F470179
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 623 | 368 | 611 | 465 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10081548|Ga0075433_100815481 |
| Length | 480 |
| Sequence | MRGLRFARRGRQNHFMIPITTFAGKKVAVFGLGSSGLLAARALKEGGADVVVFDDDGKKTAEAQAAGLQAHDLHDIEWRKISSLVLTPGVPLTHPTPHWTVALARNANVEVIGDIELFCRERAKSGRECPLIAITGTNGKSTTTALTAHLLKSAGRDAQMGGNIGVPVLALEPFRPGRAYVLEASSYQIDLAPSLKPTVGVLLNVSEDHIDRHGSIENYSAIKERVPANVEQGGAAVIDVDDVYTRAAAERIEHAGKNVVRVSVESSLTDGYFSEGSHILRAARGKTHPVAELAGLGSLRGVHNAQNAACAVAACVALGIDLPAIQKGLRSFPGLAHRMQQVGHKGNVLFVNDSKATNADSASKALASFYDIFWIAGGKPKTGGINSLAEFFPRIRKAYLIGEATKEFAQTLDGKVAYEIDGVLSAAISAATRDAEASGLKEPVVLLSPACASFDQYPNFEVRGKAFIDAVMAISGVTEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 5 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 6 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 7 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 8 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 9 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 10 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 11 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 210 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 361 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 362 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 367 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 368 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.23 |
| Metatranscriptomes | 0 |
| Isolates | 1.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.93 |
| Nodule | 1.28 |
| Rhizoplane | 6.42 |
| Rhizosphere | 88.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214797992 | 2209111006 | Bacteria | 2098 |
| 2 | ARSoilOldRDRAFT_c000230 | 3300000044 | Bacteria | 8490 |
| 3 | ARCol0yngRDRAFT_1000425 | 3300000652 | Bacteria | 5410 |
| 4 | JGI24739J22299_10037514 | 3300001989 | Bacteria | 1632 |
| 5 | JGI24737J22298_10002225 | 3300001990 | Bacteria | 6917 |
| 6 | JGI24745J21846_1000036 | 3300002073 | Bacteria | 9023 |
| 7 | JGI24738J21930_10002861 | 3300002075 | Bacteria | 4423 |
| 8 | JGI24749J21850_1005252 | 3300002076 | Bacteria | 1817 |
| 9 | JGI24744J21845_10001136 | 3300002077 | Bacteria | 5178 |
| 10 | JGI24742J22300_10000210 | 3300002244 | Bacteria | 8662 |
| 11 | JGI24751J29686_10012561 | 3300002459 | Bacteria | 1746 |
| 12 | Ga0065712_10001033 | 3300005290 | Bacteria | 10330 |
| 13 | Ga0065715_10000973 | 3300005293 | Bacteria | 7498 |
| 14 | Ga0065715_10095332 | 3300005293 | Bacteria | 4107 |
| 15 | Ga0070658_10153847 | 3300005327 | Bacteria | 1927 |
| 16 | Ga0070676_10000499 | 3300005328 | Bacteria | 18707 |
| 17 | Ga0070683_100000265 | 3300005329 | Bacteria | 36059 |
| 18 | Ga0070690_100000718 | 3300005330 | Bacteria | 16997 |
| 19 | Ga0070690_100064430 | 3300005330 | Bacteria | 2367 |
| 20 | Ga0070670_100082630 | 3300005331 | Bacteria | 2760 |
| 21 | Ga0070677_10001854 | 3300005333 | Bacteria | 6684 |
| 22 | Ga0068869_100000414 | 3300005334 | Bacteria | 23258 |
| 23 | Ga0070666_10020782 | 3300005335 | Bacteria | 4247 |
| 24 | Ga0070666_10020803 | 3300005335 | Bacteria | 4245 |
| 25 | Ga0070680_100001359 | 3300005336 | Bacteria | 17686 |
| 26 | Ga0070680_100201724 | 3300005336 | Bacteria | 1678 |
| 27 | Ga0070682_100000745 | 3300005337 | Bacteria | 19431 |
| 28 | Ga0068868_100008743 | 3300005338 | Bacteria | 7253 |
| 29 | Ga0070660_100000136 | 3300005339 | Bacteria | 46892 |
| 30 | Ga0070689_100000722 | 3300005340 | Bacteria | 20157 |
| 31 | Ga0070691_10000148 | 3300005341 | Bacteria | 22373 |
| 32 | Ga0070687_100000080 | 3300005343 | Bacteria | 31259 |
| 33 | Ga0070687_100034617 | 3300005343 | Bacteria | 2501 |
| 34 | Ga0070661_100000425 | 3300005344 | Bacteria | 32302 |
| 35 | Ga0070692_10000893 | 3300005345 | Bacteria | 10102 |
| 36 | Ga0070668_100005857 | 3300005347 | Bacteria | 9111 |
| 37 | Ga0070669_100000276 | 3300005353 | Bacteria | 41366 |
| 38 | Ga0070669_100002660 | 3300005353 | Bacteria | 12871 |
| 39 | Ga0070675_100000271 | 3300005354 | Bacteria | 34156 |
| 40 | Ga0070675_100008544 | 3300005354 | Bacteria | 7949 |
| 41 | Ga0070671_100000389 | 3300005355 | Bacteria | 30190 |
| 42 | Ga0070671_100012096 | 3300005355 | Bacteria | 6944 |
| 43 | Ga0070674_100000928 | 3300005356 | Bacteria | 15290 |
| 44 | Ga0070673_100001722 | 3300005364 | Bacteria | 13004 |
| 45 | Ga0070688_100001089 | 3300005365 | Bacteria | 13567 |
| 46 | Ga0070659_100008795 | 3300005366 | Bacteria | 7396 |
| 47 | Ga0070659_100190426 | 3300005366 | Bacteria | 1686 |
| 48 | Ga0070667_100001569 | 3300005367 | Bacteria | 20471 |
| 49 | Ga0070667_100055063 | 3300005367 | Bacteria | 3359 |
| 50 | Ga0070703_10004879 | 3300005406 | Bacteria | 3747 |
| 51 | Ga0070709_10104430 | 3300005434 | Bacteria | 1893 |
| 52 | Ga0070710_10002708 | 3300005437 | Bacteria | 8421 |
| 53 | Ga0070701_10000457 | 3300005438 | Bacteria | 13932 |
| 54 | Ga0070705_100000579 | 3300005440 | Bacteria | 21266 |
| 55 | Ga0070700_100000515 | 3300005441 | Bacteria | 19292 |
| 56 | Ga0070700_100030715 | 3300005441 | Bacteria | 3214 |
| 57 | Ga0070694_100001641 | 3300005444 | Bacteria | 13154 |
| 58 | Ga0070708_100027296 | 3300005445 | Bacteria | 4897 |
| 59 | Ga0070708_100148472 | 3300005445 | Bacteria | 2179 |
| 60 | Ga0070663_100000580 | 3300005455 | Bacteria | 19553 |
| 61 | Ga0070678_100000016 | 3300005456 | Bacteria | 53269 |
| 62 | Ga0070678_100008371 | 3300005456 | Bacteria | 6195 |
| 63 | Ga0070662_100001325 | 3300005457 | Bacteria | 15215 |
| 64 | Ga0070681_10001764 | 3300005458 | Bacteria | 19392 |
| 65 | Ga0068867_100002288 | 3300005459 | Bacteria | 13466 |
| 66 | Ga0070685_10000344 | 3300005466 | Bacteria | 28550 |
| 67 | Ga0070685_10059463 | 3300005466 | Bacteria | 2231 |
| 68 | Ga0070679_100001267 | 3300005530 | Bacteria | 22298 |
| 69 | Ga0070684_100002476 | 3300005535 | Bacteria | 13600 |
| 70 | Ga0070684_100033334 | 3300005535 | Bacteria | 4396 |
| 71 | Ga0068853_100001111 | 3300005539 | Bacteria | 19042 |
| 72 | Ga0068853_100021373 | 3300005539 | Bacteria | 5395 |
| 73 | Ga0070672_100000233 | 3300005543 | Bacteria | 31143 |
| 74 | Ga0070672_100018746 | 3300005543 | Bacteria | 5011 |
| 75 | Ga0070686_100000699 | 3300005544 | Bacteria | 19478 |
| 76 | Ga0070686_100129693 | 3300005544 | Bacteria | 1742 |
| 77 | Ga0070695_100001478 | 3300005545 | Bacteria | 13043 |
| 78 | Ga0070696_100001198 | 3300005546 | Bacteria | 16816 |
| 79 | Ga0070693_100000594 | 3300005547 | Bacteria | 16031 |
| 80 | Ga0070665_100176101 | 3300005548 | Bacteria | 2140 |
| 81 | Ga0070704_100000112 | 3300005549 | Bacteria | 28583 |
| 82 | Ga0070704_100001736 | 3300005549 | Bacteria | 11901 |
| 83 | Ga0068855_100007243 | 3300005563 | Bacteria | 13453 |
| 84 | Ga0070664_100071641 | 3300005564 | Bacteria | 2970 |
| 85 | Ga0070664_100191044 | 3300005564 | Bacteria | 1824 |
| 86 | Ga0068857_100000371 | 3300005577 | Bacteria | 31431 |
| 87 | Ga0068854_100000735 | 3300005578 | Bacteria | 19431 |
| 88 | Ga0068856_100000520 | 3300005614 | Bacteria | 42483 |
| 89 | Ga0068856_100164064 | 3300005614 | Bacteria | 2233 |
| 90 | Ga0068856_100235815 | 3300005614 | Bacteria | 1845 |
| 91 | Ga0070702_100000122 | 3300005615 | Bacteria | 23858 |
| 92 | Ga0068859_100019554 | 3300005617 | Bacteria | 6804 |
| 93 | Ga0068864_100000333 | 3300005618 | Bacteria | 41669 |
| 94 | Ga0068864_100207791 | 3300005618 | Bacteria | 1801 |
| 95 | Ga0068861_100000417 | 3300005719 | Bacteria | 24695 |
| 96 | Ga0068870_10000113 | 3300005840 | Bacteria | 27642 |
| 97 | Ga0068863_100004693 | 3300005841 | Bacteria | 13466 |
| 98 | Ga0068858_100000975 | 3300005842 | Bacteria | 29622 |
| 99 | Ga0068860_100001740 | 3300005843 | Bacteria | 23200 |
| 100 | Ga0081455_10000110 | 3300005937 | Bacteria | 92459 |
| 101 | Ga0081455_10007679 | 3300005937 | Bacteria | 11320 |
| 102 | Ga0081540_1003272 | 3300005983 | Bacteria | 12881 |
| 103 | Ga0081540_1036865 | 3300005983 | Bacteria | 2601 |
| 104 | Ga0070717_10002936 | 3300006028 | Bacteria | 12106 |
| 105 | Ga0070717_10092207 | 3300006028 | Bacteria | 2559 |
| 106 | Ga0075432_10040263 | 3300006058 | Bacteria | 1631 |
| 107 | Ga0070712_100008568 | 3300006175 | Bacteria | 6435 |
| 108 | Ga0070712_100048251 | 3300006175 | Bacteria | 2951 |
| 109 | Ga0075427_10002058 | 3300006194 | Bacteria | 2661 |
| 110 | Ga0097621_100000203 | 3300006237 | Bacteria | 38745 |
| 111 | Ga0097621_100049459 | 3300006237 | Bacteria | 3415 |
| 112 | Ga0075370_10018625 | 3300006353 | Bacteria | 3768 |
| 113 | Ga0068871_100000575 | 3300006358 | Bacteria | 25171 |
| 114 | Ga0068871_100192678 | 3300006358 | Bacteria | 1756 |
| 115 | Ga0075428_100008481 | 3300006844 | Bacteria | 11403 |
| 116 | Ga0075430_100000012 | 3300006846 | Bacteria | 94359 |
| 117 | Ga0075431_100003622 | 3300006847 | Bacteria | 14964 |
| 118 | Ga0075433_10014382 | 3300006852 | Bacteria | 6464 |
| 119 | Ga0075433_10081548 | 3300006852 | Bacteria | 2852 |
| 120 | Ga0075434_100000114 | 3300006871 | Bacteria | 46406 |
| 121 | Ga0075434_100020042 | 3300006871 | Bacteria | 6479 |
| 122 | Ga0075434_100030889 | 3300006871 | Bacteria | 5279 |
| 123 | Ga0075434_100052011 | 3300006871 | Bacteria | 4070 |
| 124 | Ga0075429_100002694 | 3300006880 | Bacteria | 14964 |
| 125 | Ga0068865_100000654 | 3300006881 | Bacteria | 19602 |
| 126 | Ga0097620_100019554 | 3300006931 | Bacteria | 6804 |
| 127 | Ga0075435_100019420 | 3300007076 | Bacteria | 5191 |
| 128 | Ga0075435_100023780 | 3300007076 | Bacteria | 4746 |
| 129 | Ga0105240_10246481 | 3300009093 | Bacteria | 2069 |
| 130 | Ga0111539_10000581 | 3300009094 | Bacteria | 47068 |
| 131 | Ga0111539_10002232 | 3300009094 | Bacteria | 25871 |
| 132 | Ga0111539_10004022 | 3300009094 | Bacteria | 19301 |
| 133 | Ga0105245_10000230 | 3300009098 | Bacteria | 53225 |
| 134 | Ga0105245_10022871 | 3300009098 | Bacteria | 5484 |
| 135 | Ga0105247_10009917 | 3300009101 | Bacteria | 5769 |
| 136 | Ga0114129_10008877 | 3300009147 | Bacteria | 14335 |
| 137 | Ga0114129_10010926 | 3300009147 | Bacteria | 12938 |
| 138 | Ga0105243_10002755 | 3300009148 | Bacteria | 14611 |
| 139 | Ga0105243_10021104 | 3300009148 | Bacteria | 4943 |
| 140 | Ga0105243_10043053 | 3300009148 | Bacteria | 3538 |
| 141 | Ga0105241_10001308 | 3300009174 | Bacteria | 18957 |
| 142 | Ga0105242_10000696 | 3300009176 | Bacteria | 26370 |
| 143 | Ga0105242_10012804 | 3300009176 | Bacteria | 6461 |
| 144 | Ga0105248_10001593 | 3300009177 | Bacteria | 25250 |
| 145 | Ga0105248_10009030 | 3300009177 | Bacteria | 10965 |
| 146 | Ga0105248_10098683 | 3300009177 | Bacteria | 3291 |
| 147 | Ga0105237_10113575 | 3300009545 | Bacteria | 2701 |
| 148 | Ga0105238_10030898 | 3300009551 | Bacteria | 5451 |
| 149 | Ga0105249_10001642 | 3300009553 | Bacteria | 19605 |
| 150 | Ga0105249_10102158 | 3300009553 | Bacteria | 2698 |
| 151 | Ga0105249_10118547 | 3300009553 | Bacteria | 2512 |
