Ga0157374_10002125 Ga0157374_100021252 469
457 3300013297 Ga0157378_10000864 Ga0157378_100008649 469
458 3300013297 Ga0157378_10181280 Ga0157378_101812801 469
459 3300013306 Ga0163162_10000420 Ga0163162_100004208 469
460 3300013306 Ga0163162_10016129 Ga0163162_100161293 469
461 3300013308 Ga0157375_10001626 Ga0157375_100016268 469
462 3300013308 Ga0157375_10061566 Ga0157375_100615661 469
463 3300014325 Ga0163163_10081470 Ga0163163_100814703 469
464 3300014326 Ga0157380_10000511 Ga0157380_1000051111 469
465 3300014745 Ga0157377_10000053 Ga0157377_1000005358 469
466 3300014968 Ga0157379_10001333 Ga0157379_1000133310 469
467 3300014969 Ga0157376_10000436 Ga0157376_1000043613 469
468 3300017792 Ga0163161_10000555 Ga0163161_1000055527 469
469 3300025271 Ga0207666_1000014 Ga0207666_10000143 469
470 3300025315 Ga0207697_10000672 Ga0207697_100006729 469
471 3300025885 Ga0207653_10007649 Ga0207653_100076493 469
472 3300025893 Ga0207682_10000154 Ga0207682_1000015426 469
473 3300025900 Ga0207710_10001145 Ga0207710_100011458 469
474 3300025901 Ga0207688_10001479 Ga0207688_1000147910 469
475 3300025903 Ga0207680_10022307 Ga0207680_100223073 469
476 3300025907 Ga0207645_10000182 Ga0207645_1000018241 469
477 3300025908 Ga0207643_10000405 Ga0207643_1000040512 469
478 3300025911 Ga0207654_10008238 Ga0207654_100082382 469
479 3300025912 Ga0207707_10001762 Ga0207707_1000176211 469
480 3300025913 Ga0207695_10162560 Ga0207695_101625602 469
481 3300025917 Ga0207660_10000007 Ga0207660_1000000733 469
482 3300025918 Ga0207662_10000913 Ga0207662_100009133 469
483 3300025918 Ga0207662_10041211 Ga0207662_100412112 469
484 3300025919 Ga0207657_10005343 Ga0207657_1000534310 469
485 3300025920 Ga0207649_10000143 Ga0207649_100001432 469
486 3300025920 Ga0207649_10081042 Ga0207649_100810422 469
487 3300025921 Ga0207652_10000459 Ga0207652_1000045932 469
488 3300025921 Ga0207652_10143839 Ga0207652_101438392 469
489 3300025923 Ga0207681_10000506 Ga0207681_100005062 469
490 3300025926 Ga0207659_10000015 Ga0207659_10000015134 469
491 3300025927 Ga0207687_10000357 Ga0207687_1000035711 469
492 3300025931 Ga0207644_10000251 Ga0207644_1000025134 469
493 3300025933 Ga0207706_10002583 Ga0207706_1000258310 469
494 3300025934 Ga0207686_10000234 Ga0207686_1000023415 469
495 3300025935 Ga0207709_10000081 Ga0207709_10000081121 469
496 3300025936 Ga0207670_10000620 Ga0207670_100006208 469
497 3300025936 Ga0207670_10018819 Ga0207670_100188194 469
498 3300025937 Ga0207669_10000008 Ga0207669_1000000828 469
499 3300025938 Ga0207704_10002142 Ga0207704_100021425 469
500 3300025940 Ga0207691_10002588 Ga0207691_100025888 469
501 3300025941 Ga0207711_10001662 Ga0207711_1000166216 469
502 3300025942 Ga0207689_10000749 Ga0207689_1000074916 469
503 3300025944 Ga0207661_10000170 Ga0207661_1000017036 469
504 3300025945 Ga0207679_10000046 Ga0207679_1000004680 469
505 3300025949 Ga0207667_10010820 Ga0207667_100108205 469
506 3300025960 Ga0207651_10000200 Ga0207651_1000020018 469
507 3300025961 Ga0207712_10000555 Ga0207712_100005553 469
508 3300025961 Ga0207712_10011089 Ga0207712_100110893 469
509 3300025972 Ga0207668_10000133 Ga0207668_1000013333 469
510 3300025981 Ga0207640_10000191 Ga0207640_1000019137 469
511 3300025986 Ga0207658_10000535 Ga0207658_1000053524 469
512 3300025986 Ga0207658_10131348 Ga0207658_101313482 469
513 3300026023 Ga0207677_10001779 Ga0207677_100017792 469
514 3300026035 Ga0207703_10003074 Ga0207703_100030749 469
515 3300026041 Ga0207639_10001004 Ga0207639_100010042 469