| 152 | Ga0105239_10009048 | 3300010375 | Bacteria | 11275 |
| 153 | Ga0105246_10000550 | 3300011119 | Bacteria | 20662 |
| 154 | Ga0105246_10122940 | 3300011119 | Bacteria | 1926 |
| 155 | Ga0157373_10011542 | 3300013100 | Bacteria | 6492 |
| 156 | Ga0157371_10029473 | 3300013102 | Bacteria | 3968 |
| 157 | Ga0157370_10062178 | 3300013104 | Bacteria | 3542 |
| 158 | Ga0157374_10002125 | 3300013296 | Bacteria | 16679 |
| 159 | Ga0157378_10000864 | 3300013297 | Bacteria | 28028 |
| 160 | Ga0157378_10181280 | 3300013297 | Bacteria | 1981 |
| 161 | Ga0163162_10000420 | 3300013306 | Bacteria | 39042 |
| 162 | Ga0163162_10016129 | 3300013306 | Bacteria | 7303 |
| 163 | Ga0157372_10003944 | 3300013307 | Bacteria | 15940 |
| 164 | Ga0157372_10005907 | 3300013307 | Bacteria | 13032 |
| 165 | Ga0157375_10001626 | 3300013308 | Bacteria | 19334 |
| 166 | Ga0157375_10061566 | 3300013308 | Bacteria | 3727 |
| 167 | Ga0157375_10235618 | 3300013308 | Bacteria | 1989 |
| 168 | Ga0163163_10003284 | 3300014325 | Bacteria | 13715 |
| 169 | Ga0163163_10081470 | 3300014325 | Bacteria | 3238 |
| 170 | Ga0157380_10000511 | 3300014326 | Bacteria | 23725 |
| 171 | Ga0157377_10000053 | 3300014745 | Bacteria | 89091 |
| 172 | Ga0157379_10001333 | 3300014968 | Bacteria | 20150 |
| 173 | Ga0157379_10024669 | 3300014968 | Bacteria | 5337 |
| 174 | Ga0157379_10075180 | 3300014968 | Bacteria | 3024 |
| 175 | Ga0157376_10000436 | 3300014969 | Bacteria | 26857 |
| 176 | Ga0163161_10000555 | 3300017792 | Bacteria | 30093 |
| 177 | Ga0207666_1000014 | 3300025271 | Bacteria | 41355 |
| 178 | Ga0209758_1010107 | 3300025297 | Bacteria | 5715 |
| 179 | Ga0207697_10000672 | 3300025315 | Bacteria | 19436 |
| 180 | Ga0207653_10007649 | 3300025885 | Bacteria | 3371 |
| 181 | Ga0207682_10000154 | 3300025893 | Bacteria | 31265 |
| 182 | Ga0207710_10001145 | 3300025900 | Bacteria | 13506 |
| 183 | Ga0207710_10033844 | 3300025900 | Bacteria | 2243 |
| 184 | Ga0207688_10001479 | 3300025901 | Bacteria | 12310 |
| 185 | Ga0207680_10022307 | 3300025903 | Bacteria | 3440 |
| 186 | Ga0207685_10011949 | 3300025905 | Bacteria | 2633 |
| 187 | Ga0207645_10000182 | 3300025907 | Bacteria | 50129 |
| 188 | Ga0207643_10000405 | 3300025908 | Bacteria | 28698 |
| 189 | Ga0207705_10100274 | 3300025909 | Bacteria | 2130 |
| 190 | Ga0207654_10008238 | 3300025911 | Bacteria | 5261 |
| 191 | Ga0207707_10001762 | 3300025912 | Bacteria | 19871 |
| 192 | Ga0207695_10162560 | 3300025913 | Bacteria | 2163 |
| 193 | Ga0207693_10007487 | 3300025915 | Bacteria | 8977 |
| 194 | Ga0207660_10000007 | 3300025917 | Bacteria | 102878 |
| 195 | Ga0207662_10000913 | 3300025918 | Bacteria | 13677 |
| 196 | Ga0207662_10027211 | 3300025918 | Bacteria | 3301 |
| 197 | Ga0207662_10041211 | 3300025918 | Bacteria | 2718 |
| 198 | Ga0207657_10005343 | 3300025919 | Bacteria | 13456 |
| 199 | Ga0207649_10000143 | 3300025920 | Bacteria | 59962 |
| 200 | Ga0207649_10081042 | 3300025920 | Bacteria | 2101 |
| 201 | Ga0207652_10000459 | 3300025921 | Bacteria | 42058 |
| 202 | Ga0207652_10143839 | 3300025921 | Bacteria | 2133 |
| 203 | Ga0207681_10000506 | 3300025923 | Bacteria | 27118 |
| 204 | Ga0207650_10009331 | 3300025925 | Bacteria | 6705 |
| 205 | Ga0207659_10000015 | 3300025926 | Bacteria | 168475 |
| 206 | Ga0207687_10000357 | 3300025927 | Bacteria | 30477 |
| 207 | Ga0207687_10018417 | 3300025927 | Bacteria | 4609 |
| 208 | Ga0207687_10025228 | 3300025927 | Bacteria | 3977 |
| 209 | Ga0207700_10001137 | 3300025928 | Bacteria | 15268 |
| 210 | Ga0207700_10133441 | 3300025928 | Bacteria | 2031 |
| 211 | Ga0207664_10027404 | 3300025929 | Bacteria | 4319 |
| 212 | Ga0207664_10086611 | 3300025929 | Bacteria | 2559 |
| 213 | Ga0207644_10000251 | 3300025931 | Bacteria | 36497 |
| 214 | Ga0207644_10005542 | 3300025931 | Bacteria | 8213 |
| 215 | Ga0207706_10002583 | 3300025933 | Bacteria | 17644 |
| 216 | Ga0207706_10021896 | 3300025933 | Bacteria | 5737 |
| 217 | Ga0207686_10000234 | 3300025934 | Bacteria | 42207 |
| 218 | Ga0207686_10012409 | 3300025934 | Bacteria | 4687 |
| 219 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 220 | Ga0207709_10018748 | 3300025935 | Bacteria | 3880 |
| 221 | Ga0207670_10000620 | 3300025936 | Bacteria | 19095 |
| 222 | Ga0207670_10018819 | 3300025936 | Bacteria | 4207 |
| 223 | Ga0207669_10000008 | 3300025937 | Bacteria | 168213 |
| 224 | Ga0207704_10002142 | 3300025938 | Bacteria | 8851 |
| 225 | Ga0207665_10001484 | 3300025939 | Bacteria | 15767 |
| 226 | Ga0207691_10002588 | 3300025940 | Bacteria | 17682 |
| 227 | Ga0207691_10106091 | 3300025940 | Bacteria | 2502 |
| 228 | Ga0207711_10001662 | 3300025941 | Bacteria | 20503 |
| 229 | Ga0207711_10043909 | 3300025941 | Bacteria | 3814 |
| 230 | Ga0207711_10129229 | 3300025941 | Bacteria | 2263 |
| 231 | Ga0207689_10000749 | 3300025942 | Bacteria | 31134 |
| 232 | Ga0207661_10000170 | 3300025944 | Bacteria | 41868 |
| 233 | Ga0207661_10216292 | 3300025944 | Bacteria | 1691 |
| 234 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 235 | Ga0207667_10010820 | 3300025949 | Bacteria | 10639 |
| 236 | Ga0207651_10000200 | 3300025960 | Bacteria | 26185 |
| 237 | Ga0207712_10000555 | 3300025961 | Bacteria | 30178 |
| 238 | Ga0207712_10011089 | 3300025961 | Bacteria | 5739 |
| 239 | Ga0207668_10000133 | 3300025972 | Bacteria | 52202 |
| 240 | Ga0207640_10000191 | 3300025981 | Bacteria | 43590 |
| 241 | Ga0207658_10000535 | 3300025986 | Bacteria | 34617 |
| 242 | Ga0207658_10131348 | 3300025986 | Bacteria | 2012 |
| 243 | Ga0207658_10238082 | 3300025986 | Bacteria | 1540 |
| 244 | Ga0207677_10001779 | 3300026023 | Bacteria | 11377 |
| 245 | Ga0207703_10003074 | 3300026035 | Bacteria | 14117 |
| 246 | Ga0207703_10012070 | 3300026035 | Bacteria | 6731 |
| 247 | Ga0207639_10001004 | 3300026041 | Bacteria | 19189 |
| 248 | Ga0207678_10001859 | 3300026067 | Bacteria | 19293 |
| 249 | Ga0207678_10016738 | 3300026067 | Bacteria | 6439 |
| 250 | Ga0207678_10042909 | 3300026067 | Bacteria | 3915 |
| 251 | Ga0207708_10002476 | 3300026075 | Bacteria | 13580 |
| 252 | Ga0207708_10002480 | 3300026075 | Bacteria | 13573 |
| 253 | Ga0207702_10003065 | 3300026078 | Bacteria | 15534 |
| 254 | Ga0207702_10142938 | 3300026078 | Bacteria | 2168 |
| 255 | Ga0207641_10000593 | 3300026088 | Bacteria | 39825 |
| 256 | Ga0207648_10002417 | 3300026089 | Bacteria | 20105 |
| 257 | Ga0207676_10002520 | 3300026095 | Bacteria | 13061 |
| 258 | Ga0207676_10259756 | 3300026095 | Bacteria | 1567 |
| 259 | Ga0207674_10003381 | 3300026116 | Bacteria | 19581 |
| 260 | Ga0207674_10058980 | 3300026116 | Bacteria | 3886 |
| 261 | Ga0207675_100002182 | 3300026118 | Bacteria | 19438 |
| 262 | Ga0207675_100050415 | 3300026118 | Bacteria | 3884 |
| 263 | Ga0207675_100095986 | 3300026118 | Bacteria | 2790 |
| 264 | Ga0207683_10000002 | 3300026121 | Bacteria | 258441 |
| 265 | Ga0207683_10006919 | 3300026121 | Bacteria | 9710 |
| 266 | Ga0207683_10026216 | 3300026121 | Bacteria | 5031 |
| 267 | Ga0207698_10000545 | 3300026142 | Bacteria | 21874 |
| 268 | Ga0210002_1003424 | 3300027617 | Bacteria | 2335 |
| 269 | Ga0209998_10001951 | 3300027717 | Bacteria | 4843 |
| 270 | Ga0209974_10000944 | 3300027876 | Bacteria | 10160 |
| 271 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 272 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 273 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 274 | Ga0207428_10001276 | 3300027907 | Bacteria | 26949 |
| 275 | Ga0268266_10030112 | 3300028379 | Bacteria | 4611 |
| 276 | Ga0268265_10011194 | 3300028380 | Bacteria | 6062 |
| 277 | Ga0268264_10000340 | 3300028381 | Bacteria | 71850 |
| 278 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 279 | Ga0265325_10005052 | 3300031241 | Bacteria | 8209 |
| 280 | Ga0265325_10008083 | 3300031241 | Bacteria | 6236 |
| 281 | Ga0265325_10024983 | 3300031241 | Bacteria | 3245 |
| 282 | Ga0265339_10000450 | 3300031249 | Bacteria | 32195 |
| 283 | Ga0265316_10077382 | 3300031344 | Bacteria | 2555 |
| 284 | Ga0307513_10194768 | 3300031456 | Bacteria | 1874 |
| 285 | Ga0265313_10000340 | 3300031595 | Bacteria | 50703 |
| 286 | Ga0265313_10005637 | 3300031595 | Bacteria | 9149 |
| 287 | Ga0265313_10043711 | 3300031595 | Bacteria | 2192 |
| 288 | Ga0265314_10001245 | 3300031711 | Bacteria | 29069 |
| 289 | Ga0265314_10011444 | 3300031711 | Bacteria | 7323 |
| 290 | Ga0265342_10000211 | 3300031712 | Bacteria | 65440 |
| 291 | Ga0265342_10015086 | 3300031712 | Bacteria | 5097 |
| 292 | Ga0265342_10037879 | 3300031712 | Bacteria | 2939 |
| 293 | Ga0307516_10019297 | 3300031730 | Bacteria | 7063 |
| 294 | Ga0373948_0000050 | 3300034817 | Bacteria | 12553 |
| 295 | Ga0373950_0000879 | 3300034818 | Bacteria | 3794 |
| 296 | Ga0373958_0000097 | 3300034819 | Bacteria | 9234 |
| 297 | Ga0373958_0001146 | 3300034819 | Bacteria | 3507 |
| 298 | Ga0373959_0000255 | 3300034820 | Bacteria | 11614 |
| 299 | Ga0373938_0000032 | 3300034957 | Bacteria | 17872 |
| 300 | Ga0373938_0002417 | 3300034957 | Bacteria | 3009 |
| 301 | Ga0373928_0000973 | 3300035084 | Bacteria | 5617 |
| 302 | Ga0373929_0001646 | 3300035085 | Bacteria | 4239 |
| 303 | Ga0373929_0002085 | 3300035085 | Bacteria | 3718 |
| 304 | Ga0373934_0038799 | 3300035086 | Bacteria | 1876 |
| 305 | Ga0373940_0000828 | 3300035088 | Bacteria | 5149 |
| 306 | Ga0373949_0001084 | 3300035090 | Bacteria | 8306 |
| 307 | Ga0373951_0000472 | 3300035091 | Bacteria | 11551 |
| 308 | Ga0373952_0000189 | 3300035092 | Bacteria | 9680 |
| 309 | Ga0373952_0003514 | 3300035092 | Bacteria | 2827 |
| 310 | Ga0373923_0028891 | 3300035111 | Bacteria | 2220 |
| 311 | Ga0373932_0000180 | 3300035112 | Bacteria | 18517 |
| 312 | Ga0373932_0003067 | 3300035112 | Bacteria | 4078 |
| 313 | Ga0373936_0011822 | 3300035113 | Bacteria | 3311 |
| 314 | Ga0373939_0000151 | 3300035114 | Bacteria | 19559 |
| 315 | Ga0373939_0001945 | 3300035114 | Bacteria | 4940 |
| 316 | Ga0373941_0001114 | 3300035115 | Bacteria | 5600 |
| 317 | Ga0373941_0004341 | 3300035115 | Bacteria | 3268 |
| 318 | Ga0373945_0032196 | 3300035116 | Bacteria | 1857 |
| 319 | Ga0373953_0006108 | 3300035117 | Bacteria | 3951 |
| 320 | Ga0373953_0008982 | 3300035117 | Bacteria | 3416 |
| 321 | Ga0373954_0001664 | 3300035118 | Bacteria | 9102 |
| 322 | Ga0373954_0015167 | 3300035118 | Bacteria | 3442 |
| 323 | Ga0373954_0037497 | 3300035118 | Bacteria | 2253 |
| 324 | Ga0373956_0015521 | 3300035119 | Bacteria | 3190 |
| 325 | Ga0373960_0000156 | 3300035121 | Bacteria | 11721 |
| 326 | Ga0373960_0000184 | 3300035121 | Bacteria | 11160 |
| 327 | Ga0373960_0002802 | 3300035121 | Bacteria | 3950 |
| 328 | Ga0373943_0008581 | 3300035170 | Bacteria | 4581 |
| 329 | Ga0373946_0003393 | 3300035171 | Bacteria | 5654 |
| 330 | Ga0373946_0019208 | 3300035171 | Bacteria | 2632 |
| 331 | Ga0373955_0008032 | 3300035172 | Bacteria | 4878 |
| 332 | Ga0373955_0008697 | 3300035172 | Bacteria | 4725 |
| 333 | Ga0373942_0000457 | 3300035207 | Bacteria | 11506 |
| 334 | Ga0373961_0002408 | 3300035241 | Bacteria | 4861 |
| 335 | Ga0373962_0000113 | 3300035242 | Bacteria | 16882 |
| 336 | Ga0373962_0000251 | 3300035242 | Bacteria | 11401 |
| 337 | Ga0373962_0002284 | 3300035242 | Bacteria | 4578 |
| 338 | Ga0373924_0002329 | 3300035410 | Bacteria | 6375 |
| 339 | Ga0373924_0003763 | 3300035410 | Bacteria | 5243 |
| 340 | Ga0373931_0000290 | 3300035691 | Bacteria | 21067 |
| 341 | Ga0373931_0001559 | 3300035691 | Bacteria | 9897 |
| 342 | Ga0373935_0000185 | 3300035692 | Bacteria | 29355 |
| 343 | Ga0373927_0019298 | 3300035695 | Bacteria | 4472 |
| 344 | Ga0373933_0037195 | 3300035724 | Bacteria | 2854 |
| 345 | Ga0373947_0011703 | 3300035725 | Bacteria | 5030 |
| 346 | Ga0373937_0000068 | 3300036401 | Bacteria | 94138 |
| 347 | Ga0373937_0003441 | 3300036401 | Bacteria | 13290 |
| 348 | Ga0373937_0037814 | 3300036401 | Bacteria | 4399 |
| 349 | Ga0373925_0000913 | 3300037068 | Bacteria | 26960 |
| 350 | Ga0373925_0025581 | 3300037068 | Bacteria | 4313 |
| 351 | Ga0395898_0018149 | 3300037466 | Bacteria | 7181 |
| 352 | Ga0436364_1425617 | 3300037853 | Bacteria | 2815 |
| 353 | Ga0436365_1010704 | 3300039437 | Bacteria | 15340 |
| 354 | Ga0436365_1829810 | 3300039437 | Bacteria | 2316 |
| 355 | Ga0436361_0303370 | 3300039447 | Bacteria | 1717 |
| 356 | Ga0466963_0074916 | 3300044694 | Bacteria | 2283 |
| 357 | Ga0466964_0082769 | 3300044706 | Bacteria | 1381 |
| 358 | Ga0453684_0113196 | 3300044712 | Bacteria | 3292 |
| 359 | Ga0451576_0027624 | 3300045051 | Bacteria | 6091 |
| 360 | Ga0466967_0107623 | 3300045976 | Bacteria | 2557 |
| 361 | Ga0495617_004301 | 3300046452 | Bacteria | 5192 |
| 362 | Ga0495592_0000488 | 3300046454 | Bacteria | 28883 |
| 363 | Ga0495603_0010478 | 3300046455 | Bacteria | 5617 |
| 364 | Ga0495603_0023619 | 3300046455 | Bacteria | 3719 |
| 365 | Ga0495603_0037648 | 3300046455 | Bacteria | 2902 |
| 366 | Ga0495629_0001536 | 3300046459 | Bacteria | 18162 |
| 367 | Ga0495638_0032117 | 3300046460 | Bacteria | 3368 |
| 368 | Ga0495651_0001053 | 3300046462 | Bacteria | 21347 |
| 369 | Ga0495651_0002415 | 3300046462 | Bacteria | 14429 |
| 370 | Ga0495651_0059789 | 3300046462 | Bacteria | 2921 |
| 371 | Ga0495653_0000199 | 3300046463 | Bacteria | 48763 |
| 372 | Ga0495653_0006680 | 3300046463 | Bacteria | 9465 |
| 373 | Ga0495582_0001755 | 3300046473 | Bacteria | 12244 |
| 374 | Ga0495605_0059715 | 3300046474 | Bacteria | 1830 |
| 375 | Ga0495639_0010278 | 3300046475 | Bacteria | 4026 |
| 376 | Ga0495662_0002942 | 3300046476 | Bacteria | 8598 |
| 377 | Ga0495664_0000105 | 3300046477 | Bacteria | 41914 |
| 378 | Ga0495664_0014203 | 3300046477 | Bacteria | 4511 |
| 379 | Ga0495594_0036774 | 3300046499 | Bacteria | 2671 |
| 380 | Ga0495594_0115956 | 3300046499 | Bacteria | 1512 |
| 381 | Ga0495608_0000020 | 3300046511 | Bacteria | 169036 |
| 382 | Ga0495608_0008586 | 3300046511 | Bacteria | 7155 |
| 383 | Ga0495618_0000225 | 3300046514 | Bacteria | 41236 |
| 384 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 385 | Ga0495628_0020292 | 3300046516 | Bacteria | 5484 |
| 386 | Ga0495628_0047505 | 3300046516 | Bacteria | 3405 |
| 387 | Ga0495628_0090506 | 3300046516 | Bacteria | 2369 |
| 388 | Ga0495630_0005536 | 3300046517 | Bacteria | 8914 |
| 389 | Ga0495630_0271954 | 3300046517 | Bacteria | 1294 |
| 390 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 391 | Ga0495665_0017692 | 3300046531 | Bacteria | 3832 |
| 392 | Ga0495640_0000027 | 3300046533 | Bacteria | 90638 |
| 393 | Ga0495587_0000017 | 3300046536 | Bacteria | 172923 |
| 394 | Ga0495587_0004533 | 3300046536 | Bacteria | 9126 |
| 395 | Ga0495609_0034479 | 3300046538 | Bacteria | 2294 |
| 396 | Ga0495645_0000212 | 3300046543 | Bacteria | 41774 |
| 397 | Ga0495645_0024148 | 3300046543 | Bacteria | 4409 |
| 398 | Ga0495667_0000031 | 3300046559 | Bacteria | 147377 |
| 399 | Ga0495667_0015229 | 3300046559 | Bacteria | 5191 |
| 400 | Ga0495667_0080327 | 3300046559 | Bacteria | 2120 |
| 401 | Ga0495656_0059117 | 3300046615 | Bacteria | 1666 |
| 402 | Ga0495668_0018111 | 3300046616 | Bacteria | 4074 |
| 403 | Ga0495634_0000006 | 3300046642 | Bacteria | 172775 |
| 404 | Ga0495634_0022747 | 3300046642 | Bacteria | 4415 |
| 405 | Ga0495634_0115184 | 3300046642 | Bacteria | 1725 |
| 406 | Ga0495611_0030654 | 3300046648 | Bacteria | 2366 |
| 407 | Ga0495635_0000154 | 3300046663 | Bacteria | 41886 |
| 408 | Ga0495635_0008349 | 3300046663 | Bacteria | 7231 |
| 409 | Ga0495635_0055138 | 3300046663 | Bacteria | 2738 |
| 410 | Ga0495635_0143797 | 3300046663 | Bacteria | 1624 |
| 411 | Ga0495657_0000828 | 3300046675 | Bacteria | 27353 |
| 412 | Ga0495657_0005789 | 3300046675 | Bacteria | 9736 |
| 413 | Ga0495599_0000051 | 3300046678 | Bacteria | 81853 |
| 414 | Ga0495599_0013640 | 3300046678 | Bacteria | 5021 |
| 415 | Ga0495623_0001373 | 3300046679 | Bacteria | 16526 |
| 416 | Ga0495623_0003197 | 3300046679 | Bacteria | 10822 |
| 417 | Ga0495646_0000102 | 3300046680 | Bacteria | 41798 |
| 418 | Ga0495646_0004146 | 3300046680 | Bacteria | 9100 |
| 419 | Ga0495647_0001979 | 3300046681 | Bacteria | 6401 |
| 420 | Ga0495658_0004872 | 3300046683 | Bacteria | 6586 |
| 421 | Ga0495669_0003877 | 3300046684 | Bacteria | 6153 |
| 422 | Ga0495613_0003386 | 3300046689 | Bacteria | 11918 |
| 423 | Ga0495613_0008152 | 3300046689 | Bacteria | 7791 |
| 424 | Ga0495624_0017557 | 3300046690 | Bacteria | 4802 |
| 425 | Ga0495600_0000069 | 3300046809 | Bacteria | 58754 |
| 426 | Ga0495600_0010128 | 3300046809 | Bacteria | 5845 |
| 427 | Ga0495581_0015179 | 3300047315 | Bacteria | 4471 |
| 428 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 429 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 430 | Ga0495674_0059656 | 3300047319 | Bacteria | 3331 |
| 431 | Ga0495674_0153002 | 3300047319 | Bacteria | 1934 |
| 432 | Ga0495676_0153822 | 3300047321 | Bacteria | 1634 |
| 433 | Ga0495680_0000216 | 3300047322 | Bacteria | 62986 |
| 434 | Ga0495680_0007202 | 3300047322 | Bacteria | 10242 |
| 435 | Ga0495680_0014111 | 3300047322 | Bacteria | 6938 |
| 436 | Ga0495680_0103326 | 3300047322 | Bacteria | 2121 |
| 437 | Ga0495675_0000216 | 3300047444 | Bacteria | 41783 |
| 438 | Ga0495675_0005926 | 3300047444 | Bacteria | 7468 |
| 439 | Ga0495684_0000009 | 3300047471 | Bacteria | 199436 |
| 440 | Ga0495684_0003057 | 3300047471 | Bacteria | 13153 |
| 441 | Ga0495593_0005967 | 3300047673 | Bacteria | 7174 |
| 442 | Ga0495593_0012056 | 3300047673 | Bacteria | 4954 |
| 443 | Ga0495602_0000373 | 3300048088 | Bacteria | 41729 |
| 444 | Ga0495602_0037977 | 3300048088 | Bacteria | 4459 |
| 445 | Ga0496100_0000171 | 3300048903 | Bacteria | 35989 |
| 446 | Ga0496100_0049649 | 3300048903 | Bacteria | 2714 |
| 447 | Ga0496101_0000246 | 3300048904 | Bacteria | 39478 |
| 448 | Ga0496101_0055775 | 3300048904 | Bacteria | 2855 |
| 449 | Ga0496102_0045863 | 3300048905 | Bacteria | 3968 |
| 450 | Ga0496102_0052855 | 3300048905 | Bacteria | 3702 |
| 451 | Ga0496103_0000753 | 3300048906 | Bacteria | 23863 |
| 452 | Ga0496103_0013775 | 3300048906 | Bacteria | 4800 |
| 453 | Ga0496103_0024347 | 3300048906 | Bacteria | 3654 |
| 454 | Ga0496103_0067269 | 3300048906 | Bacteria | 2237 |
| 455 | Ga0496104_0088059 | 3300048907 | Bacteria | 2966 |
| 456 | Ga0496105_0009322 | 3300048908 | Bacteria | 7672 |
| 457 | Ga0496105_0036145 | 3300048908 | Bacteria | 4068 |
| 458 | Ga0496106_0000183 | 3300048909 | Bacteria | 45053 |
| 459 | Ga0496106_0026194 | 3300048909 | Bacteria | 4339 |
| 460 | Ga0496107_0001430 | 3300048910 | Bacteria | 14748 |
| 461 | Ga0496107_0008995 | 3300048910 | Bacteria | 6922 |
| 462 | Ga0496107_0024819 | 3300048910 | Bacteria | 4242 |
| 463 | Ga0496107_0083401 | 3300048910 | Bacteria | 2331 |
| 464 | Ga0496108_0001856 | 3300048911 | Bacteria | 16893 |
| 465 | Ga0496108_0003772 | 3300048911 | Bacteria | 12130 |
| 466 | Ga0496108_0047949 | 3300048911 | Bacteria | 3571 |
| 467 | Ga0496109_0004054 | 3300048912 | Bacteria | 12240 |
| 468 | Ga0496109_0004165 | 3300048912 | Bacteria | 12074 |
| 469 | Ga0496109_0098648 | 3300048912 | Bacteria | 2708 |
| 470 | Ga0496109_0183964 | 3300048912 | Bacteria | 1963 |
| 471 | Ga0496109_0186624 | 3300048912 | Bacteria | 1948 |
| 472 | Ga0496110_0007624 | 3300048913 | Bacteria | 8654 |
| 473 | Ga0496110_0085718 | 3300048913 | Bacteria | 2812 |
| 474 | Ga0496111_0036865 | 3300048914 | Bacteria | 3497 |
| 475 | Ga0496112_0002096 | 3300048915 | Bacteria | 15835 |
| 476 | Ga0496112_0247025 | 3300048915 | Bacteria | 1736 |
| 477 | Ga0496113_0003761 | 3300048916 | Bacteria | 9157 |
| 478 | Ga0496113_0017451 | 3300048916 | Bacteria | 4983 |
| 479 | Ga0496113_0039473 | 3300048916 | Bacteria | 3475 |
| 480 | Ga0496114_0002224 | 3300048917 | Bacteria | 14788 |
| 481 | Ga0496115_0020141 | 3300048918 | Bacteria | 5142 |
| 482 | Ga0496115_0026952 | 3300048918 | Bacteria | 4491 |
| 483 | Ga0496115_0143410 | 3300048918 | Bacteria | 1970 |
| 484 | Ga0496115_0168462 | 3300048918 | Bacteria | 1811 |
| 485 | Ga0496121_0001497 | 3300048924 | Bacteria | 39336 |
| 486 | Ga0496121_0003089 | 3300048924 | Bacteria | 24095 |
| 487 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 488 | Ga0496126_0074904 | 3300048929 | Bacteria | 3005 |
| 489 | Ga0501032_0008293 | 3300049569 | Bacteria | 7571 |
| 490 | Ga0501032_0019777 | 3300049569 | Bacteria | 4702 |
| 491 | Ga0501032_0020626 | 3300049569 | Bacteria | 4587 |
| 492 | Ga0501033_0033897 | 3300049570 | Bacteria | 3832 |
| 493 | Ga0501033_0049039 | 3300049570 | Bacteria | 3135 |
| 494 | Ga0501033_0079355 | 3300049570 | Bacteria | 2408 |
| 495 | Ga0501033_0123341 | 3300049570 | Bacteria | 1879 |
| 496 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 497 | Ga0501034_0003303 | 3300049571 | Bacteria | 18422 |
| 498 | Ga0501034_0013393 | 3300049571 | Bacteria | 8442 |
| 499 | Ga0501034_0019841 | 3300049571 | Bacteria | 6868 |
| 500 | Ga0501034_0021364 | 3300049571 | Bacteria | 6599 |
| 501 | Ga0501034_0031012 | 3300049571 | Bacteria | 5433 |
| 502 | Ga0501034_0087578 | 3300049571 | Bacteria | 3113 |
| 503 | Ga0501034_0101010 | 3300049571 | Bacteria | 2878 |
| 504 | Ga0501034_0120692 | 3300049571 | Bacteria | 2607 |
| 505 | Ga0501034_0161491 | 3300049571 | Bacteria | 2211 |
| 506 | Ga0501036_0001894 | 3300049572 | Bacteria | 16266 |
| 507 | Ga0501036_0048563 | 3300049572 | Bacteria | 3593 |
| 508 | Ga0501036_0051873 | 3300049572 | Bacteria | 3473 |
| 509 | Ga0501036_0057570 | 3300049572 | Bacteria | 3292 |
| 510 | Ga0501036_0068612 | 3300049572 | Bacteria | 3000 |
| 511 | Ga0501036_0156118 | 3300049572 | Bacteria | 1924 |
| 512 | Ga0501036_0181148 | 3300049572 | Bacteria | 1773 |
| 513 | Ga0501037_0043649 | 3300049573 | Bacteria | 3294 |