516 3300026067 Ga0207678_10001859 Ga0207678_100018598 469
517 3300026067 Ga0207678_10042909 Ga0207678_100429093 469
518 3300026075 Ga0207708_10002476 Ga0207708_1000247610 469
519 3300026075 Ga0207708_10002480 Ga0207708_1000248010 469
520 3300026078 Ga0207702_10003065 Ga0207702_1000306510 469
521 3300026088 Ga0207641_10000593 Ga0207641_1000059317 469
522 3300026089 Ga0207648_10002417 Ga0207648_100024179 469
523 3300026095 Ga0207676_10002520 Ga0207676_1000252010 469
524 3300026116 Ga0207674_10003381 Ga0207674_100033819 469
525 3300026118 Ga0207675_100002182 Ga0207675_10000218210 469
526 3300026118 Ga0207675_100050415 Ga0207675_1000504153 469
527 3300026121 Ga0207683_10000002 Ga0207683_10000002256 469
528 3300026142 Ga0207698_10000545 Ga0207698_1000054514 469
529 3300027617 Ga0210002_1003424 Ga0210002_10034242 469
530 3300027717 Ga0209998_10001951 Ga0209998_100019512 469
531 3300027876 Ga0209974_10000944 Ga0209974_100009448 469
532 3300027907 Ga0207428_10000011 Ga0207428_1000001146 469
533 3300027907 Ga0207428_10000046 Ga0207428_10000046135 469
534 3300027907 Ga0207428_10001276 Ga0207428_1000127613 469
535 3300028380 Ga0268265_10011194 Ga0268265_100111942 469
536 3300028381 Ga0268264_10000340 Ga0268264_100003404 469
537 3300034817 Ga0373948_0000050 Ga0373948_0000050_9496_10905 469
538 3300034818 Ga0373950_0000879 Ga0373950_0000879_1538_2947 469
539 3300034819 Ga0373958_0000097 Ga0373958_0000097_7158_8567 469
540 3300034819 Ga0373958_0001146 Ga0373958_0001146_713_2122 469
541 3300034820 Ga0373959_0000255 Ga0373959_0000255_1836_3245 469
542 3300034957 Ga0373938_0000032 Ga0373938_0000032_8069_9478 469
543 3300034957 Ga0373938_0002417 Ga0373938_0002417_1367_2776 469
544 3300035084 Ga0373928_0000973 Ga0373928_0000973_2692_4101 469
545 3300035085 Ga0373929_0001646 Ga0373929_0001646_2553_3962 469
546 3300035088 Ga0373940_0000828 Ga0373940_0000828_464_1873 469
547 3300035090 Ga0373949_0001084 Ga0373949_0001084_5281_6690 469
548 3300035091 Ga0373951_0000472 Ga0373951_0000472_2937_4346 469
549 3300035092 Ga0373952_0000189 Ga0373952_0000189_5892_7301 469
550 3300035092 Ga0373952_0003514 Ga0373952_0003514_1089_2498 469
551 3300035111 Ga0373923_0028891 Ga0373923_0028891_259_1668 469
552 3300035112 Ga0373932_0000180 Ga0373932_0000180_7944_9353 469
553 3300035112 Ga0373932_0003067 Ga0373932_0003067_1612_3021 469
554 3300035114 Ga0373939_0000151 Ga0373939_0000151_9855_11264 469
555 3300035115 Ga0373941_0001114 Ga0373941_0001114_3070_4479 469
556 3300035116 Ga0373945_0032196 Ga0373945_0032196_276_1685 469
557 3300035118 Ga0373954_0015167 Ga0373954_0015167_908_2317 469
558 3300035121 Ga0373960_0000156 Ga0373960_0000156_456_1865 469
559 3300035121 Ga0373960_0000184 Ga0373960_0000184_3128_4537 469
560 3300035172 Ga0373955_0008032 Ga0373955_0008032_3268_4677 469
561 3300035207 Ga0373942_0000457 Ga0373942_0000457_1554_2963 469
562 3300035241 Ga0373961_0002408 Ga0373961_0002408_267_1676 469
563 3300035242 Ga0373962_0000113 Ga0373962_0000113_8268_9677 469
564 3300035242 Ga0373962_0000251 Ga0373962_0000251_2345_3754 469
565 3300035410 Ga0373924_0003763 Ga0373924_0003763_1173_2582 469
566 3300035691 Ga0373931_0000290 Ga0373931_0000290_9743_11152 469
567 3300036401 Ga0373937_0037814 Ga0373937_0037814_1492_2901 469
568 3300044712 Ga0453684_0113196 Ga0453684_0113196_1624_3033 469
569 3300045051 Ga0451576_0027624 Ga0451576_0027624_2951_4360 469
570 3300046455 Ga0495603_0037648 Ga0495603_0037648_1465_2874 469
571 3300046462 Ga0495651_0001053 Ga0495651_0001053_15464_16873 469
572 3300046463 Ga0495653_0006680 Ga0495653_0006680_7417_8826 469
573 3300046511 Ga0495608_0008586 Ga0495608_0008586_3729_5138 469
574 3300046516 Ga0495628_0020292 Ga0495628_0020292_3340_4749 469
575 3300046536 Ga0495587_0004533 Ga0495587_0004533_5795_7204 469
576 3300046543 Ga0495645_0024148 Ga0495645_0024148_2019_3428 469
577 3300046559 Ga0495667_0015229 Ga0495667_0015229_2733_4142 469
578 3300046642 Ga0495634_0115184 Ga0495634_0115184_30_1439 469
579 3300046663 Ga0495635_0008349 Ga0495635_0008349_5290_6699 469
580 3300046663 Ga0495635_0143797 Ga0495635_0143797_174_1583 469
581 3300046675 Ga0495657_0005789 Ga0495657_0005789_49_1458 469
582 3300046678 Ga0495599_0013640 Ga0495599_0013640_934_2343 469
583 3300046679 Ga0495623_0003197 Ga0495623_0003197_7695_9104 469
584 3300046809 Ga0495600_0010128 Ga0495600_0010128_2746_4155 469
585 3300047319 Ga0495674_0153002 Ga0495674_0153002_102_1511 469
586 3300047322 Ga0495680_0014111 Ga0495680_0014111_1109_2518 469
587 3300047322 Ga0495680_0103326 Ga0495680_0103326_473_1882 469
588 3300047444 Ga0495675_0005926 Ga0495675_0005926_5991_7400 469
589 3300048088 Ga0495602_0037977 Ga0495602_0037977_2395_3804 469
590 3300048903 Ga0496100_0000171 Ga0496100_0000171_25594_27003 469
591 3300048904 Ga0496101_0000246 Ga0496101_0000246_11426_12835 469
592 3300048906 Ga0496103_0000753 Ga0496103_0000753_18346_19755 469
593 3300048906 Ga0496103_0024347 Ga0496103_0024347_1061_2470 469
594 3300048908 Ga0496105_0036145 Ga0496105_0036145_2332_3741 469
595 3300048909 Ga0496106_0000183 Ga0496106_0000183_20822_22231 469
596 3300048909 Ga0496106_0026194 Ga0496106_0026194_2756_4165 469
597 3300048910 Ga0496107_0001430 Ga0496107_0001430_4253_5662 469
598 3300048910 Ga0496107_0024819 Ga0496107_0024819_2025_3434 469
599 3300048911 Ga0496108_0001856 Ga0496108_0001856_15319_16728 469
600 3300048912 Ga0496109_0004054 Ga0496109_0004054_975_2384 469
601 3300048912 Ga0496109_0186624 Ga0496109_0186624_121_1530 469
602 3300048913 Ga0496110_0007624 Ga0496110_0007624_4069_5478 469
603 3300048913 Ga0496110_0085718 Ga0496110_0085718_1117_2526 469
604 3300048914 Ga0496111_0036865 Ga0496111_0036865_985_2394 469
605 3300048915 Ga0496112_0247025 Ga0496112_0247025_286_1695 469
606 3300048916 Ga0496113_0017451 Ga0496113_0017451_2472_3881 469
607 3300048917 Ga0496114_0002224 Ga0496114_0002224_4487_5896 469
608 3300048918 Ga0496115_0020141 Ga0496115_0020141_2623_4032 469
609 3300048918 Ga0496115_0143410 Ga0496115_0143410_531_1940 469
610 3300048918 Ga0496115_0168462 Ga0496115_0168462_372_1781 469
611 3300049593 Ga0501077_0065796 Ga0501077_0065796_720_2129 469
612 3300049741 Ga0501079_0098241 Ga0501079_0098241_117_1526 469
613 3300049744 Ga0501083_0113885 Ga0501083_0113885_125_1534 469
614 3300050511 nmdc:mga08y16_9096_c1 nmdc:mga08y16_9096_c1_6222_7631 469
615 3300050512 nmdc:mga0n895_971_c1 nmdc:mga0n895_971_c1_16627_18036 469
616 3300050515 nmdc:mga0a205_1026_c1 nmdc:mga0a205_1026_c1_2656_4065 469
617 3300053077 Ga0495601_0005819 Ga0495601_0005819_5051_6460 469
618 3300053078 Ga0495612_0015054 Ga0495612_0015054_1624_3033 469
619 3300053078 Ga0495612_0029945 Ga0495612_0029945_558_1967 469
620 3300053084 Ga0495595_0001470 Ga0495595_0001470_4074_5483 469
621 3300053085 Ga0495619_0000151 Ga0495619_0000151_38515_39924 469
622 3300053085 Ga0495619_0022205 Ga0495619_0022205_1626_3035 469
623 3300054114 Ga0501084_0099209 Ga0501084_0099209_883_2292 469