| 514 | Ga0501037_0044025 | 3300049573 | Bacteria | 3279 |
| 515 | Ga0501038_0022795 | 3300049574 | Bacteria | 5604 |
| 516 | Ga0501038_0052938 | 3300049574 | Bacteria | 3497 |
| 517 | Ga0501038_0070121 | 3300049574 | Bacteria | 2977 |
| 518 | Ga0501038_0209242 | 3300049574 | Bacteria | 1561 |
| 519 | Ga0501039_0034296 | 3300049575 | Bacteria | 3916 |
| 520 | Ga0501039_0044517 | 3300049575 | Bacteria | 3428 |
| 521 | Ga0501040_0111273 | 3300049576 | Bacteria | 1915 |
| 522 | Ga0501043_0003514 | 3300049579 | Bacteria | 12892 |
| 523 | Ga0501043_0016234 | 3300049579 | Bacteria | 5840 |
| 524 | Ga0501043_0024770 | 3300049579 | Bacteria | 4707 |
| 525 | Ga0501043_0042646 | 3300049579 | Bacteria | 3565 |
| 526 | Ga0501043_0050714 | 3300049579 | Bacteria | 3261 |
| 527 | Ga0501043_0101567 | 3300049579 | Bacteria | 2260 |
| 528 | Ga0501046_0008812 | 3300049580 | Bacteria | 8763 |
| 529 | Ga0501046_0027889 | 3300049580 | Bacteria | 4603 |
| 530 | Ga0501046_0047163 | 3300049580 | Bacteria | 3416 |
| 531 | Ga0501047_0000688 | 3300049581 | Bacteria | 35266 |
| 532 | Ga0501047_0003823 | 3300049581 | Bacteria | 14152 |
| 533 | Ga0501047_0009938 | 3300049581 | Bacteria | 8998 |
| 534 | Ga0501047_0077104 | 3300049581 | Bacteria | 3207 |
| 535 | Ga0501047_0100572 | 3300049581 | Bacteria | 2770 |
| 536 | Ga0501047_0130238 | 3300049581 | Bacteria | 2396 |
| 537 | Ga0501047_0173479 | 3300049581 | Bacteria | 2025 |
| 538 | Ga0501048_0000044 | 3300049582 | Bacteria | 60933 |
| 539 | Ga0501048_0002575 | 3300049582 | Bacteria | 13870 |
| 540 | Ga0501048_0077651 | 3300049582 | Bacteria | 2343 |
| 541 | Ga0501068_0036118 | 3300049584 | Bacteria | 2953 |
| 542 | Ga0501068_0147920 | 3300049584 | Bacteria | 1475 |
| 543 | Ga0501069_0014126 | 3300049585 | Bacteria | 4263 |
| 544 | Ga0501070_0006200 | 3300049586 | Bacteria | 10187 |
| 545 | Ga0501070_0020220 | 3300049586 | Bacteria | 5584 |
| 546 | Ga0501070_0046667 | 3300049586 | Bacteria | 3602 |
| 547 | Ga0501070_0089611 | 3300049586 | Bacteria | 2546 |
| 548 | Ga0501070_0185396 | 3300049586 | Bacteria | 1711 |
| 549 | Ga0501071_0025123 | 3300049587 | Bacteria | 4171 |
| 550 | Ga0501072_0058455 | 3300049588 | Bacteria | 3039 |
| 551 | Ga0501073_0031621 | 3300049589 | Bacteria | 3776 |
| 552 | Ga0501073_0043244 | 3300049589 | Bacteria | 3176 |
| 553 | Ga0501073_0048730 | 3300049589 | Bacteria | 2973 |
| 554 | Ga0501074_0040108 | 3300049590 | Bacteria | 3391 |
| 555 | Ga0501077_0065796 | 3300049593 | Bacteria | 2299 |
| 556 | Ga0501079_0098241 | 3300049741 | Bacteria | 2270 |
| 557 | Ga0501080_0000153 | 3300049742 | Bacteria | 49231 |
| 558 | Ga0501080_0080916 | 3300049742 | Bacteria | 3018 |
| 559 | Ga0501083_0003065 | 3300049744 | Bacteria | 11615 |
| 560 | Ga0501083_0022198 | 3300049744 | Bacteria | 4405 |
| 561 | Ga0501083_0074383 | 3300049744 | Bacteria | 2257 |
| 562 | Ga0501083_0081607 | 3300049744 | Bacteria | 2143 |
| 563 | Ga0501083_0113885 | 3300049744 | Bacteria | 1777 |
| 564 | Ga0501035_0011386 | 3300049822 | Bacteria | 8244 |
| 565 | Ga0501035_0066183 | 3300049822 | Bacteria | 3207 |
| 566 | Ga0501035_0103055 | 3300049822 | Bacteria | 2503 |
| 567 | Ga0501035_0172862 | 3300049822 | Bacteria | 1865 |
| 568 | Ga0501044_0007955 | 3300049823 | Bacteria | 11650 |
| 569 | Ga0501044_0030717 | 3300049823 | Bacteria | 5660 |
| 570 | Ga0501044_0057298 | 3300049823 | Bacteria | 3998 |
| 571 | nmdc:mga07m45_24549_c1 | 3300050496 | Bacteria | 3304 |
| 572 | nmdc:mga05p37_17666_c1 | 3300050507 | Bacteria | 8607 |
| 573 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 574 | nmdc:mga09592_813_c1 | 3300050508 | Bacteria | 24096 |
| 575 | nmdc:mga0qj67_1453_c1 | 3300050509 | Bacteria | 16598 |
| 576 | nmdc:mga06r32_4634_c1 | 3300050510 | Bacteria | 12334 |
| 577 | nmdc:mga08y16_1715_c1 | 3300050511 | Bacteria | 22248 |
| 578 | nmdc:mga08y16_9096_c1 | 3300050511 | Bacteria | 10430 |
| 579 | nmdc:mga0n895_1392_c1 | 3300050512 | Bacteria | 18016 |
| 580 | nmdc:mga0n895_169721_c1 | 3300050512 | Bacteria | 2214 |
| 581 | nmdc:mga0n895_46203_c1 | 3300050512 | Bacteria | 4252 |
| 582 | nmdc:mga0n895_6890_c1 | 3300050512 | Bacteria | 9707 |
| 583 | nmdc:mga0n895_971_c1 | 3300050512 | Bacteria | 20812 |
| 584 | nmdc:mga0rr50_12087_c1 | 3300050513 | Bacteria | 5561 |
| 585 | nmdc:mga0rr50_55713_c1 | 3300050513 | Bacteria | 2951 |
| 586 | nmdc:mga0a205_1026_c1 | 3300050515 | Bacteria | 23240 |
| 587 | nmdc:mga0a205_687_c1 | 3300050515 | Bacteria | 27032 |
| 588 | Ga0495601_0000020 | 3300053077 | Bacteria | 160011 |
| 589 | Ga0495601_0005819 | 3300053077 | Bacteria | 7188 |
| 590 | Ga0495601_0041647 | 3300053077 | Bacteria | 2880 |
| 591 | Ga0495612_0000030 | 3300053078 | Bacteria | 81917 |
| 592 | Ga0495612_0015054 | 3300053078 | Bacteria | 3101 |
| 593 | Ga0495612_0027973 | 3300053078 | Bacteria | 2268 |
| 594 | Ga0495612_0029945 | 3300053078 | Bacteria | 2193 |
| 595 | Ga0495595_0000125 | 3300053084 | Bacteria | 33101 |
| 596 | Ga0495595_0001470 | 3300053084 | Bacteria | 9200 |
| 597 | Ga0495619_0000151 | 3300053085 | Bacteria | 51364 |
| 598 | Ga0495619_0000216 | 3300053085 | Bacteria | 41892 |
| 599 | Ga0495619_0000419 | 3300053085 | Bacteria | 28779 |
| 600 | Ga0495619_0022205 | 3300053085 | Bacteria | 4058 |
| 601 | Ga0500643_003281 | 3300053087 | Bacteria | 7866 |
| 602 | Ga0500644_0000314 | 3300053088 | Bacteria | 25311 |
| 603 | Ga0500651_0053949 | 3300053093 | Bacteria | 2521 |
| 604 | Ga0500641_0004097 | 3300053096 | Bacteria | 5148 |
| 605 | Ga0500641_0041519 | 3300053096 | Bacteria | 1861 |
| 606 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 607 | Ga0500652_000011 | 3300053131 | Bacteria | 160704 |
| 608 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 609 | Ga0500645_000122 | 3300053730 | Bacteria | 61591 |
| 610 | Ga0501084_0099209 | 3300054114 | Bacteria | 2446 |
| 611 | Ga0501082_0157164 | 3300060353 | Bacteria | 1975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_1425617 | Ga0436364_1425617_22_1233 | 398 |
| 2 | 3300046517 | Ga0495630_0271954 | Ga0495630_0271954_16_1269 | 417 |
| 3 | 3300046680 | Ga0495646_0004146 | Ga0495646_0004146_14_1267 | 417 |
| 4 | 3300002076 | JGI24749J21850_1005252 | JGI24749J21850_10052522 | 424 |
| 5 | 3300005445 | Ga0070708_100148472 | Ga0070708_1001484722 | 427 |
| 6 | 3300035117 | Ga0373953_0006108 | Ga0373953_0006108_1560_2957 | 429 |
| 7 | 3300036401 | Ga0373937_0003441 | Ga0373937_0003441_11729_13126 | 429 |
| 8 | 3300005335 | Ga0070666_10020782 | Ga0070666_100207823 | 437 |
| 9 | 3300005456 | Ga0070678_100008371 | Ga0070678_1000083715 | 437 |
| 10 | 3300006237 | Ga0097621_100049459 | Ga0097621_1000494593 | 437 |
| 11 | 3300007076 | Ga0075435_100023780 | Ga0075435_1000237804 | 437 |
| 12 | 3300025900 | Ga0207710_10033844 | Ga0207710_100338442 | 437 |
| 13 | 3300025905 | Ga0207685_10011949 | Ga0207685_100119492 | 437 |
| 14 | 3300025927 | Ga0207687_10018417 | Ga0207687_100184173 | 437 |
| 15 | 3300025934 | Ga0207686_10012409 | Ga0207686_100124092 | 437 |
| 16 | 3300044706 | Ga0466964_0082769 | Ga0466964_0082769_15_1358 | 437 |
| 17 | 3300046462 | Ga0495651_0059789 | Ga0495651_0059789_939_2252 | 437 |
| 18 | 3300046516 | Ga0495628_0047505 | Ga0495628_0047505_223_1536 | 437 |
| 19 | 3300053078 | Ga0495612_0027973 | Ga0495612_0027973_546_1859 | 437 |
| 20 | 3300006175 | Ga0070712_100008568 | Ga0070712_1000085682 | 442 |
| 21 | 3300039437 | Ga0436365_1010704 | Ga0436365_1010704_162_1565 | 443 |
| 22 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_48415_49815 | 444 |
| 23 | 3300049584 | Ga0501068_0147920 | Ga0501068_0147920_71_1405 | 444 |
| 24 | 3300049742 | Ga0501080_0080916 | Ga0501080_0080916_107_1501 | 444 |
| 25 | 3300049576 | Ga0501040_0111273 | Ga0501040_0111273_172_1584 | 446 |
| 26 | 3300049579 | Ga0501043_0024770 | Ga0501043_0024770_1295_2695 | 448 |
| 27 | 3300035114 | Ga0373939_0001945 | Ga0373939_0001945_2373_3785 | 449 |
| 28 | 3300006353 | Ga0075370_10018625 | Ga0075370_100186252 | 451 |
| 29 | 3300049571 | Ga0501034_0019841 | Ga0501034_0019841_1044_2444 | 451 |
| 30 | 3300050496 | nmdc:mga07m45_24549_c1 | nmdc:mga07m45_24549_c1_1209_2654 | 451 |
| 31 | 3300039447 | Ga0436361_0303370 | Ga0436361_0303370_142_1557 | 452 |
| 32 | 3300046499 | Ga0495594_0115956 | Ga0495594_0115956_101_1477 | 452 |
| 33 | 3300005327 | Ga0070658_10153847 | Ga0070658_101538472 | 453 |
| 34 | 3300025909 | Ga0207705_10100274 | Ga0207705_101002742 | 453 |
| 35 | 3300039437 | Ga0436365_1829810 | Ga0436365_1829810_581_1981 | 453 |
| 36 | 3300031241 | Ga0265325_10008083 | Ga0265325_100080833 | 454 |
| 37 | 3300049569 | Ga0501032_0020626 | Ga0501032_0020626_408_1805 | 454 |
| 38 | 3300049570 | Ga0501033_0079355 | Ga0501033_0079355_887_2284 | 454 |
| 39 | 3300049571 | Ga0501034_0013393 | Ga0501034_0013393_2293_3690 | 454 |
| 40 | 3300049572 | Ga0501036_0048563 | Ga0501036_0048563_2056_3453 | 454 |
| 41 | 3300049573 | Ga0501037_0043649 | Ga0501037_0043649_199_1596 | 454 |
| 42 | 3300049579 | Ga0501043_0042646 | Ga0501043_0042646_310_1707 | 454 |
| 43 | 3300049580 | Ga0501046_0008812 | Ga0501046_0008812_540_1937 | 454 |
| 44 | 3300049581 | Ga0501047_0009938 | Ga0501047_0009938_537_1934 | 454 |
| 45 | 3300049571 | Ga0501034_0120692 | Ga0501034_0120692_965_2377 | 455 |
| 46 | 3300049572 | Ga0501036_0181148 | Ga0501036_0181148_71_1483 | 455 |
| 47 | 3300049579 | Ga0501043_0101567 | Ga0501043_0101567_167_1579 | 455 |
| 48 | 3300049586 | Ga0501070_0185396 | Ga0501070_0185396_224_1636 | 455 |
| 49 | 3300005367 | Ga0070667_100055063 | Ga0070667_1000550633 | 456 |
| 50 | 3300005614 | Ga0068856_100164064 | Ga0068856_1001640642 | 456 |
| 51 | 3300009177 | Ga0105248_10009030 | Ga0105248_100090303 | 456 |
| 52 | 3300009177 | Ga0105248_10098683 | Ga0105248_100986832 | 456 |
| 53 | 3300014325 | Ga0163163_10003284 | Ga0163163_100032845 | 456 |
| 54 | 3300014968 | Ga0157379_10024669 | Ga0157379_100246692 | 456 |
| 55 | 3300025927 | Ga0207687_10025228 | Ga0207687_100252283 | 456 |
| 56 | 3300025928 | Ga0207700_10133441 | Ga0207700_101334412 | 456 |
| 57 | 3300025929 | Ga0207664_10086611 | Ga0207664_100866112 | 456 |
| 58 | 3300025941 | Ga0207711_10129229 | Ga0207711_101292291 | 456 |
| 59 | 3300026121 | Ga0207683_10026216 | Ga0207683_100262162 | 456 |
| 60 | 3300048903 | Ga0496100_0049649 | Ga0496100_0049649_419_1828 | 456 |
| 61 | 3300048905 | Ga0496102_0052855 | Ga0496102_0052855_2193_3602 | 456 |
| 62 | 3300048906 | Ga0496103_0067269 | Ga0496103_0067269_779_2188 | 456 |
| 63 | 3300048908 | Ga0496105_0009322 | Ga0496105_0009322_5715_7124 | 456 |
| 64 | 3300048911 | Ga0496108_0003772 | Ga0496108_0003772_8245_9690 | 456 |
| 65 | 3300048912 | Ga0496109_0004165 | Ga0496109_0004165_5980_7425 | 456 |
| 66 | 3300048912 | Ga0496109_0183964 | Ga0496109_0183964_165_1574 | 456 |
| 67 | 3300048915 | Ga0496112_0002096 | Ga0496112_0002096_10028_11473 | 456 |
| 68 | 3300048916 | Ga0496113_0003761 | Ga0496113_0003761_836_2281 | 456 |
| 69 | 3300048918 | Ga0496115_0026952 | Ga0496115_0026952_510_1919 | 456 |
| 70 | 3300048924 | Ga0496121_0001497 | Ga0496121_0001497_24153_25550 | 456 |
| 71 | 3300048929 | Ga0496126_0074904 | Ga0496126_0074904_1291_2688 | 456 |
| 72 | 3300049822 | Ga0501035_0011386 | Ga0501035_0011386_3916_5316 | 456 |
| 73 | 3300049572 | Ga0501036_0057570 | Ga0501036_0057570_402_1802 | 457 |
| 74 | 3300049579 | Ga0501043_0016234 | Ga0501043_0016234_3792_5192 | 457 |
| 75 | 3300053131 | Ga0500652_000011 | Ga0500652_000011_11366_12772 | 457 |
| 76 | 3300049570 | Ga0501033_0033897 | Ga0501033_0033897_1027_2442 | 460 |
| 77 | 3300049572 | Ga0501036_0068612 | Ga0501036_0068612_993_2408 | 460 |
| 78 | 3300031344 | Ga0265316_10077382 | Ga0265316_100773822 | 461 |
| 79 | 3300031712 | Ga0265342_10037879 | Ga0265342_100378792 | 461 |
| 80 | 3300048910 | Ga0496107_0083401 | Ga0496107_0083401_440_1837 | 461 |
| 81 | 3300053077 | Ga0495601_0041647 | Ga0495601_0041647_77_1474 | 461 |
| 82 | iso_pu_bacteria | 2513237101 | 2513697437 | 462 |
| 83 | iso_pu_bacteria | 2643221547 | 2643755165 | 462 |
| 84 | iso_pu_bacteria | 2721755755 | 2723843070 | 462 |
| 85 | iso_pu_bacteria | 2791355199 | 2793079521 | 462 |
| 86 | iso_pu_bacteria | 2874604998 | 2874612598 | 462 |
| 87 | iso_pu_bacteria | 2879110137 | 2879118037 | 462 |
| 88 | iso_pu_bacteria | 2889033259 | 2889033628 | 462 |
| 89 | iso_pu_bacteria | 2922361189 | 2922366994 | 462 |
| 90 | iso_pu_bacteria | 2922386360 | 2922390223 | 462 |
| 91 | iso_pu_bacteria | 8006964411 | 8006966530 | 462 |
| 92 | iso_pu_bacteria | 8006984368 | 8006989359 | 462 |
| 93 | iso_pu_bacteria | 8006994254 | 8006997842 | 462 |
| 94 | 3300037466 | Ga0395898_0018149 | Ga0395898_0018149_2559_3974 | 463 |
| 95 | 3300049571 | Ga0501034_0021364 | Ga0501034_0021364_2391_3806 | 463 |
| 96 | 3300049581 | Ga0501047_0077104 | Ga0501047_0077104_960_2375 | 463 |
| 97 | 3300049581 | Ga0501047_0173479 | Ga0501047_0173479_297_1712 | 463 |
| 98 | 3300049582 | Ga0501048_0000044 | Ga0501048_0000044_2386_3801 | 463 |
| 99 | 3300049586 | Ga0501070_0089611 | Ga0501070_0089611_507_1922 | 463 |
| 100 | 3300005331 | Ga0070670_100082630 | Ga0070670_1000826302 | 464 |
| 101 | 3300005434 | Ga0070709_10104430 | Ga0070709_101044302 | 464 |
| 102 | 3300005437 | Ga0070710_10002708 | Ga0070710_100027087 | 464 |
| 103 | 3300005441 | Ga0070700_100030715 | Ga0070700_1000307152 | 464 |
| 104 | 3300005535 | Ga0070684_100033334 | Ga0070684_1000333344 | 464 |
| 105 | 3300005564 | Ga0070664_100071641 | Ga0070664_1000716412 | 464 |
| 106 | 3300005618 | Ga0068864_100207791 | Ga0068864_1002077912 | 464 |
| 107 | 3300006028 | Ga0070717_10002936 | Ga0070717_100029369 | 464 |
| 108 | 3300006028 | Ga0070717_10092207 | Ga0070717_100922072 | 464 |
| 109 | 3300006175 | Ga0070712_100048251 | Ga0070712_1000482513 | 464 |
| 110 | 3300006871 | Ga0075434_100052011 | Ga0075434_1000520112 | 464 |
| 111 | 3300009148 | Ga0105243_10043053 | Ga0105243_100430532 | 464 |
| 112 | 3300009176 | Ga0105242_10012804 | Ga0105242_100128045 | 464 |
| 113 | 3300009553 | Ga0105249_10118547 | Ga0105249_101185472 | 464 |
| 114 | 3300013308 | Ga0157375_10235618 | Ga0157375_102356182 | 464 |
| 115 | 3300014968 | Ga0157379_10075180 | Ga0157379_100751802 | 464 |
| 116 | 3300025915 | Ga0207693_10007487 | Ga0207693_100074875 | 464 |
| 117 | 3300025918 | Ga0207662_10027211 | Ga0207662_100272112 | 464 |
| 118 | 3300025925 | Ga0207650_10009331 | Ga0207650_100093316 | 464 |
| 119 | 3300025928 | Ga0207700_10001137 | Ga0207700_1000113710 | 464 |
| 120 | 3300025929 | Ga0207664_10027404 | Ga0207664_100274044 | 464 |
| 121 | 3300025931 | Ga0207644_10005542 | Ga0207644_100055426 | 464 |
| 122 | 3300025935 | Ga0207709_10018748 | Ga0207709_100187482 | 464 |
| 123 | 3300025939 | Ga0207665_10001484 | Ga0207665_100014849 | 464 |
| 124 | 3300025941 | Ga0207711_10043909 | Ga0207711_100439092 | 464 |
| 125 | 3300025944 | Ga0207661_10216292 | Ga0207661_102162922 | 464 |
| 126 | 3300025986 | Ga0207658_10238082 | Ga0207658_102380821 | 464 |
| 127 | 3300026035 | Ga0207703_10012070 | Ga0207703_100120705 | 464 |
| 128 | 3300026067 | Ga0207678_10016738 | Ga0207678_100167382 | 464 |
| 129 | 3300026095 | Ga0207676_10259756 | Ga0207676_102597561 | 464 |
| 130 | 3300026121 | Ga0207683_10006919 | Ga0207683_100069192 | 464 |
| 131 | 3300035085 | Ga0373929_0002085 | Ga0373929_0002085_1867_3261 | 464 |
| 132 | 3300035121 | Ga0373960_0002802 | Ga0373960_0002802_1766_3160 | 464 |
| 133 | 3300035171 | Ga0373946_0019208 | Ga0373946_0019208_1074_2468 | 464 |
| 134 | 3300035242 | Ga0373962_0002284 | Ga0373962_0002284_2622_4016 | 464 |
| 135 | 3300035691 | Ga0373931_0001559 | Ga0373931_0001559_266_1660 | 464 |
| 136 | 3300046455 | Ga0495603_0010478 | Ga0495603_0010478_3155_4549 | 464 |
| 137 | 3300046459 | Ga0495629_0001536 | Ga0495629_0001536_1691_3085 | 464 |
| 138 | 3300046473 | Ga0495582_0001755 | Ga0495582_0001755_890_2284 | 464 |
| 139 | 3300046681 | Ga0495647_0001979 | Ga0495647_0001979_1065_2459 | 464 |
| 140 | 3300046683 | Ga0495658_0004872 | Ga0495658_0004872_1486_2880 | 464 |
| 141 | 3300046689 | Ga0495613_0003386 | Ga0495613_0003386_9677_11071 | 464 |
| 142 | 3300047321 | Ga0495676_0153822 | Ga0495676_0153822_49_1443 | 464 |
| 143 | 3300047322 | Ga0495680_0007202 | Ga0495680_0007202_819_2213 | 464 |
| 144 | 3300048904 | Ga0496101_0055775 | Ga0496101_0055775_442_1836 | 464 |
| 145 | 3300048905 | Ga0496102_0045863 | Ga0496102_0045863_329_1723 | 464 |
| 146 | 3300048906 | Ga0496103_0013775 | Ga0496103_0013775_1155_2549 | 464 |
| 147 | 3300048907 | Ga0496104_0088059 | Ga0496104_0088059_1192_2586 | 464 |
| 148 | 3300048910 | Ga0496107_0008995 | Ga0496107_0008995_4371_5765 | 464 |
| 149 | 3300048911 | Ga0496108_0047949 | Ga0496108_0047949_1104_2498 | 464 |
| 150 | 3300048912 | Ga0496109_0098648 | Ga0496109_0098648_1207_2601 | 464 |
| 151 | 3300050512 | nmdc:mga0n895_169721_c1 | nmdc:mga0n895_169721_c1_490_1884 | 464 |
| 152 | 3300050512 | nmdc:mga0n895_46203_c1 | nmdc:mga0n895_46203_c1_660_2054 | 464 |
| 153 | 3300053085 | Ga0495619_0000419 | Ga0495619_0000419_16059_17453 | 464 |
| 154 | 3300053087 | Ga0500643_003281 | Ga0500643_003281_5593_6999 | 464 |
| 155 | 3300053088 | Ga0500644_0000314 | Ga0500644_0000314_14411_15817 | 464 |
| 156 | 3300053093 | Ga0500651_0053949 | Ga0500651_0053949_1077_2483 | 464 |
| 157 | 3300053119 | Ga0500595_000024 | Ga0500595_000024_117977_119383 | 464 |
| 158 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_51816_53222 | 464 |
| 159 | 3300053730 | Ga0500645_000122 | Ga0500645_000122_51359_52765 | 464 |
| 160 | 3300005336 | Ga0070680_100201724 | Ga0070680_1002017242 | 465 |
| 161 | 3300006194 | Ga0075427_10002058 | Ga0075427_100020583 | 465 |
| 162 | 3300006844 | Ga0075428_100008481 | Ga0075428_1000084817 | 465 |
| 163 | 3300006846 | Ga0075430_100000012 | Ga0075430_10000001212 | 465 |
| 164 | 3300006847 | Ga0075431_100003622 | Ga0075431_1000036228 | 465 |
| 165 | 3300006852 | Ga0075433_10014382 | Ga0075433_100143825 | 465 |
| 166 | 3300006852 | Ga0075433_10081548 | Ga0075433_100815481 | 465 |
| 167 | 3300006871 | Ga0075434_100000114 | Ga0075434_10000011444 | 465 |
| 168 | 3300006871 | Ga0075434_100020042 | Ga0075434_1000200422 | 465 |
| 169 | 3300006880 | Ga0075429_100002694 | Ga0075429_1000026948 | 465 |
| 170 | 3300007076 | Ga0075435_100019420 | Ga0075435_1000194202 | 465 |
| 171 | 3300009094 | Ga0111539_10002232 | Ga0111539_100022325 | 465 |
| 172 | 3300009147 | Ga0114129_10008877 | Ga0114129_100088775 | 465 |
| 173 | 3300009147 | Ga0114129_10010926 | Ga0114129_100109265 | 465 |
| 174 | 3300027907 | Ga0207428_10000058 | Ga0207428_1000005874 | 465 |
| 175 | 3300031241 | Ga0265325_10005052 | Ga0265325_100050524 | 465 |
| 176 | 3300031249 | Ga0265339_10000450 | Ga0265339_1000045018 | 465 |
| 177 | 3300031595 | Ga0265313_10005637 | Ga0265313_100056374 | 465 |
| 178 | 3300031711 | Ga0265314_10001245 | Ga0265314_100012456 | 465 |
| 179 | 3300031711 | Ga0265314_10011444 | Ga0265314_100114442 | 465 |
| 180 | 3300031712 | Ga0265342_10000211 | Ga0265342_1000021120 | 465 |
| 181 | 3300031712 | Ga0265342_10015086 | Ga0265342_100150863 | 465 |
| 182 | 3300044694 | Ga0466963_0074916 | Ga0466963_0074916_638_2035 | 465 |
| 183 | 3300045976 | Ga0466967_0107623 | Ga0466967_0107623_608_2005 | 465 |
| 184 | 3300049570 | Ga0501033_0123341 | Ga0501033_0123341_269_1666 | 465 |
| 185 | 3300049744 | Ga0501083_0022198 | Ga0501083_0022198_2807_4228 | 465 |
| 186 | 3300050507 | nmdc:mga05p37_17666_c1 | nmdc:mga05p37_17666_c1_4301_5698 | 465 |
| 187 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_43107_44504 | 465 |
| 188 | 3300050508 | nmdc:mga09592_813_c1 | nmdc:mga09592_813_c1_7935_9332 | 465 |
| 189 | 3300050509 | nmdc:mga0qj67_1453_c1 | nmdc:mga0qj67_1453_c1_7963_9360 | 465 |
| 190 | 3300050510 | nmdc:mga06r32_4634_c1 | nmdc:mga06r32_4634_c1_3265_4662 | 465 |
| 191 | 3300050511 | nmdc:mga08y16_1715_c1 | nmdc:mga08y16_1715_c1_12029_13426 | 465 |
| 192 | 3300050512 | nmdc:mga0n895_1392_c1 | nmdc:mga0n895_1392_c1_8616_10013 | 465 |
| 193 | 3300050512 | nmdc:mga0n895_6890_c1 | nmdc:mga0n895_6890_c1_1074_2471 | 465 |
| 194 | 3300050513 | nmdc:mga0rr50_12087_c1 | nmdc:mga0rr50_12087_c1_556_1953 | 465 |
| 195 | 3300050513 | nmdc:mga0rr50_55713_c1 | nmdc:mga0rr50_55713_c1_1006_2403 | 465 |
| 196 | 3300050515 | nmdc:mga0a205_687_c1 | nmdc:mga0a205_687_c1_17816_19213 | 465 |
| 197 | 3300005366 | Ga0070659_100190426 | Ga0070659_1001904262 | 466 |
| 198 | 3300005544 | Ga0070686_100129693 | Ga0070686_1001296931 | 466 |
| 199 | 3300005614 | Ga0068856_100235815 | Ga0068856_1002358152 | 466 |
| 200 | 3300005983 | Ga0081540_1003272 | Ga0081540_100327211 | 466 |
| 201 | 3300005983 | Ga0081540_1036865 | Ga0081540_10368652 | 466 |
| 202 | 3300006871 | Ga0075434_100030889 | Ga0075434_1000308893 | 466 |
| 203 | 3300009553 | Ga0105249_10102158 | Ga0105249_101021581 | 466 |
| 204 | 3300013307 | Ga0157372_10003944 | Ga0157372_1000394416 | 466 |
| 205 | 3300013307 | Ga0157372_10005907 | Ga0157372_100059072 | 466 |
| 206 | 3300025297 | Ga0209758_1010107 | Ga0209758_10101073 | 466 |
| 207 | 3300025933 | Ga0207706_10021896 | Ga0207706_100218961 | 466 |
| 208 | 3300025940 | Ga0207691_10106091 | Ga0207691_101060912 | 466 |
| 209 | 3300026078 | Ga0207702_10142938 | Ga0207702_101429382 | 466 |
| 210 | 3300026118 | Ga0207675_100095986 | Ga0207675_1000959862 | 466 |
| 211 | 3300028379 | Ga0268266_10030112 | Ga0268266_100301122 | 466 |
| 212 | 3300028786 | Ga0307517_10000085 | Ga0307517_10000085117 | 466 |
| 213 | 3300031241 | Ga0265325_10024983 | Ga0265325_100249832 | 466 |
| 214 | 3300031456 | Ga0307513_10194768 | Ga0307513_101947682 | 466 |
| 215 | 3300031595 | Ga0265313_10000340 | Ga0265313_1000034023 | 466 |
| 216 | 3300031595 | Ga0265313_10043711 | Ga0265313_100437111 | 466 |