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

21

89

0.87

PF08245

Mur_ligase_M

Mur ligase middle domain

134

315

0.85

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

337

451

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9755 9 42
5v96-assembly1.cif.gz_A crystal structure of s-adenosyl-l-homocysteine hydrolase from naegleria fowleri with bound nad and adenosine 0.9122 8 72
5tj9-assembly1.cif.gz_A 2.6 angstrom crystal structure of s-adenosylhomocysteinase from cryptosporidium parvum in complex with aristeromycin and nad 0.8858 7 76
2bra-assembly1.cif.gz_A structure of n-terminal fad binding motif of mouse mical 0.8774 5 39
5a5e-assembly1.cif.gz_A crystal structure of murd ligase from escherichia coli 0.8589 9 455
ID Description Score Start End Superfamily
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9324 10 37 3.50.50.60
3lk7A03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9109 325 458 3.90.190.20
2jaeB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9049 10 42 3.50.50.60
3lk7A02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9025 113 317 3.40.1190.10
af_Q2FZ92_312_442_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9013 325 455 3.90.190.20
ID Description Score Start End GO Terms
AF-A0A529HNV6-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9887 1 172 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009058
GO:0051301
AF-A0A659UZ91-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9883 1 215 GO:0004326
GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0051301
AF-A0A3S2JPD5-F1-model_v4 UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9) 0.9878 56 469 GO:0004326
GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009252
GO:0051301
GO:0071555
AF-A0A2W4KNT3-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9873 1 115 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0051301
AF-A0A3D2PIQ5-F1-model_v4 deleted 0.9869 1 107

Feature Viewer

pLDDT pTM Quality
92.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map