| 217 | 3300031730 | Ga0307516_10019297 | Ga0307516_100192978 | 466 |
| 218 | 3300035086 | Ga0373934_0038799 | Ga0373934_0038799_185_1585 | 466 |
| 219 | 3300035113 | Ga0373936_0011822 | Ga0373936_0011822_334_1734 | 466 |
| 220 | 3300035115 | Ga0373941_0004341 | Ga0373941_0004341_1381_2781 | 466 |
| 221 | 3300035117 | Ga0373953_0008982 | Ga0373953_0008982_1164_2564 | 466 |
| 222 | 3300035118 | Ga0373954_0001664 | Ga0373954_0001664_358_1758 | 466 |
| 223 | 3300035118 | Ga0373954_0037497 | Ga0373954_0037497_645_2045 | 466 |
| 224 | 3300035119 | Ga0373956_0015521 | Ga0373956_0015521_216_1616 | 466 |
| 225 | 3300035170 | Ga0373943_0008581 | Ga0373943_0008581_2617_4017 | 466 |
| 226 | 3300035171 | Ga0373946_0003393 | Ga0373946_0003393_3169_4569 | 466 |
| 227 | 3300035172 | Ga0373955_0008697 | Ga0373955_0008697_3287_4687 | 466 |
| 228 | 3300035410 | Ga0373924_0002329 | Ga0373924_0002329_4761_6161 | 466 |
| 229 | 3300035692 | Ga0373935_0000185 | Ga0373935_0000185_17450_18850 | 466 |
| 230 | 3300035695 | Ga0373927_0019298 | Ga0373927_0019298_594_1994 | 466 |
| 231 | 3300035724 | Ga0373933_0037195 | Ga0373933_0037195_1082_2482 | 466 |
| 232 | 3300035725 | Ga0373947_0011703 | Ga0373947_0011703_179_1579 | 466 |
| 233 | 3300036401 | Ga0373937_0000068 | Ga0373937_0000068_72923_74323 | 466 |
| 234 | 3300037068 | Ga0373925_0000913 | Ga0373925_0000913_20627_22027 | 466 |
| 235 | 3300037068 | Ga0373925_0025581 | Ga0373925_0025581_176_1576 | 466 |
| 236 | 3300046452 | Ga0495617_004301 | Ga0495617_004301_2455_3855 | 466 |
| 237 | 3300046454 | Ga0495592_0000488 | Ga0495592_0000488_7918_9318 | 466 |
| 238 | 3300046455 | Ga0495603_0023619 | Ga0495603_0023619_1352_2752 | 466 |
| 239 | 3300046460 | Ga0495638_0032117 | Ga0495638_0032117_125_1525 | 466 |
| 240 | 3300046462 | Ga0495651_0002415 | Ga0495651_0002415_34_1434 | 466 |
| 241 | 3300046463 | Ga0495653_0000199 | Ga0495653_0000199_9590_10990 | 466 |
| 242 | 3300046474 | Ga0495605_0059715 | Ga0495605_0059715_44_1444 | 466 |
| 243 | 3300046475 | Ga0495639_0010278 | Ga0495639_0010278_1082_2482 | 466 |
| 244 | 3300046476 | Ga0495662_0002942 | Ga0495662_0002942_4674_6074 | 466 |
| 245 | 3300046477 | Ga0495664_0000105 | Ga0495664_0000105_19822_21222 | 466 |
| 246 | 3300046477 | Ga0495664_0014203 | Ga0495664_0014203_2390_3790 | 466 |
| 247 | 3300046499 | Ga0495594_0036774 | Ga0495594_0036774_1174_2574 | 466 |
| 248 | 3300046511 | Ga0495608_0000020 | Ga0495608_0000020_19557_20957 | 466 |
| 249 | 3300046514 | Ga0495618_0000225 | Ga0495618_0000225_1217_2617 | 466 |
| 250 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_72753_74153 | 466 |
| 251 | 3300046516 | Ga0495628_0090506 | Ga0495628_0090506_33_1433 | 466 |
| 252 | 3300046517 | Ga0495630_0005536 | Ga0495630_0005536_1147_2547 | 466 |
| 253 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_1004991_1006391 | 466 |
| 254 | 3300046531 | Ga0495665_0017692 | Ga0495665_0017692_726_2126 | 466 |
| 255 | 3300046533 | Ga0495640_0000027 | Ga0495640_0000027_69495_70895 | 466 |
| 256 | 3300046536 | Ga0495587_0000017 | Ga0495587_0000017_21948_23348 | 466 |
| 257 | 3300046538 | Ga0495609_0034479 | Ga0495609_0034479_334_1734 | 466 |
| 258 | 3300046543 | Ga0495645_0000212 | Ga0495645_0000212_20617_22017 | 466 |
| 259 | 3300046559 | Ga0495667_0000031 | Ga0495667_0000031_125330_126730 | 466 |
| 260 | 3300046559 | Ga0495667_0080327 | Ga0495667_0080327_606_2006 | 466 |
| 261 | 3300046615 | Ga0495656_0059117 | Ga0495656_0059117_226_1626 | 466 |
| 262 | 3300046616 | Ga0495668_0018111 | Ga0495668_0018111_1542_2942 | 466 |
| 263 | 3300046642 | Ga0495634_0000006 | Ga0495634_0000006_132783_134183 | 466 |
| 264 | 3300046642 | Ga0495634_0022747 | Ga0495634_0022747_103_1503 | 466 |
| 265 | 3300046648 | Ga0495611_0030654 | Ga0495611_0030654_60_1460 | 466 |
| 266 | 3300046663 | Ga0495635_0000154 | Ga0495635_0000154_19829_21229 | 466 |
| 267 | 3300046663 | Ga0495635_0055138 | Ga0495635_0055138_328_1728 | 466 |
| 268 | 3300046675 | Ga0495657_0000828 | Ga0495657_0000828_19697_21097 | 466 |
| 269 | 3300046678 | Ga0495599_0000051 | Ga0495599_0000051_19741_21141 | 466 |
| 270 | 3300046679 | Ga0495623_0001373 | Ga0495623_0001373_13818_15218 | 466 |
| 271 | 3300046680 | Ga0495646_0000102 | Ga0495646_0000102_19760_21160 | 466 |
| 272 | 3300046684 | Ga0495669_0003877 | Ga0495669_0003877_4723_6123 | 466 |
| 273 | 3300046689 | Ga0495613_0008152 | Ga0495613_0008152_5809_7209 | 466 |
| 274 | 3300046690 | Ga0495624_0017557 | Ga0495624_0017557_3201_4601 | 466 |
| 275 | 3300046809 | Ga0495600_0000069 | Ga0495600_0000069_37443_38843 | 466 |
| 276 | 3300047315 | Ga0495581_0015179 | Ga0495581_0015179_863_2263 | 466 |
| 277 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_372125_373525 | 466 |
| 278 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_20657_22057 | 466 |
| 279 | 3300047319 | Ga0495674_0059656 | Ga0495674_0059656_158_1558 | 466 |
| 280 | 3300047322 | Ga0495680_0000216 | Ga0495680_0000216_60703_62103 | 466 |
| 281 | 3300047444 | Ga0495675_0000216 | Ga0495675_0000216_19697_21097 | 466 |
| 282 | 3300047471 | Ga0495684_0000009 | Ga0495684_0000009_38642_40042 | 466 |
| 283 | 3300047471 | Ga0495684_0003057 | Ga0495684_0003057_7761_9161 | 466 |
| 284 | 3300047673 | Ga0495593_0005967 | Ga0495593_0005967_5673_7073 | 466 |
| 285 | 3300047673 | Ga0495593_0012056 | Ga0495593_0012056_1730_3130 | 466 |
| 286 | 3300048088 | Ga0495602_0000373 | Ga0495602_0000373_19751_21151 | 466 |
| 287 | 3300048924 | Ga0496121_0003089 | Ga0496121_0003089_10742_12142 | 466 |
| 288 | 3300049569 | Ga0501032_0008293 | Ga0501032_0008293_45_1445 | 466 |
| 289 | 3300049569 | Ga0501032_0019777 | Ga0501032_0019777_3010_4422 | 466 |
| 290 | 3300049570 | Ga0501033_0049039 | Ga0501033_0049039_606_2018 | 466 |
| 291 | 3300049571 | Ga0501034_0000197 | Ga0501034_0000197_57383_58783 | 466 |
| 292 | 3300049571 | Ga0501034_0003303 | Ga0501034_0003303_8200_9600 | 466 |
| 293 | 3300049571 | Ga0501034_0031012 | Ga0501034_0031012_3596_4996 | 466 |
| 294 | 3300049571 | Ga0501034_0087578 | Ga0501034_0087578_77_1477 | 466 |
| 295 | 3300049571 | Ga0501034_0101010 | Ga0501034_0101010_697_2109 | 466 |
| 296 | 3300049571 | Ga0501034_0161491 | Ga0501034_0161491_767_2167 | 466 |
| 297 | 3300049572 | Ga0501036_0001894 | Ga0501036_0001894_9854_11254 | 466 |
| 298 | 3300049572 | Ga0501036_0051873 | Ga0501036_0051873_1332_2744 | 466 |
| 299 | 3300049572 | Ga0501036_0156118 | Ga0501036_0156118_233_1636 | 466 |
| 300 | 3300049573 | Ga0501037_0044025 | Ga0501037_0044025_1739_3139 | 466 |
| 301 | 3300049574 | Ga0501038_0022795 | Ga0501038_0022795_3109_4509 | 466 |
| 302 | 3300049574 | Ga0501038_0052938 | Ga0501038_0052938_60_1472 | 466 |
| 303 | 3300049574 | Ga0501038_0070121 | Ga0501038_0070121_269_1672 | 466 |
| 304 | 3300049574 | Ga0501038_0209242 | Ga0501038_0209242_61_1461 | 466 |
| 305 | 3300049575 | Ga0501039_0034296 | Ga0501039_0034296_425_1837 | 466 |
| 306 | 3300049575 | Ga0501039_0044517 | Ga0501039_0044517_1964_3364 | 466 |
| 307 | 3300049579 | Ga0501043_0003514 | Ga0501043_0003514_4697_6097 | 466 |
| 308 | 3300049579 | Ga0501043_0050714 | Ga0501043_0050714_1118_2530 | 466 |
| 309 | 3300049580 | Ga0501046_0027889 | Ga0501046_0027889_1953_3353 | 466 |
| 310 | 3300049580 | Ga0501046_0047163 | Ga0501046_0047163_839_2251 | 466 |
| 311 | 3300049581 | Ga0501047_0000688 | Ga0501047_0000688_22814_24214 | 466 |
| 312 | 3300049581 | Ga0501047_0003823 | Ga0501047_0003823_3989_5389 | 466 |
| 313 | 3300049581 | Ga0501047_0100572 | Ga0501047_0100572_808_2220 | 466 |
| 314 | 3300049581 | Ga0501047_0130238 | Ga0501047_0130238_607_2007 | 466 |
| 315 | 3300049582 | Ga0501048_0002575 | Ga0501048_0002575_4486_5886 | 466 |
| 316 | 3300049582 | Ga0501048_0077651 | Ga0501048_0077651_513_1925 | 466 |
| 317 | 3300049584 | Ga0501068_0036118 | Ga0501068_0036118_744_2156 | 466 |
| 318 | 3300049585 | Ga0501069_0014126 | Ga0501069_0014126_2752_4164 | 466 |
| 319 | 3300049586 | Ga0501070_0006200 | Ga0501070_0006200_6472_7884 | 466 |
| 320 | 3300049586 | Ga0501070_0020220 | Ga0501070_0020220_2608_4008 | 466 |
| 321 | 3300049586 | Ga0501070_0046667 | Ga0501070_0046667_1137_2540 | 466 |
| 322 | 3300049587 | Ga0501071_0025123 | Ga0501071_0025123_1602_3014 | 466 |
| 323 | 3300049588 | Ga0501072_0058455 | Ga0501072_0058455_299_1711 | 466 |
| 324 | 3300049589 | Ga0501073_0031621 | Ga0501073_0031621_1308_2708 | 466 |
| 325 | 3300049589 | Ga0501073_0043244 | Ga0501073_0043244_599_2011 | 466 |
| 326 | 3300049589 | Ga0501073_0048730 | Ga0501073_0048730_461_1861 | 466 |
| 327 | 3300049590 | Ga0501074_0040108 | Ga0501074_0040108_1850_3250 | 466 |
| 328 | 3300049742 | Ga0501080_0000153 | Ga0501080_0000153_37844_39244 | 466 |
| 329 | 3300049744 | Ga0501083_0003065 | Ga0501083_0003065_1040_2440 | 466 |
| 330 | 3300049744 | Ga0501083_0074383 | Ga0501083_0074383_653_2053 | 466 |
| 331 | 3300049744 | Ga0501083_0081607 | Ga0501083_0081607_319_1731 | 466 |
| 332 | 3300049822 | Ga0501035_0066183 | Ga0501035_0066183_1016_2428 | 466 |
| 333 | 3300049822 | Ga0501035_0103055 | Ga0501035_0103055_827_2227 | 466 |
| 334 | 3300049822 | Ga0501035_0172862 | Ga0501035_0172862_347_1747 | 466 |
| 335 | 3300049823 | Ga0501044_0007955 | Ga0501044_0007955_1005_2405 | 466 |
| 336 | 3300049823 | Ga0501044_0030717 | Ga0501044_0030717_346_1749 | 466 |
| 337 | 3300049823 | Ga0501044_0057298 | Ga0501044_0057298_1855_3267 | 466 |
| 338 | 3300053077 | Ga0495601_0000020 | Ga0495601_0000020_137968_139368 | 466 |
| 339 | 3300053078 | Ga0495612_0000030 | Ga0495612_0000030_60720_62120 | 466 |
| 340 | 3300053084 | Ga0495595_0000125 | Ga0495595_0000125_11871_13271 | 466 |
| 341 | 3300053085 | Ga0495619_0000216 | Ga0495619_0000216_20666_22066 | 466 |
| 342 | 3300053096 | Ga0500641_0004097 | Ga0500641_0004097_2376_3776 | 466 |
| 343 | 3300053096 | Ga0500641_0041519 | Ga0500641_0041519_402_1802 | 466 |
| 344 | 3300060353 | Ga0501082_0157164 | Ga0501082_0157164_394_1794 | 466 |
| 345 | 3300005343 | Ga0070687_100034617 | Ga0070687_1000346171 | 468 |
| 346 | 3300005354 | Ga0070675_100008544 | Ga0070675_1000085444 | 468 |
| 347 | 3300009551 | Ga0105238_10030898 | Ga0105238_100308982 | 468 |
| 348 | 3300026116 | Ga0207674_10058980 | Ga0207674_100589802 | 468 |
| 349 | 3300048916 | Ga0496113_0039473 | Ga0496113_0039473_1275_2681 | 468 |
| 350 | 2209111006 | 2214797992 | 2213826281 | 469 |
| 351 | 3300000044 | ARSoilOldRDRAFT_c000230 | ARSoilOldRDRAFT_0002302 | 469 |
| 352 | 3300000652 | ARCol0yngRDRAFT_1000425 | ARCol0yngRDRAFT_10004254 | 469 |
| 353 | 3300001989 | JGI24739J22299_10037514 | JGI24739J22299_100375142 | 469 |
| 354 | 3300001990 | JGI24737J22298_10002225 | JGI24737J22298_100022254 | 469 |
| 355 | 3300002073 | JGI24745J21846_1000036 | JGI24745J21846_10000365 | 469 |
| 356 | 3300002075 | JGI24738J21930_10002861 | JGI24738J21930_100028612 | 469 |
| 357 | 3300002077 | JGI24744J21845_10001136 | JGI24744J21845_100011364 | 469 |
| 358 | 3300002244 | JGI24742J22300_10000210 | JGI24742J22300_100002105 | 469 |
| 359 | 3300002459 | JGI24751J29686_10012561 | JGI24751J29686_100125611 | 469 |
| 360 | 3300005290 | Ga0065712_10001033 | Ga0065712_100010334 | 469 |
| 361 | 3300005293 | Ga0065715_10000973 | Ga0065715_100009733 | 469 |
| 362 | 3300005293 | Ga0065715_10095332 | Ga0065715_100953323 | 469 |
| 363 | 3300005328 | Ga0070676_10000499 | Ga0070676_1000049910 | 469 |
| 364 | 3300005329 | Ga0070683_100000265 | Ga0070683_10000026517 | 469 |
| 365 | 3300005330 | Ga0070690_100000718 | Ga0070690_1000007186 | 469 |
| 366 | 3300005330 | Ga0070690_100064430 | Ga0070690_1000644302 | 469 |
| 367 | 3300005333 | Ga0070677_10001854 | Ga0070677_100018545 | 469 |
| 368 | 3300005334 | Ga0068869_100000414 | Ga0068869_1000004143 | 469 |
| 369 | 3300005335 | Ga0070666_10020803 | Ga0070666_100208033 | 469 |
| 370 | 3300005336 | Ga0070680_100001359 | Ga0070680_1000013597 | 469 |
| 371 | 3300005337 | Ga0070682_100000745 | Ga0070682_10000074510 | 469 |
| 372 | 3300005338 | Ga0068868_100008743 | Ga0068868_1000087433 | 469 |
| 373 | 3300005339 | Ga0070660_100000136 | Ga0070660_10000013635 | 469 |
| 374 | 3300005340 | Ga0070689_100000722 | Ga0070689_10000072210 | 469 |
| 375 | 3300005341 | Ga0070691_10000148 | Ga0070691_1000014810 | 469 |
| 376 | 3300005343 | Ga0070687_100000080 | Ga0070687_10000008010 | 469 |
| 377 | 3300005344 | Ga0070661_100000425 | Ga0070661_1000004258 | 469 |
| 378 | 3300005345 | Ga0070692_10000893 | Ga0070692_100008939 | 469 |
| 379 | 3300005347 | Ga0070668_100005857 | Ga0070668_1000058574 | 469 |
| 380 | 3300005353 | Ga0070669_100000276 | Ga0070669_10000027617 | 469 |
| 381 | 3300005353 | Ga0070669_100002660 | Ga0070669_1000026605 | 469 |
| 382 | 3300005354 | Ga0070675_100000271 | Ga0070675_10000027110 | 469 |
| 383 | 3300005355 | Ga0070671_100000389 | Ga0070671_10000038910 | 469 |
| 384 | 3300005355 | Ga0070671_100012096 | Ga0070671_1000120964 | 469 |
| 385 | 3300005356 | Ga0070674_100000928 | Ga0070674_10000092810 | 469 |
| 386 | 3300005364 | Ga0070673_100001722 | Ga0070673_1000017224 | 469 |
| 387 | 3300005365 | Ga0070688_100001089 | Ga0070688_1000010893 | 469 |
| 388 | 3300005366 | Ga0070659_100008795 | Ga0070659_1000087955 | 469 |
| 389 | 3300005367 | Ga0070667_100001569 | Ga0070667_10000156910 | 469 |
| 390 | 3300005406 | Ga0070703_10004879 | Ga0070703_100048793 | 469 |
| 391 | 3300005438 | Ga0070701_10000457 | Ga0070701_100004574 | 469 |
| 392 | 3300005440 | Ga0070705_100000579 | Ga0070705_1000005799 | 469 |
| 393 | 3300005441 | Ga0070700_100000515 | Ga0070700_1000005158 | 469 |
| 394 | 3300005444 | Ga0070694_100001641 | Ga0070694_1000016413 | 469 |
| 395 | 3300005445 | Ga0070708_100027296 | Ga0070708_1000272962 | 469 |
| 396 | 3300005455 | Ga0070663_100000580 | Ga0070663_10000058010 | 469 |
| 397 | 3300005456 | Ga0070678_100000016 | Ga0070678_10000001616 | 469 |
| 398 | 3300005457 | Ga0070662_100001325 | Ga0070662_10000132510 | 469 |
| 399 | 3300005458 | Ga0070681_10001764 | Ga0070681_1000176410 | 469 |
| 400 | 3300005459 | Ga0068867_100002288 | Ga0068867_10000228810 | 469 |
| 401 | 3300005466 | Ga0070685_10000344 | Ga0070685_1000034419 | 469 |
| 402 | 3300005466 | Ga0070685_10059463 | Ga0070685_100594631 | 469 |
| 403 | 3300005530 | Ga0070679_100001267 | Ga0070679_10000126710 | 469 |
| 404 | 3300005535 | Ga0070684_100002476 | Ga0070684_10000247610 | 469 |
| 405 | 3300005539 | Ga0068853_100001111 | Ga0068853_10000111111 | 469 |
| 406 | 3300005539 | Ga0068853_100021373 | Ga0068853_1000213731 | 469 |
| 407 | 3300005543 | Ga0070672_100000233 | Ga0070672_10000023310 | 469 |
| 408 | 3300005543 | Ga0070672_100018746 | Ga0070672_1000187463 | 469 |
| 409 | 3300005544 | Ga0070686_100000699 | Ga0070686_1000006998 | 469 |
| 410 | 3300005545 | Ga0070695_100001478 | Ga0070695_10000147810 | 469 |
| 411 | 3300005546 | Ga0070696_100001198 | Ga0070696_1000011987 | 469 |
| 412 | 3300005547 | Ga0070693_100000594 | Ga0070693_1000005948 | 469 |
| 413 | 3300005548 | Ga0070665_100176101 | Ga0070665_1001761012 | 469 |
| 414 | 3300005549 | Ga0070704_100000112 | Ga0070704_10000011217 | 469 |
| 415 | 3300005549 | Ga0070704_100001736 | Ga0070704_1000017368 | 469 |
| 416 | 3300005563 | Ga0068855_100007243 | Ga0068855_1000072434 | 469 |
| 417 | 3300005564 | Ga0070664_100191044 | Ga0070664_1001910441 | 469 |
| 418 | 3300005577 | Ga0068857_100000371 | Ga0068857_10000037126 | 469 |
| 419 | 3300005578 | Ga0068854_100000735 | Ga0068854_10000073510 | 469 |
| 420 | 3300005614 | Ga0068856_100000520 | Ga0068856_10000052034 | 469 |
| 421 | 3300005615 | Ga0070702_100000122 | Ga0070702_1000001223 | 469 |
| 422 | 3300005617 | Ga0068859_100019554 | Ga0068859_1000195544 | 469 |
| 423 | 3300005618 | Ga0068864_100000333 | Ga0068864_10000033329 | 469 |
| 424 | 3300005719 | Ga0068861_100000417 | Ga0068861_10000041710 | 469 |
| 425 | 3300005840 | Ga0068870_10000113 | Ga0068870_1000011314 | 469 |
| 426 | 3300005841 | Ga0068863_100004693 | Ga0068863_10000469310 | 469 |
| 427 | 3300005842 | Ga0068858_100000975 | Ga0068858_10000097518 | 469 |
| 428 | 3300005843 | Ga0068860_100001740 | Ga0068860_1000017404 | 469 |
| 429 | 3300005937 | Ga0081455_10000110 | Ga0081455_1000011048 | 469 |
| 430 | 3300005937 | Ga0081455_10007679 | Ga0081455_100076795 | 469 |
| 431 | 3300006058 | Ga0075432_10040263 | Ga0075432_100402631 | 469 |
| 432 | 3300006237 | Ga0097621_100000203 | Ga0097621_1000002038 | 469 |
| 433 | 3300006358 | Ga0068871_100000575 | Ga0068871_1000005755 | 469 |
| 434 | 3300006358 | Ga0068871_100192678 | Ga0068871_1001926781 | 469 |
| 435 | 3300006881 | Ga0068865_100000654 | Ga0068865_10000065410 | 469 |
| 436 | 3300006931 | Ga0097620_100019554 | Ga0097620_1000195543 | 469 |
| 437 | 3300009093 | Ga0105240_10246481 | Ga0105240_102464812 | 469 |
| 438 | 3300009094 | Ga0111539_10000581 | Ga0111539_1000058110 | 469 |
| 439 | 3300009094 | Ga0111539_10004022 | Ga0111539_1000402210 | 469 |
| 440 | 3300009098 | Ga0105245_10000230 | Ga0105245_1000023033 | 469 |
| 441 | 3300009098 | Ga0105245_10022871 | Ga0105245_100228713 | 469 |
| 442 | 3300009101 | Ga0105247_10009917 | Ga0105247_100099173 | 469 |
| 443 | 3300009148 | Ga0105243_10002755 | Ga0105243_100027558 | 469 |
| 444 | 3300009148 | Ga0105243_10021104 | Ga0105243_100211043 | 469 |
| 445 | 3300009174 | Ga0105241_10001308 | Ga0105241_100013088 | 469 |
| 446 | 3300009176 | Ga0105242_10000696 | Ga0105242_1000069616 | 469 |
| 447 | 3300009177 | Ga0105248_10001593 | Ga0105248_1000159316 | 469 |
| 448 | 3300009545 | Ga0105237_10113575 | Ga0105237_101135752 | 469 |
| 449 | 3300009553 | Ga0105249_10001642 | Ga0105249_1000164210 | 469 |
| 450 | 3300010375 | Ga0105239_10009048 | Ga0105239_100090484 | 469 |
| 451 | 3300011119 | Ga0105246_10000550 | Ga0105246_100005509 | 469 |
| 452 | 3300011119 | Ga0105246_10122940 | Ga0105246_101229402 | 469 |
| 453 | 3300013100 | Ga0157373_10011542 | Ga0157373_100115424 | 469 |
| 454 | 3300013102 | Ga0157371_10029473 | Ga0157371_100294732 | 469 |
| 455 | 3300013104 | Ga0157370_10062178 | Ga0157370_100621781 | 469 |
| 456 | 3300013296 | Ga0157374_10002125 | Ga0157374_100021252 | 469 |
| 457 | 3300013297 | Ga0157378_10000864 | Ga0157378_100008649 | 469 |
| 458 | 3300013297 | Ga0157378_10181280 | Ga0157378_101812801 | 469 |
| 459 | 3300013306 | Ga0163162_10000420 | Ga0163162_100004208 | 469 |
| 460 | 3300013306 | Ga0163162_10016129 | Ga0163162_100161293 | 469 |
| 461 | 3300013308 | Ga0157375_10001626 | Ga0157375_100016268 | 469 |
| 462 | 3300013308 | Ga0157375_10061566 | Ga0157375_100615661 | 469 |
| 463 | 3300014325 | Ga0163163_10081470 | Ga0163163_100814703 | 469 |
| 464 | 3300014326 | Ga0157380_10000511 | Ga0157380_1000051111 | 469 |
| 465 | 3300014745 | Ga0157377_10000053 | Ga0157377_1000005358 | 469 |
| 466 | 3300014968 | Ga0157379_10001333 | Ga0157379_1000133310 | 469 |
| 467 | 3300014969 | Ga0157376_10000436 | Ga0157376_1000043613 | 469 |
| 468 | 3300017792 | Ga0163161_10000555 | Ga0163161_1000055527 | 469 |
| 469 | 3300025271 | Ga0207666_1000014 | Ga0207666_10000143 | 469 |
| 470 | 3300025315 | Ga0207697_10000672 | Ga0207697_100006729 | 469 |
| 471 | 3300025885 | Ga0207653_10007649 | Ga0207653_100076493 | 469 |
| 472 | 3300025893 | Ga0207682_10000154 | Ga0207682_1000015426 | 469 |
| 473 | 3300025900 | Ga0207710_10001145 | Ga0207710_100011458 | 469 |
| 474 | 3300025901 | Ga0207688_10001479 | Ga0207688_1000147910 | 469 |
| 475 | 3300025903 | Ga0207680_10022307 | Ga0207680_100223073 | 469 |
| 476 | 3300025907 | Ga0207645_10000182 | Ga0207645_1000018241 | 469 |
| 477 | 3300025908 | Ga0207643_10000405 | Ga0207643_1000040512 | 469 |
| 478 | 3300025911 | Ga0207654_10008238 | Ga0207654_100082382 | 469 |
| 479 | 3300025912 | Ga0207707_10001762 | Ga0207707_1000176211 | 469 |
| 480 | 3300025913 | Ga0207695_10162560 | Ga0207695_101625602 | 469 |
| 481 | 3300025917 | Ga0207660_10000007 | Ga0207660_1000000733 | 469 |
| 482 | 3300025918 | Ga0207662_10000913 | Ga0207662_100009133 | 469 |
| 483 | 3300025918 | Ga0207662_10041211 | Ga0207662_100412112 | 469 |
| 484 | 3300025919 | Ga0207657_10005343 | Ga0207657_1000534310 | 469 |
| 485 | 3300025920 | Ga0207649_10000143 | Ga0207649_100001432 | 469 |
| 486 | 3300025920 | Ga0207649_10081042 | Ga0207649_100810422 | 469 |
| 487 | 3300025921 | Ga0207652_10000459 | Ga0207652_1000045932 | 469 |
| 488 | 3300025921 | Ga0207652_10143839 | Ga0207652_101438392 | 469 |
| 489 | 3300025923 | Ga0207681_10000506 | Ga0207681_100005062 | 469 |
| 490 | 3300025926 | Ga0207659_10000015 | Ga0207659_10000015134 | 469 |
| 491 | 3300025927 | Ga0207687_10000357 | Ga0207687_1000035711 | 469 |
| 492 | 3300025931 | Ga0207644_10000251 | Ga0207644_1000025134 | 469 |
| 493 | 3300025933 | Ga0207706_10002583 | Ga0207706_1000258310 | 469 |
| 494 | 3300025934 | Ga0207686_10000234 | Ga0207686_1000023415 | 469 |
| 495 | 3300025935 | Ga0207709_10000081 | Ga0207709_10000081121 | 469 |
| 496 | 3300025936 | Ga0207670_10000620 | Ga0207670_100006208 | 469 |
| 497 | 3300025936 | Ga0207670_10018819 | Ga0207670_100188194 | 469 |
| 498 | 3300025937 | Ga0207669_10000008 | Ga0207669_1000000828 | 469 |
| 499 | 3300025938 | Ga0207704_10002142 | Ga0207704_100021425 | 469 |
| 500 | 3300025940 | Ga0207691_10002588 | Ga0207691_100025888 | 469 |
| 501 | 3300025941 | Ga0207711_10001662 | Ga0207711_1000166216 | 469 |
| 502 | 3300025942 | Ga0207689_10000749 | Ga0207689_1000074916 | 469 |
| 503 | 3300025944 | Ga0207661_10000170 | Ga0207661_1000017036 | 469 |
| 504 | 3300025945 | Ga0207679_10000046 | Ga0207679_1000004680 | 469 |
| 505 | 3300025949 | Ga0207667_10010820 | Ga0207667_100108205 | 469 |
| 506 | 3300025960 | Ga0207651_10000200 | Ga0207651_1000020018 | 469 |
| 507 | 3300025961 | Ga0207712_10000555 | Ga0207712_100005553 | 469 |
| 508 | 3300025961 | Ga0207712_10011089 | Ga0207712_100110893 | 469 |
| 509 | 3300025972 | Ga0207668_10000133 | Ga0207668_1000013333 | 469 |
| 510 | 3300025981 | Ga0207640_10000191 | Ga0207640_1000019137 | 469 |
| 511 | 3300025986 | Ga0207658_10000535 | Ga0207658_1000053524 | 469 |
| 512 | 3300025986 | Ga0207658_10131348 | Ga0207658_101313482 | 469 |
| 513 | 3300026023 | Ga0207677_10001779 | Ga0207677_100017792 | 469 |
| 514 | 3300026035 | Ga0207703_10003074 | Ga0207703_100030749 | 469 |
| 515 | 3300026041 | Ga0207639_10001004 | Ga0207639_100010042 | 469 |
| 516 | 3300026067 | Ga0207678_10001859 | Ga0207678_100018598 | 469 |
| 517 | 3300026067 | Ga0207678_10042909 | Ga0207678_100429093 | 469 |
| 518 | 3300026075 | Ga0207708_10002476 | Ga0207708_1000247610 | 469 |
| 519 | 3300026075 | Ga0207708_10002480 | Ga0207708_1000248010 | 469 |
| 520 | 3300026078 | Ga0207702_10003065 | Ga0207702_1000306510 | 469 |
| 521 | 3300026088 | Ga0207641_10000593 | Ga0207641_1000059317 | 469 |
| 522 | 3300026089 | Ga0207648_10002417 | Ga0207648_100024179 | 469 |
| 523 | 3300026095 | Ga0207676_10002520 | Ga0207676_1000252010 | 469 |
| 524 | 3300026116 | Ga0207674_10003381 | Ga0207674_100033819 | 469 |
| 525 | 3300026118 | Ga0207675_100002182 | Ga0207675_10000218210 | 469 |
| 526 | 3300026118 | Ga0207675_100050415 | Ga0207675_1000504153 | 469 |
| 527 | 3300026121 | Ga0207683_10000002 | Ga0207683_10000002256 | 469 |
| 528 | 3300026142 | Ga0207698_10000545 | Ga0207698_1000054514 | 469 |
| 529 | 3300027617 | Ga0210002_1003424 | Ga0210002_10034242 | 469 |
| 530 | 3300027717 | Ga0209998_10001951 | Ga0209998_100019512 | 469 |
| 531 | 3300027876 | Ga0209974_10000944 | Ga0209974_100009448 | 469 |
| 532 | 3300027907 | Ga0207428_10000011 | Ga0207428_1000001146 | 469 |
| 533 | 3300027907 | Ga0207428_10000046 | Ga0207428_10000046135 | 469 |
| 534 | 3300027907 | Ga0207428_10001276 | Ga0207428_1000127613 | 469 |
| 535 | 3300028380 | Ga0268265_10011194 | Ga0268265_100111942 | 469 |
| 536 | 3300028381 | Ga0268264_10000340 | Ga0268264_100003404 | 469 |
| 537 | 3300034817 | Ga0373948_0000050 | Ga0373948_0000050_9496_10905 | 469 |
| 538 | 3300034818 | Ga0373950_0000879 | Ga0373950_0000879_1538_2947 | 469 |
| 539 | 3300034819 | Ga0373958_0000097 | Ga0373958_0000097_7158_8567 | 469 |
| 540 | 3300034819 | Ga0373958_0001146 | Ga0373958_0001146_713_2122 | 469 |
| 541 | 3300034820 | Ga0373959_0000255 | Ga0373959_0000255_1836_3245 | 469 |
| 542 | 3300034957 | Ga0373938_0000032 | Ga0373938_0000032_8069_9478 | 469 |
| 543 | 3300034957 | Ga0373938_0002417 | Ga0373938_0002417_1367_2776 | 469 |
| 544 | 3300035084 | Ga0373928_0000973 | Ga0373928_0000973_2692_4101 | 469 |
| 545 | 3300035085 | Ga0373929_0001646 | Ga0373929_0001646_2553_3962 | 469 |
| 546 | 3300035088 | Ga0373940_0000828 | Ga0373940_0000828_464_1873 | 469 |
| 547 | 3300035090 | Ga0373949_0001084 | Ga0373949_0001084_5281_6690 | 469 |
| 548 | 3300035091 | Ga0373951_0000472 | Ga0373951_0000472_2937_4346 | 469 |
| 549 | 3300035092 | Ga0373952_0000189 | Ga0373952_0000189_5892_7301 | 469 |
| 550 | 3300035092 | Ga0373952_0003514 | Ga0373952_0003514_1089_2498 | 469 |
| 551 | 3300035111 | Ga0373923_0028891 | Ga0373923_0028891_259_1668 | 469 |
| 552 | 3300035112 | Ga0373932_0000180 | Ga0373932_0000180_7944_9353 | 469 |
| 553 | 3300035112 | Ga0373932_0003067 | Ga0373932_0003067_1612_3021 | 469 |
| 554 | 3300035114 | Ga0373939_0000151 | Ga0373939_0000151_9855_11264 | 469 |
| 555 | 3300035115 | Ga0373941_0001114 | Ga0373941_0001114_3070_4479 | 469 |
| 556 | 3300035116 | Ga0373945_0032196 | Ga0373945_0032196_276_1685 | 469 |
| 557 | 3300035118 | Ga0373954_0015167 | Ga0373954_0015167_908_2317 | 469 |
| 558 | 3300035121 | Ga0373960_0000156 | Ga0373960_0000156_456_1865 | 469 |
| 559 | 3300035121 | Ga0373960_0000184 | Ga0373960_0000184_3128_4537 | 469 |
| 560 | 3300035172 | Ga0373955_0008032 | Ga0373955_0008032_3268_4677 | 469 |
| 561 | 3300035207 | Ga0373942_0000457 | Ga0373942_0000457_1554_2963 | 469 |
| 562 | 3300035241 | Ga0373961_0002408 | Ga0373961_0002408_267_1676 | 469 |
| 563 | 3300035242 | Ga0373962_0000113 | Ga0373962_0000113_8268_9677 | 469 |
| 564 | 3300035242 | Ga0373962_0000251 | Ga0373962_0000251_2345_3754 | 469 |
| 565 | 3300035410 | Ga0373924_0003763 | Ga0373924_0003763_1173_2582 | 469 |
| 566 | 3300035691 | Ga0373931_0000290 | Ga0373931_0000290_9743_11152 | 469 |
| 567 | 3300036401 | Ga0373937_0037814 | Ga0373937_0037814_1492_2901 | 469 |
| 568 | 3300044712 | Ga0453684_0113196 | Ga0453684_0113196_1624_3033 | 469 |
| 569 | 3300045051 | Ga0451576_0027624 | Ga0451576_0027624_2951_4360 | 469 |
| 570 | 3300046455 | Ga0495603_0037648 | Ga0495603_0037648_1465_2874 | 469 |
| 571 | 3300046462 | Ga0495651_0001053 | Ga0495651_0001053_15464_16873 | 469 |
| 572 | 3300046463 | Ga0495653_0006680 | Ga0495653_0006680_7417_8826 | 469 |
| 573 | 3300046511 | Ga0495608_0008586 | Ga0495608_0008586_3729_5138 | 469 |
| 574 | 3300046516 | Ga0495628_0020292 | Ga0495628_0020292_3340_4749 | 469 |
| 575 | 3300046536 | Ga0495587_0004533 | Ga0495587_0004533_5795_7204 | 469 |
| 576 | 3300046543 | Ga0495645_0024148 | Ga0495645_0024148_2019_3428 | 469 |
| 577 | 3300046559 | Ga0495667_0015229 | Ga0495667_0015229_2733_4142 | 469 |
| 578 | 3300046642 | Ga0495634_0115184 | Ga0495634_0115184_30_1439 | 469 |
| 579 | 3300046663 | Ga0495635_0008349 | Ga0495635_0008349_5290_6699 | 469 |
| 580 | 3300046663 | Ga0495635_0143797 | Ga0495635_0143797_174_1583 | 469 |
| 581 | 3300046675 | Ga0495657_0005789 | Ga0495657_0005789_49_1458 | 469 |
| 582 | 3300046678 | Ga0495599_0013640 | Ga0495599_0013640_934_2343 | 469 |
| 583 | 3300046679 | Ga0495623_0003197 | Ga0495623_0003197_7695_9104 | 469 |
| 584 | 3300046809 | Ga0495600_0010128 | Ga0495600_0010128_2746_4155 | 469 |
| 585 | 3300047319 | Ga0495674_0153002 | Ga0495674_0153002_102_1511 | 469 |
| 586 | 3300047322 | Ga0495680_0014111 | Ga0495680_0014111_1109_2518 | 469 |
| 587 | 3300047322 | Ga0495680_0103326 | Ga0495680_0103326_473_1882 | 469 |
| 588 | 3300047444 | Ga0495675_0005926 | Ga0495675_0005926_5991_7400 | 469 |
| 589 | 3300048088 | Ga0495602_0037977 | Ga0495602_0037977_2395_3804 | 469 |
| 590 | 3300048903 | Ga0496100_0000171 | Ga0496100_0000171_25594_27003 | 469 |
| 591 | 3300048904 | Ga0496101_0000246 | Ga0496101_0000246_11426_12835 | 469 |
| 592 | 3300048906 | Ga0496103_0000753 | Ga0496103_0000753_18346_19755 | 469 |
| 593 | 3300048906 | Ga0496103_0024347 | Ga0496103_0024347_1061_2470 | 469 |
| 594 | 3300048908 | Ga0496105_0036145 | Ga0496105_0036145_2332_3741 | 469 |
| 595 | 3300048909 | Ga0496106_0000183 | Ga0496106_0000183_20822_22231 | 469 |
| 596 | 3300048909 | Ga0496106_0026194 | Ga0496106_0026194_2756_4165 | 469 |
| 597 | 3300048910 | Ga0496107_0001430 | Ga0496107_0001430_4253_5662 | 469 |
| 598 | 3300048910 | Ga0496107_0024819 | Ga0496107_0024819_2025_3434 | 469 |
| 599 | 3300048911 | Ga0496108_0001856 | Ga0496108_0001856_15319_16728 | 469 |
| 600 | 3300048912 | Ga0496109_0004054 | Ga0496109_0004054_975_2384 | 469 |
| 601 | 3300048912 | Ga0496109_0186624 | Ga0496109_0186624_121_1530 | 469 |
| 602 | 3300048913 | Ga0496110_0007624 | Ga0496110_0007624_4069_5478 | 469 |
| 603 | 3300048913 | Ga0496110_0085718 | Ga0496110_0085718_1117_2526 | 469 |
| 604 | 3300048914 | Ga0496111_0036865 | Ga0496111_0036865_985_2394 | 469 |
| 605 | 3300048915 | Ga0496112_0247025 | Ga0496112_0247025_286_1695 | 469 |
| 606 | 3300048916 | Ga0496113_0017451 | Ga0496113_0017451_2472_3881 | 469 |
| 607 | 3300048917 | Ga0496114_0002224 | Ga0496114_0002224_4487_5896 | 469 |
| 608 | 3300048918 | Ga0496115_0020141 | Ga0496115_0020141_2623_4032 | 469 |
| 609 | 3300048918 | Ga0496115_0143410 | Ga0496115_0143410_531_1940 | 469 |
| 610 | 3300048918 | Ga0496115_0168462 | Ga0496115_0168462_372_1781 | 469 |
| 611 | 3300049593 | Ga0501077_0065796 | Ga0501077_0065796_720_2129 | 469 |
| 612 | 3300049741 | Ga0501079_0098241 | Ga0501079_0098241_117_1526 | 469 |
| 613 | 3300049744 | Ga0501083_0113885 | Ga0501083_0113885_125_1534 | 469 |
| 614 | 3300050511 | nmdc:mga08y16_9096_c1 | nmdc:mga08y16_9096_c1_6222_7631 | 469 |
| 615 | 3300050512 | nmdc:mga0n895_971_c1 | nmdc:mga0n895_971_c1_16627_18036 | 469 |
| 616 | 3300050515 | nmdc:mga0a205_1026_c1 | nmdc:mga0a205_1026_c1_2656_4065 | 469 |
| 617 | 3300053077 | Ga0495601_0005819 | Ga0495601_0005819_5051_6460 | 469 |
| 618 | 3300053078 | Ga0495612_0015054 | Ga0495612_0015054_1624_3033 | 469 |
| 619 | 3300053078 | Ga0495612_0029945 | Ga0495612_0029945_558_1967 | 469 |
| 620 | 3300053084 | Ga0495595_0001470 | Ga0495595_0001470_4074_5483 | 469 |
| 621 | 3300053085 | Ga0495619_0000151 | Ga0495619_0000151_38515_39924 | 469 |
| 622 | 3300053085 | Ga0495619_0022205 | Ga0495619_0022205_1626_3035 | 469 |
| 623 | 3300054114 | Ga0501084_0099209 | Ga0501084_0099209_883_2292 | 469 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j34-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. | 0.9755 | 9 | 42 |
| 5v96-assembly1.cif.gz_A | crystal structure of s-adenosyl-l-homocysteine hydrolase from naegleria fowleri with bound nad and adenosine | 0.9122 | 8 | 72 |
| 5tj9-assembly1.cif.gz_A | 2.6 angstrom crystal structure of s-adenosylhomocysteinase from cryptosporidium parvum in complex with aristeromycin and nad | 0.8858 | 7 | 76 |
| 2bra-assembly1.cif.gz_A | structure of n-terminal fad binding motif of mouse mical | 0.8774 | 5 | 39 |
| 5a5e-assembly1.cif.gz_A | crystal structure of murd ligase from escherichia coli | 0.8589 | 9 | 455 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WM81_180_403_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9324 | 10 | 37 | 3.50.50.60 |
| 3lk7A03 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain | 0.9109 | 325 | 458 | 3.90.190.20 |
| 2jaeB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9049 | 10 | 42 | 3.50.50.60 |
| 3lk7A02 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9025 | 113 | 317 | 3.40.1190.10 |
| af_Q2FZ92_312_442_3.90.190.20 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain | 0.9013 | 325 | 455 | 3.90.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529HNV6-F1-model_v4 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) | 0.9887 | 1 | 172 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0009058 GO:0051301 |
| AF-A0A659UZ91-F1-model_v4 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) | 0.9883 | 1 | 215 |
GO:0004326
GO:0005524 GO:0005737 GO:0008360 GO:0008764 GO:0051301 |
| AF-A0A3S2JPD5-F1-model_v4 | UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9) | 0.9878 | 56 | 469 |
GO:0004326
GO:0005524 GO:0005737 GO:0008360 GO:0008764 GO:0009252 GO:0051301 GO:0071555 |
| AF-A0A2W4KNT3-F1-model_v4 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) | 0.9873 | 1 | 115 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0051301 |
| AF-A0A3D2PIQ5-F1-model_v4 | deleted | 0.9869 | 1 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar