F470127

General Info

Members Datasets Scaffolds Average Seq Length
622 308 604 333

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0036821|Ga0466957_0036821_1442_2452
Length 327
Sequence MSDKPFPVMVTGGAGYIGSHAVLSLLDAGWPVVVVDNLATGFRWAVPDAATFVQGDVSDVALMTEVIREHGIGAILHFAGSLLVEESTKDPLKYYRNNTAASRSLIEAAVAGGAKHFVFSSTAATYGVPEAVPIPEGAPQRPINPYGRSKLMTEEILADAASVHPFNYCALRYFNVAGADPRGRSGQSTKGATHLIHIAAEAATGKRDYVNVFGTDYDTPDGSDLADAHVHALEHLIAHPQENLKLNCGYGHGYSVLQVLDTVDRVTNRHIERRLVGRRPGDPDALVADNRAILATLGWKPRYDDIGQIVSDALSWERTLRERGLSN

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
9 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
12 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
13 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
14 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
17 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
18 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
108 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
202 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
203 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
269 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
275 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
276 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
277 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
278 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
279 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
280 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
281 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
282 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
283 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
292 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
298 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
306 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
307 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 15.92
Nodule 0
Rhizoplane 1.45
Rhizosphere 72.83
Stem 0
Stem Tuber 0
Unclassified 9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000253 3300001976 Bacteria 7386
2 JGI24739J22299_10009020 3300001989 Bacteria 3722
3 JGI24737J22298_10000500 3300001990 Bacteria 13665
4 JGI24735J21928_10005685 3300002067 Bacteria 4123
5 JGI24735J21928_10006836 3300002067 Bacteria 3736
6 JGI24738J21930_10002202 3300002075 Bacteria 5184
7 JGI24738J21930_10002603 3300002075 Bacteria 4657
8 JGI24738J21930_10005891 3300002075 Bacteria 2911
9 JGI24744J21845_10003666 3300002077 Bacteria 3165
10 JGI24742J22300_10006413 3300002244 Bacteria 1944
11 JGI25151J46595_10016590 3300003187 Bacteria 3216
12 JGI25165J46597_1000024 3300003214 Bacteria 335150
13 JGI25165J46597_1000040 3300003214 Bacteria 277491
14 JGI25153J46596_10000027 3300003215 Bacteria 210760
15 Ga0055525_1000118 3300003759 Bacteria 120652
16 Ga0055542_1000076 3300003762 Bacteria 139662
17 Ga0055542_1004902 3300003762 Bacteria 3121
18 Ga0055529_1000004 3300003763 Bacteria 433331
19 Ga0055526_1001321 3300003771 Bacteria 17733
20 Ga0055537_1000482 3300003773 Bacteria 24718
21 Ga0055537_1003479 3300003773 Bacteria 4834
22 Ga0055524_1000165 3300003775 Bacteria 75996
23 Ga0055530_10000084 3300003791 Bacteria 80615
24 Ga0055530_10005398 3300003791 Bacteria 6106
25 Ga0055530_10009352 3300003791 Bacteria 3778
26 Ga0055540_1001052 3300003792 Bacteria 17586
27 Ga0055531_10000090 3300003794 Bacteria 100342
28 Ga0055531_10004100 3300003794 Bacteria 9010
29 Ga0055531_10044944 3300003794 Bacteria 1231
30 Ga0055531_10044946 3300003794 Bacteria 1231
31 Ga0065165_1010052 3300005262 Bacteria 4155
32 Ga0065165_1042206 3300005262 Bacteria 1348
33 Ga0065704_10087891 3300005289 Bacteria 2975
34 Ga0065704_10094426 3300005289 Bacteria 2544
35 Ga0065707_10082279 3300005295 Bacteria 17547
36 Ga0070658_10000022 3300005327 Bacteria 186706
37 Ga0070658_10000050 3300005327 Bacteria 119052
38 Ga0070658_10024485 3300005327 Bacteria 4842
39 Ga0070658_10055698 3300005327 Bacteria 3213
40 Ga0070658_10169110 3300005327 Bacteria 1836
41 Ga0070676_10001276 3300005328 Bacteria 12641
42 Ga0070670_100000215 3300005331 Bacteria 53387
43 Ga0070670_100003193 3300005331 Bacteria 13522
44 Ga0070670_100057367 3300005331 Bacteria 3343
45 Ga0068869_100000159 3300005334 Bacteria 33762
46 Ga0070666_10000054 3300005335 Bacteria 95458
47 Ga0068868_100000074 3300005338 Bacteria 58620
48 Ga0070660_100000568 3300005339 Bacteria 24762
49 Ga0070660_100000801 3300005339 Bacteria 20852
50 Ga0070660_100007623 3300005339 Bacteria 7544
51 Ga0070660_100360903 3300005339 Bacteria 1197
52 Ga0070661_100002129 3300005344 Bacteria 13642
53 Ga0070661_100212878 3300005344 Bacteria 1480
54 Ga0070668_100000021 3300005347 Bacteria 96397
55 Ga0070668_100004064 3300005347 Bacteria 10836
56 Ga0070668_100182354 3300005347 Bacteria 1715
57 Ga0070669_100000097 3300005353 Bacteria 86804
58 Ga0070669_100032516 3300005353 Bacteria 3768
59 Ga0070675_100007766 3300005354 Bacteria 8305
60 Ga0070671_100000041 3300005355 Bacteria 91555
61 Ga0070671_100000114 3300005355 Bacteria 51983
62 Ga0070671_100046896 3300005355 Bacteria 3594
63 Ga0070674_100002053 3300005356 Bacteria 11026
64 Ga0070674_100157323 3300005356 Bacteria 1721
65 Ga0070673_100000008 3300005364 Bacteria 166844
66 Ga0070659_100051584 3300005366 Bacteria 3235
67 Ga0070659_100349909 3300005366 Bacteria 1239
68 Ga0070667_100000030 3300005367 Bacteria 178327
69 Ga0070667_100000188 3300005367 Bacteria 74225
70 Ga0070667_100000311 3300005367 Bacteria 54491
71 Ga0070663_100262462 3300005455 Bacteria 1370
72 Ga0070678_100000250 3300005456 Bacteria 24828
73 Ga0070678_100151796 3300005456 Bacteria 1867
74 Ga0070662_100023766 3300005457 Bacteria 4214
75 Ga0070662_100031618 3300005457 Bacteria 3716
76 Ga0070662_100131727 3300005457 Bacteria 1929
77 Ga0070662_100138877 3300005457 Bacteria 1881
78 Ga0068867_100000003 3300005459 Bacteria 217886
79 Ga0070679_100098272 3300005530 Bacteria 2915
80 Ga0068853_100027638 3300005539 Bacteria 4767
81 Ga0068853_100038790 3300005539 Bacteria 4059
82 Ga0068853_100063651 3300005539 Bacteria 3195
83 Ga0070672_100009714 3300005543 Bacteria 6644
84 Ga0070672_100097191 3300005543 Bacteria 2384
85 Ga0070672_100145215 3300005543 Bacteria 1960
86 Ga0070665_100000011 3300005548 Bacteria 525539
87 Ga0070665_100000043 3300005548 Bacteria 279774
88 Ga0070665_100073658 3300005548 Bacteria 3421
89 Ga0070665_100355272 3300005548 Bacteria 1471
90 Ga0070665_100414951 3300005548 Bacteria 1355
91 Ga0068855_100000371 3300005563 Bacteria 55533
92 Ga0068855_100001082 3300005563 Bacteria 33864
93 Ga0068855_100066463 3300005563 Bacteria 4204
94 Ga0068855_100150685 3300005563 Bacteria 2645
95 Ga0070664_100201224 3300005564 Bacteria 1777
96 Ga0068857_100016268 3300005577 Bacteria 6517
97 Ga0068854_100001249 3300005578 Bacteria 15265
98 Ga0068854_100014314 3300005578 Bacteria 5227
99 Ga0068854_100022097 3300005578 Bacteria 4327
100 Ga0068854_100047792 3300005578 Bacteria 3050
101 Ga0068854_100065251 3300005578 Bacteria 2647
102 Ga0068856_100011374 3300005614 Bacteria 8633
103 Ga0068856_100207705 3300005614 Bacteria 1973
104 Ga0068852_100002341 3300005616 Bacteria 13039
105 Ga0068852_100205455 3300005616 Bacteria 1866
106 Ga0068852_100260231 3300005616 Bacteria 1666
107 Ga0068852_100389257 3300005616 Bacteria 1369
108 Ga0068859_100001817 3300005617 Bacteria 21737
109 Ga0068859_100015829 3300005617 Bacteria 7579
110 Ga0068859_100036585 3300005617 Bacteria 4929
111 Ga0068864_100000080 3300005618 Bacteria 102508
112 Ga0068864_100000371 3300005618 Bacteria 39127
113 Ga0068864_100003001 3300005618 Bacteria 13945
114 Ga0068861_100009406 3300005719 Bacteria 6745
115 Ga0068851_10020928 3300005834 Bacteria 3172
116 Ga0068863_100000043 3300005841 Bacteria 153935
117 Ga0068863_100000049 3300005841 Bacteria 132539
118 Ga0068863_100000087 3300005841 Bacteria 102508
119 Ga0068863_100002305 3300005841 Bacteria 18976
120 Ga0068863_100002750 3300005841 Bacteria 17410
121 Ga0068858_100000166 3300005842 Bacteria 70016
122 Ga0068858_100003256 3300005842 Bacteria 16182
123 Ga0068860_100000013 3300005843 Bacteria 323055
124 Ga0068860_100001377 3300005843 Bacteria 26402
125 Ga0068860_100087306 3300005843 Bacteria 2969
126 Ga0068860_100121565 3300005843 Bacteria 2501
127 Ga0068860_100261637 3300005843 Bacteria 1686
128 Ga0068862_100000059 3300005844 Bacteria 136840
129 Ga0068862_100000101 3300005844 Bacteria 102508
130 Ga0068862_100000576 3300005844 Bacteria 38236
131 Ga0068862_100038858 3300005844 Bacteria 4039
132 Ga0068862_100154211 3300005844 Bacteria 2046
133 Ga0097621_100026451 3300006237 Bacteria 4552
134 Ga0097621_100035801 3300006237 Bacteria 3968
135 Ga0075370_10041560 3300006353 Bacteria 2595
136 Ga0075430_100014766 3300006846 Bacteria 6651
137 Ga0068865_100000002 3300006881 Bacteria 285745
138 Ga0097620_100001817 3300006931 Bacteria 21737
139 Ga0097620_100015829 3300006931 Bacteria 7579
140 Ga0097620_100036585 3300006931 Bacteria 4929
141 Ga0105251_10000248 3300009011 Bacteria 54567
142 Ga0105251_10088608 3300009011 Bacteria 1424
143 Ga0105240_10011621 3300009093 Bacteria 12245
144 Ga0105240_10017250 3300009093 Bacteria 9739
145 Ga0105240_10088337 3300009093 Bacteria 3793
146 Ga0105245_10000184 3300009098 Bacteria 58946
147 Ga0105245_10000430 3300009098 Bacteria 39014
148 Ga0105247_10001581 3300009101 Bacteria 16166
149 Ga0105247_10010807 3300009101 Bacteria 5513
150 Ga0105247_10023908 3300009101 Bacteria 3682
151 Ga0105243_10000031 3300009148 Bacteria 185825
152 Ga0105243_10000689 3300009148 Bacteria 32863
153 Ga0105242_10000171 3300009176 Bacteria 49237
154 Ga0105248_10000029 3300009177 Bacteria 223366
155 Ga0105248_10016882 3300009177 Bacteria 8037
156 Ga0105248_10026551 3300009177 Bacteria 6442
157 Ga0105248_10028248 3300009177 Bacteria 6249
158 Ga0105237_10003433 3300009545 Bacteria 18817
159 Ga0105237_10015645 3300009545 Bacteria 7886
160 Ga0105237_10101634 3300009545 Bacteria 2867
161 Ga0105238_10043691 3300009551 Bacteria 4533
162 Ga0105238_10047423 3300009551 Bacteria 4331
163 Ga0105238_10203528 3300009551 Bacteria 1955
164 Ga0105238_10320305 3300009551 Bacteria 1536
165 Ga0105249_10000024 3300009553 Bacteria 232947
166 Ga0105249_10000065 3300009553 Bacteria 151159
167 Ga0105249_10000424 3300009553 Bacteria 40288
168 Ga0105249_10003685 3300009553 Bacteria 13206
169 Ga0105249_10070837 3300009553 Bacteria 3219
170 Ga0105246_10000056 3300011119 Bacteria 45044
171 Ga0157373_10028936 3300013100 Bacteria 3995
172 Ga0157371_10000062 3300013102 Bacteria 169669
173 Ga0157371_10326300 3300013102 Bacteria 1114
174 Ga0157370_10000117 3300013104 Bacteria 92168
175 Ga0157370_10305681 3300013104 Bacteria 1468
176 Ga0157369_10002806 3300013105 Bacteria 20790
177 Ga0157369_10009587 3300013105 Bacteria 11071
178 Ga0157369_10079001 3300013105 Bacteria 3524
179 Ga0157369_10222549 3300013105 Bacteria 1975
180 Ga0157374_10163835 3300013296 Bacteria 2166
181 Ga0157378_10000205 3300013297 Bacteria 57706
182 Ga0157378_10022815 3300013297 Bacteria 5508
183 Ga0163162_10003734 3300013306 Bacteria 14589
184 Ga0163162_10009961 3300013306 Bacteria 9245
185 Ga0163162_10093952 3300013306 Bacteria 3085
186 Ga0163162_10245565 3300013306 Bacteria 1922
187 Ga0157372_10100207 3300013307 Bacteria 3306
188 Ga0157375_10003415 3300013308 Bacteria 13770
189 Ga0157375_10175710 3300013308 Bacteria 2291
190 Ga0163163_10255124 3300014325 Bacteria 1804
191 Ga0157380_10018217 3300014326 Bacteria 5211
192 Ga0157380_10052432 3300014326 Bacteria 3230
193 Ga0157379_10210980 3300014968 Bacteria 1758
194 Ga0157379_10284618 3300014968 Bacteria 1505
195 Ga0157376_10000148 3300014969 Bacteria 48325
196 Ga0183363_1002 3300015690 Bacteria 425040
197 Ga0183361_10560 3300016635 Bacteria 1658
198 Ga0163161_10061876 3300017792 Bacteria 2726
199 Ga0213876_10003358 3300021384 Bacteria 9163
200 Ga0213875_10000135 3300021388 Bacteria 82147
201 Ga0209674_102849 3300025226 Bacteria 3456
202 Ga0209563_100070 3300025230 Bacteria 249779
203 Ga0207427_101501 3300025231 Bacteria 8295
204 Ga0207425_1000005 3300025245 Bacteria 900502
205 Ga0209026_1000641 3300025250 Bacteria 21580
206 Ga0209677_107720 3300025253 Bacteria 2220
207 Ga0209148_1000008 3300025254 Bacteria 1504371
208 Ga0209148_1000147 3300025254 Bacteria 160231
209 Ga0209148_1002072 3300025254 Bacteria 7681
210 Ga0209129_1000228 3300025258 Bacteria 63465
211 Ga0209233_1000003 3300025261 Bacteria 1607366
212 Ga0209233_1000084 3300025261 Bacteria 335222
213 Ga0209565_1000007 3300025263 Bacteria 784361
214 Ga0209565_1000231 3300025263 Bacteria 61384
215 Ga0209455_1000002 3300025272 Bacteria 1505459
216 Ga0209455_1003120 3300025272 Bacteria 6034
217 Ga0209455_1013427 3300025272 Bacteria 1901
218 Ga0209455_1015820 3300025272 Bacteria 1641
219 Ga0209673_1003053 3300025273 Bacteria 10337
220 Ga0209673_1017486 3300025273 Bacteria 2642
221 Ga0209675_1007267 3300025291 Bacteria 4286
222 Ga0209676_1001342 3300025292 Bacteria 24674
223 Ga0209676_1042798 3300025292 Bacteria 1255
224 Ga0209025_1000515 3300025294 Bacteria 73801
225 Ga0209564_1000680 3300025295 Bacteria 50194
226 Ga0209564_1012482 3300025295 Bacteria 3700
227 Ga0209564_1026375 3300025295 Bacteria 1922
228 Ga0209758_1000002 3300025297 Bacteria 1400310
229 Ga0209758_1000007 3300025297 Bacteria 1270410
230 Ga0209050_1000001 3300025298 Bacteria 3563507
231 Ga0209050_1000051 3300025298 Bacteria 353153
232 Ga0209050_1000483 3300025298 Bacteria 69796
233 Ga0209050_1002594 3300025298 Bacteria 14975
234 Ga0209050_1017333 3300025298 Bacteria 2880
235 Ga0209050_1045283 3300025298 Bacteria 1168
236 Ga0209256_1000008 3300025299 Bacteria 975723
237 Ga0209051_1000999 3300025303 Bacteria 27167
238 Ga0209257_1000028 3300025304 Bacteria 699493
239 Ga0209257_1001517 3300025304 Bacteria 27226
240 Ga0209257_1001522 3300025304 Bacteria 27092
241 Ga0209257_1002018 3300025304 Bacteria 21696
242 Ga0207697_10016191 3300025315 Bacteria 3075
243 Ga0207713_1024835 3300025735 Bacteria 2781
244 Ga0207710_10001917 3300025900 Bacteria 9961
245 Ga0207710_10011684 3300025900 Bacteria 3693
246 Ga0207688_10021302 3300025901 Bacteria 3541
247 Ga0207647_10035059 3300025904 Bacteria 3200
248 Ga0207647_10035686 3300025904 Bacteria 3166
249 Ga0207647_10099925 3300025904 Bacteria 1723
250 Ga0207645_10003054 3300025907 Bacteria 12867
251 Ga0207645_10044628 3300025907 Bacteria 2836
252 Ga0207705_10000014 3300025909 Bacteria 434286
253 Ga0207705_10000236 3300025909 Bacteria 54788
254 Ga0207705_10000350 3300025909 Bacteria 41599
255 Ga0207705_10011211 3300025909 Bacteria 6498
256 Ga0207705_10118700 3300025909 Bacteria 1961
257 Ga0207705_10129683 3300025909 Bacteria 1876
258 Ga0207654_10001225 3300025911 Bacteria 13706
259 Ga0207695_10020519 3300025913 Bacteria 7565
260 Ga0207695_10062774 3300025913 Bacteria 3833
261 Ga0207695_10074872 3300025913 Bacteria 3446
262 Ga0207695_10376939 3300025913 Bacteria 1305
263 Ga0207671_10004798 3300025914 Bacteria 12737
264 Ga0207671_10113452 3300025914 Bacteria 2064
265 Ga0207657_10000837 3300025919 Bacteria 32516
266 Ga0207657_10001189 3300025919 Bacteria 27647
267 Ga0207657_10003808 3300025919 Bacteria 16035
268 Ga0207657_10016781 3300025919 Bacteria 7051
269 Ga0207649_10003468 3300025920 Bacteria 8617
270 Ga0207649_10068638 3300025920 Bacteria 2255
271 Ga0207652_10122250 3300025921 Bacteria 2317
272 Ga0207681_10220131 3300025923 Bacteria 1468
273 Ga0207694_10025630 3300025924 Bacteria 4482
274 Ga0207694_10087684 3300025924 Bacteria 2452
275 Ga0207694_10264461 3300025924 Bacteria 1410
276 Ga0207650_10000261 3300025925 Bacteria 56610
277 Ga0207650_10011625 3300025925 Bacteria 6064
278 Ga0207659_10017796 3300025926 Bacteria 4648
279 Ga0207687_10001967 3300025927 Bacteria 14143
280 Ga0207687_10010931 3300025927 Bacteria 5932
281 Ga0207644_10000077 3300025931 Bacteria 72394
282 Ga0207690_10006218 3300025932 Bacteria 7071
283 Ga0207690_10009597 3300025932 Bacteria 5748
284 Ga0207690_10023901 3300025932 Bacteria 3821
285 Ga0207706_10007744 3300025933 Bacteria 9915
286 Ga0207706_10008803 3300025933 Bacteria 9291
287 Ga0207706_10033446 3300025933 Bacteria 4577
288 Ga0207686_10000178 3300025934 Bacteria 48947
289 Ga0207709_10000005 3300025935 Bacteria 806813
290 Ga0207709_10000237 3300025935 Bacteria 69190
291 Ga0207669_10000356 3300025937 Bacteria 20819
292 Ga0207704_10000003 3300025938 Bacteria 285808
293 Ga0207691_10057992 3300025940 Bacteria 3522
294 Ga0207691_10079463 3300025940 Bacteria 2952
295 Ga0207691_10120038 3300025940 Bacteria 2331
296 Ga0207691_10320225 3300025940 Bacteria 1330
297 Ga0207711_10000004 3300025941 Bacteria 870636
298 Ga0207711_10008299 3300025941 Bacteria 8694
299 Ga0207711_10015217 3300025941 Bacteria 6386
300 Ga0207711_10020471 3300025941 Bacteria 5516
301 Ga0207711_10041833 3300025941 Bacteria 3903
302 Ga0207689_10001018 3300025942 Bacteria 26943
303 Ga0207667_10000001 3300025949 Bacteria 1178522
304 Ga0207667_10000017 3300025949 Bacteria 390654
305 Ga0207667_10005618 3300025949 Bacteria 15301
306 Ga0207667_10024489 3300025949 Bacteria 6626
307 Ga0207667_10399124 3300025949 Bacteria 1400
308 Ga0207651_10000003 3300025960 Bacteria 308050
309 Ga0207712_10000002 3300025961 Bacteria 706628
310 Ga0207712_10000034 3300025961 Bacteria 202320
311 Ga0207712_10002044 3300025961 Bacteria 13241
312 Ga0207712_10013167 3300025961 Bacteria 5302
313 Ga0207712_10015689 3300025961 Bacteria 4891
314 Ga0207712_10099057 3300025961 Bacteria 2163
315 Ga0207668_10000066 3300025972 Bacteria 84452
316 Ga0207668_10000068 3300025972 Bacteria 81202
317 Ga0207668_10011349 3300025972 Bacteria 5409
318 Ga0207668_10173148 3300025972 Bacteria 1695
319 Ga0207640_10000653 3300025981 Bacteria 20274
320 Ga0207640_10002633 3300025981 Bacteria 9614
321 Ga0207640_10013176 3300025981 Bacteria 4731
322 Ga0207640_10105705 3300025981 Bacteria 1984
323 Ga0207640_10107715 3300025981 Bacteria 1968
324 Ga0207658_10000019 3300025986 Bacteria 206335
325 Ga0207658_10000145 3300025986 Bacteria 74256
326 Ga0207658_10000239 3300025986 Bacteria 57662
327 Ga0207658_10029314 3300025986 Bacteria 3885
328 Ga0207677_10000194 3300026023 Bacteria 48709
329 Ga0207703_10000711 3300026035 Bacteria 32868
330 Ga0207639_10002702 3300026041 Bacteria 11907
331 Ga0207639_10027527 3300026041 Bacteria 4143
332 Ga0207639_10034637 3300026041 Bacteria 3733
333 Ga0207639_10045705 3300026041 Bacteria 3300
334 Ga0207639_10141987 3300026041 Bacteria 2002
335 Ga0207639_10186971 3300026041 Bacteria 1767
336 Ga0207678_10000656 3300026067 Bacteria 31806
337 Ga0207678_10044072 3300026067 Bacteria 3860
338 Ga0207678_10115873 3300026067 Bacteria 2286
339 Ga0207702_10006436 3300026078 Bacteria 10127
340 Ga0207702_10016086 3300026078 Bacteria 6193
341 Ga0207702_10134773 3300026078 Bacteria 2227
342 Ga0207702_10278811 3300026078 Bacteria 1579
343 Ga0207641_10000010 3300026088 Bacteria 402193
344 Ga0207641_10000029 3300026088 Bacteria 229383
345 Ga0207641_10000031 3300026088 Bacteria 224320
346 Ga0207641_10001424 3300026088 Bacteria 23544
347 Ga0207641_10006908 3300026088 Bacteria 9496
348 Ga0207641_10012604 3300026088 Bacteria 6933
349 Ga0207641_10058731 3300026088 Bacteria 3274
350 Ga0207648_10000007 3300026089 Bacteria 217865
351 Ga0207676_10000036 3300026095 Bacteria 198447
352 Ga0207676_10000351 3300026095 Bacteria 39386
353 Ga0207674_10007690 3300026116 Bacteria 12548
354 Ga0207674_10042262 3300026116 Bacteria 4709
355 Ga0207675_100000732 3300026118 Bacteria 32563
356 Ga0207683_10000605 3300026121 Bacteria 33065
357 Ga0207683_10004322 3300026121 Bacteria 12272
358 Ga0207698_10000385 3300026142 Bacteria 25510
359 Ga0207698_10017172 3300026142 Bacteria 4902
360 Ga0207698_10073492 3300026142 Bacteria 2723
361 Ga0268266_10000002 3300028379 Bacteria 3059047
362 Ga0268266_10000058 3300028379 Bacteria 277346
363 Ga0268266_10000171 3300028379 Bacteria 118317
364 Ga0268266_10070814 3300028379 Bacteria 3022
365 Ga0268266_10269125 3300028379 Bacteria 1581
366 Ga0268265_10000059 3300028380 Bacteria 152531
367 Ga0268265_10000114 3300028380 Bacteria 101337
368 Ga0268265_10038178 3300028380 Bacteria 3531
369 Ga0268265_10177676 3300028380 Bacteria 1826
370 Ga0268264_10000039 3300028381 Bacteria 376641
371 Ga0268264_10000562 3300028381 Bacteria 45693
372 Ga0268264_10074261 3300028381 Bacteria 2888
373 Ga0268264_10119827 3300028381 Bacteria 2318
374 Ga0307517_10065908 3300028786 Bacteria 3342
375 Ga0307517_10115951 3300028786 Bacteria 2008
376 Ga0307513_10024830 3300031456 Bacteria 6965
377 Ga0307513_10036193 3300031456 Bacteria 5512
378 Ga0307513_10073482 3300031456 Bacteria 3560
379 Ga0307513_10080558 3300031456 Bacteria 3358
380 Ga0307509_10124251 3300031507 Bacteria 2551
381 Ga0307508_10000166 3300031616 Bacteria 79602
382 Ga0307405_10004519 3300031731 Bacteria 6587
383 Ga0307405_10005990 3300031731 Bacteria 5938
384 Ga0307410_10025284 3300031852 Bacteria 3723
385 Ga0307406_10033935 3300031901 Bacteria 3127
386 Ga0307406_10111940 3300031901 Bacteria 1881
387 Ga0307412_10003556 3300031911 Bacteria 8653
388 Ga0307412_10010539 3300031911 Bacteria 5324
389 Ga0307412_10059577 3300031911 Bacteria 2559
390 Ga0307412_10129731 3300031911 Bacteria 1829
391 Ga0307409_100130832 3300031995 Bacteria 2144
392 Ga0307416_100027869 3300032002 Bacteria 4191
393 Ga0307416_100078608 3300032002 Bacteria 2777
394 Ga0307416_100303450 3300032002 Bacteria 1588
395 Ga0307414_10048694 3300032004 Bacteria 2925
396 Ga0307414_10273829 3300032004 Bacteria 1415
397 Ga0307415_100040481 3300032126 Bacteria 3087
398 Ga0307510_10000081 3300033180 Bacteria 72540
399 Ga0395899_0002159 3300037312 Bacteria 16147
400 Ga0395905_0040082 3300037471 Bacteria 4394
401 Ga0395905_0067724 3300037471 Bacteria 3344
402 Ga0395901_0101671 3300038443 Bacteria 3016
403 Ga0395901_0503745 3300038443 Bacteria 1232
404 Ga0436365_0380590 3300039437 Bacteria 74578
405 Ga0436365_0478409 3300039437 Bacteria 9475
406 Ga0436365_0567097 3300039437 Bacteria 6293
407 Ga0439436_0009278 3300041404 Bacteria 3015
408 Ga0439436_0012005 3300041404 Bacteria 2630
409 Ga0439439_0001789 3300041406 Bacteria 4389
410 Ga0439447_026022 3300041407 Bacteria 1503
411 Ga0439461_0000027 3300041410 Bacteria 18688
412 Ga0439461_0022496 3300041410 Bacteria 1263
413 Ga0439466_0022164 3300041411 Bacteria 2244
414 Ga0439465_0000555 3300041413 Bacteria 11222
415 Ga0439465_0004009 3300041413 Bacteria 4799
416 Ga0439431_0002380 3300041997 Bacteria 4162
417 Ga0439431_0014035 3300041997 Bacteria 1853
418 Ga0439442_003046 3300042002 Bacteria 3312
419 Ga0439445_0000241 3300042004 Bacteria 10317
420 Ga0439445_0012089 3300042004 Bacteria 2068
421 Ga0439445_0017551 3300042004 Bacteria 1769
422 Ga0439448_0002591 3300042005 Bacteria 4929
423 Ga0439448_0005384 3300042005 Bacteria 3649
424 Ga0439448_0010657 3300042005 Bacteria 2729
425 Ga0439432_001358 3300042006 Bacteria 9256
426 Ga0439432_015867 3300042006 Bacteria 2537
427 Ga0439455_0001161 3300042012 Bacteria 4258
428 Ga0439455_0007004 3300042012 Bacteria 2368
429 Ga0439455_0022726 3300042012 Bacteria 1505
430 Ga0439455_0028703 3300042012 Bacteria 1371
431 Ga0439462_0001825 3300042015 Bacteria 4826
432 Ga0439458_0000312 3300042157 Bacteria 12101
433 Ga0439458_0002017 3300042157 Bacteria 5046
434 Ga0439458_0036207 3300042157 Bacteria 1187
435 Ga0466972_0000559 3300044658 Bacteria 18168
436 Ga0466961_0010692 3300044693 Bacteria 5861
437 Ga0466970_0042819 3300044765 Bacteria 2408
438 Ga0466957_0036821 3300044842 Bacteria 2943
439 Ga0466960_0006284 3300044901 Bacteria 4758
440 Ga0466959_0011041 3300045049 Bacteria 6483
441 Ga0466958_0024547 3300045836 Bacteria 3548
442 Ga0495627_048963 3300046453 Bacteria 1277
443 Ga0495638_0000266 3300046460 Bacteria 70490
444 Ga0495638_0017145 3300046460 Bacteria 4835
445 Ga0495638_0029884 3300046460 Bacteria 3513
446 Ga0495638_0069487 3300046460 Bacteria 2159
447 Ga0495650_0001670 3300046471 Bacteria 20498
448 Ga0495650_0001698 3300046471 Bacteria 20259
449 Ga0495584_0005300 3300046491 Bacteria 6833
450 Ga0495585_0002637 3300046492 Bacteria 12631
451 Ga0495583_0000023 3300046506 Bacteria 280019
452 Ga0495583_0005610 3300046506 Bacteria 8457
453 Ga0495583_0046945 3300046506 Bacteria 1989
454 Ga0495583_0055122 3300046506 Bacteria 1797
455 Ga0495583_0103147 3300046506 Bacteria 1215
456 Ga0495606_0001237 3300046507 Bacteria 35671
457 Ga0495606_0001895 3300046507 Bacteria 26125
458 Ga0495606_0027805 3300046507 Bacteria 4002
459 Ga0495616_0000213 3300046513 Bacteria 48346
460 Ga0495616_0010730 3300046513 Bacteria 5285
461 Ga0495631_0001519 3300046518 Bacteria 13982
462 Ga0495631_0069420 3300046518 Bacteria 1524
463 Ga0495643_0000762 3300046522 Bacteria 36100
464 Ga0495643_0004533 3300046522 Bacteria 9680
465 Ga0495648_0000809 3300046524 Bacteria 33122
466 Ga0495648_0010353 3300046524 Bacteria 7106
467 Ga0495648_0079506 3300046524 Bacteria 1871
468 Ga0495648_0164057 3300046524 Bacteria 1145
469 Ga0495663_0031422 3300046525 Bacteria 1577
470 Ga0495642_0022746 3300046528 Bacteria 2471
471 Ga0495654_0001867 3300046530 Bacteria 14027
472 Ga0495633_0002763 3300046558 Bacteria 12134
473 Ga0495668_0000059 3300046616 Bacteria 194951
474 Ga0495668_0002552 3300046616 Bacteria 14809
475 Ga0495668_0036035 3300046616 Bacteria 2773
476 Ga0495668_0050121 3300046616 Bacteria 2314
477 Ga0495611_0008277 3300046648 Bacteria 4408
478 Ga0495625_0000274 3300046660 Bacteria 80067
479 Ga0495625_0001644 3300046660 Bacteria 26272
480 Ga0495625_0003774 3300046660 Bacteria 14712
481 Ga0495625_0004006 3300046660 Bacteria 14102
482 Ga0495661_0166051 3300046665 Bacteria 1181
483 Ga0495669_0000107 3300046684 Bacteria 53426
484 Ga0495670_0000036 3300046691 Bacteria 78512
485 Ga0495670_0045474 3300046691 Bacteria 2192
486 Ga0495671_0016420 3300046692 Bacteria 3953
487 Ga0495649_0016788 3300046694 Bacteria 4145
488 Ga0495600_0055656 3300046809 Bacteria 2583
489 Ga0495660_0132605 3300046810 Bacteria 1248
490 Ga0495687_000181 3300047443 Bacteria 91455
491 Ga0495687_000286 3300047443 Bacteria 66428
492 Ga0495677_0005239 3300047445 Bacteria 4930
493 Ga0495677_0043446 3300047445 Bacteria 1647
494 Ga0495673_0053086 3300047469 Bacteria 1769
495 Ga0495681_0004350 3300047470 Bacteria 9687
496 Ga0495686_0000132 3300047472 Bacteria 151609
497 Ga0495686_0000209 3300047472 Bacteria 108972
498 Ga0495686_0000366 3300047472 Bacteria 73243
499 Ga0495686_0000741 3300047472 Bacteria 43528
500 Ga0495686_0007896 3300047472 Bacteria 7904
501 Ga0495686_0019543 3300047472 Bacteria 4527
502 Ga0495686_0116934 3300047472 Bacteria 1593
503 Ga0496101_0043257 3300048904 Bacteria 3219
504 Ga0496102_0000497 3300048905 Bacteria 43250
505 Ga0496103_0000205 3300048906 Bacteria 59075
506 Ga0496105_0000881 3300048908 Bacteria 20545
507 Ga0496111_0005587 3300048914 Bacteria 8085
508 Ga0496114_0037394 3300048917 Bacteria 4015
509 Ga0496115_0000197 3300048918 Bacteria 56313
510 Ga0496115_0000522 3300048918 Bacteria 29892
511 Ga0496115_0313552 3300048918 Bacteria 1284
512 Ga0496116_0000685 3300048919 Bacteria 44025
513 Ga0496117_0000628 3300048920 Bacteria 57204
514 Ga0496117_0018287 3300048920 Bacteria 5813
515 Ga0496117_0106479 3300048920 Bacteria 1759
516 Ga0496117_0124189 3300048920 Bacteria 1579
517 Ga0496118_0000154 3300048921 Bacteria 122224
518 Ga0496118_0000335 3300048921 Bacteria 80253
519 Ga0496118_0008136 3300048921 Bacteria 10920
520 Ga0496118_0135611 3300048921 Bacteria 1571
521 Ga0496119_0001965 3300048922 Bacteria 23377
522 Ga0496120_0013373 3300048923 Bacteria 5530
523 Ga0496121_0000335 3300048924 Bacteria 98310
524 Ga0496121_0000650 3300048924 Bacteria 65007
525 Ga0496121_0000986 3300048924 Bacteria 50999
526 Ga0496121_0051848 3300048924 Bacteria 3452
527 Ga0496121_0172496 3300048924 Bacteria 1569
528 Ga0496122_0002744 3300048925 Bacteria 24327
529 Ga0496122_0014321 3300048925 Bacteria 7678
530 Ga0496122_0048012 3300048925 Bacteria 3289
531 Ga0496123_0001272 3300048926 Bacteria 36131
532 Ga0496123_0006046 3300048926 Bacteria 11887
533 Ga0496123_0010147 3300048926 Bacteria 8366
534 Ga0496123_0018742 3300048926 Bacteria 5485
535 Ga0496123_0154106 3300048926 Bacteria 1235
536 Ga0496124_0000655 3300048927 Bacteria 57195
537 Ga0496124_0001312 3300048927 Bacteria 37532
538 Ga0496124_0033521 3300048927 Bacteria 4517
539 Ga0496124_0037572 3300048927 Bacteria 4210
540 Ga0496124_0052849 3300048927 Bacteria 3449
541 Ga0496124_0225959 3300048927 Bacteria 1403
542 Ga0496125_0001506 3300048928 Bacteria 33371
543 Ga0496125_0068144 3300048928 Bacteria 2801
544 Ga0496126_0000501 3300048929 Bacteria 76957
545 Ga0496126_0006072 3300048929 Bacteria 13556
546 Ga0501292_000008 3300049515 Bacteria 83748
547 Ga0501300_000388 3300049523 Bacteria 6738
548 Ga0501032_0065491 3300049569 Bacteria 2430
549 Ga0501033_0037409 3300049570 Bacteria 3633
550 Ga0501034_0095285 3300049571 Bacteria 2973
551 Ga0501047_0005316 3300049581 Bacteria 12098
552 Ga0501047_0393420 3300049581 Bacteria 1219
553 Ga0501222_000204 3300049662 Bacteria 10576
554 Ga0501223_001803 3300049663 Bacteria 4833
555 Ga0501227_012280 3300049665 Bacteria 1874
556 Ga0501257_000122 3300049686 Bacteria 17841
557 Ga0501261_000020 3300049690 Bacteria 37889
558 Ga0501241_010062 3300049758 Bacteria 1720
559 Ga0501279_000002 3300049775 Bacteria 205937
560 Ga0501280_000010 3300049776 Bacteria 63153
561 Ga0501280_003806 3300049776 Bacteria 2275
562 Ga0501282_001212 3300049778 Bacteria 2894
563 Ga0501283_002667 3300049779 Bacteria 2324
564 Ga0501035_0063647 3300049822 Bacteria 3280
565 Ga0501044_0009707 3300049823 Bacteria 10471
566 Ga0501044_0392277 3300049823 Bacteria 1302
567 nmdc:mga0qj67_5921_c1 3300050509 Bacteria 8958
568 Ga0500610_0028866 3300053079 Bacteria 2798
569 Ga0500643_000001 3300053087 Bacteria 1440111
570 Ga0500643_000467 3300053087 Bacteria 29824
571 Ga0500643_000850 3300053087 Bacteria 19500
572 Ga0500643_003366 3300053087 Bacteria 7736
573 Ga0500643_006324 3300053087 Bacteria 4963
574 Ga0500643_042440 3300053087 Bacteria 1331
575 Ga0500566_0000251 3300053094 Bacteria 28795
576 Ga0500641_0000748 3300053096 Bacteria 11770
577 Ga0500555_000335 3300053103 Bacteria 20168
578 Ga0500592_000009 3300053116 Bacteria 87878
579 Ga0500592_000174 3300053116 Bacteria 12704
580 Ga0500595_001306 3300053119 Bacteria 13558
581 Ga0500595_016196 3300053119 Bacteria 2781
582 Ga0500642_0001077 3300053130 Bacteria 7867
583 Ga0500658_0002012 3300053134 Bacteria 7939
584 Ga0500658_0009116 3300053134 Bacteria 3662
585 Ga0500658_0040720 3300053134 Bacteria 1861
586 Ga0500573_0000040 3300053140 Bacteria 105074
587 Ga0500577_0043027 3300053142 Bacteria 1657
588 Ga0500604_0000055 3300053151 Bacteria 41071
589 Ga0500604_0072558 3300053151 Bacteria 1100
590 Ga0500616_0109638 3300053153 Bacteria 1335
591 Ga0500624_000075 3300053157 Bacteria 56822
592 Ga0500624_000215 3300053157 Bacteria 21766
593 Ga0500627_0000051 3300053158 Bacteria 56260
594 Ga0500627_0002029 3300053158 Bacteria 5848
595 Ga0500627_0002503 3300053158 Bacteria 5465
596 Ga0500627_0022883 3300053158 Bacteria 2541
597 Ga0500627_0024189 3300053158 Bacteria 2482
598 Ga0500636_0031239 3300053177 Bacteria 3152
599 Ga0500637_0000049 3300053178 Bacteria 43426
600 Ga0500645_000389 3300053730 Bacteria 30770
601 Ga0500645_014883 3300053730 Bacteria 2474
602 Ga0500596_002758 3300053735 Bacteria 3438
603 Ga0500587_000861 3300053739 Bacteria 4012
604 Ga0590071_010536 3300059421 Bacteria 2165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053116 Ga0500592_000009 Ga0500592_000009_57642_58619 308
2 3300053158 Ga0500627_0000051 Ga0500627_0000051_54874_55851 308
3 3300044901 Ga0466960_0006284 Ga0466960_0006284_3810_4748 310
4 3300046665 Ga0495661_0166051 Ga0495661_0166051_26_1024 311
5 3300005841 Ga0068863_100002750 Ga0068863_10000275011 314
6 3300005844 Ga0068862_100000059 Ga0068862_10000005949 314
7 3300026088 Ga0207641_10001424 Ga0207641_100014249 314
8 3300028380 Ga0268265_10000114 Ga0268265_100001145 314
9 3300031901 Ga0307406_10033935 Ga0307406_100339353 314
10 3300031911 Ga0307412_10010539 Ga0307412_100105393 314
11 3300032002 Ga0307416_100303450 Ga0307416_1003034502 314
12 3300032004 Ga0307414_10273829 Ga0307414_102738292 314
13 3300003773 Ga0055537_1000482 Ga0055537_100048210 315
14 3300003775 Ga0055524_1000165 Ga0055524_100016547 315
15 3300003791 Ga0055530_10009352 Ga0055530_100093523 315
16 3300003794 Ga0055531_10004100 Ga0055531_100041003 315
17 3300025263 Ga0209565_1000007 Ga0209565_1000007529 315
18 3300025273 Ga0209673_1003053 Ga0209673_10030539 315
19 3300025291 Ga0209675_1007267 Ga0209675_10072674 315
20 3300025295 Ga0209564_1026375 Ga0209564_10263752 315
21 3300025298 Ga0209050_1002594 Ga0209050_100259411 315
22 3300025299 Ga0209256_1000008 Ga0209256_1000008371 315
23 3300025304 Ga0209257_1002018 Ga0209257_10020188 315
24 3300037471 Ga0395905_0040082 Ga0395905_0040082_2207_3199 316
25 3300038443 Ga0395901_0503745 Ga0395901_0503745_224_1216 316
26 3300005548 Ga0070665_100000043 Ga0070665_100000043241 317
27 3300028379 Ga0268266_10000002 Ga0268266_10000002350 317
28 3300002067 JGI24735J21928_10005685 JGI24735J21928_100056855 319
29 3300044842 Ga0466957_0036821 Ga0466957_0036821_1442_2452 319
30 3300002075 JGI24738J21930_10002603 JGI24738J21930_100026034 321
31 3300002075 JGI24738J21930_10005891 JGI24738J21930_100058911 321
32 3300005457 Ga0070662_100138877 Ga0070662_1001388771 321
33 3300013105 Ga0157369_10222549 Ga0157369_102225491 321
34 3300025933 Ga0207706_10008803 Ga0207706_100088036 321
35 3300031911 Ga0307412_10003556 Ga0307412_100035563 321
36 3300042005 Ga0439448_0005384 Ga0439448_0005384_588_1622 321
37 3300042012 Ga0439455_0007004 Ga0439455_0007004_678_1712 321
38 3300042012 Ga0439455_0028703 Ga0439455_0028703_89_1123 321
39 3300042157 Ga0439458_0000312 Ga0439458_0000312_415_1449 321
40 3300042157 Ga0439458_0036207 Ga0439458_0036207_82_1116 321
41 3300053151 Ga0500604_0072558 Ga0500604_0072558_110_1084 322
42 3300013105 Ga0157369_10079001 Ga0157369_100790012 323
43 3300053730 Ga0500645_014883 Ga0500645_014883_1466_2443 323
44 iso_pu_bacteria 2885429604 2885432132 323
45 3300014326 Ga0157380_10052432 Ga0157380_100524322 324
46 3300031911 Ga0307412_10129731 Ga0307412_101297312 324
47 3300031995 Ga0307409_100130832 Ga0307409_1001308322 324
48 3300032004 Ga0307414_10048694 Ga0307414_100486944 324
49 3300005563 Ga0068855_100066463 Ga0068855_1000664632 325
50 3300049581 Ga0501047_0393420 Ga0501047_0393420_180_1172 325
51 3300049823 Ga0501044_0392277 Ga0501044_0392277_217_1209 325
52 3300053087 Ga0500643_042440 Ga0500643_042440_230_1228 325
53 iso_pu_bacteria 2643221622 2644125417 325
54 iso_pu_bacteria 2751185897 2753767477 325
55 iso_pu_bacteria 2818991466 2819716223 325
56 iso_pu_bacteria 2879163058 2879165477 325
57 iso_pu_bacteria 2928526807 2928528974 325
58 iso_pu_bacteria 2928968154 2928971209 325
59 iso_pu_bacteria 2946787523 2946790265 325
60 iso_pu_bacteria 8057101203 8057102106 325
61 3300001990 JGI24737J22298_10000500 JGI24737J22298_100005009 326
62 3300002244 JGI24742J22300_10006413 JGI24742J22300_100064133 326
63 3300003187 JGI25151J46595_10016590 JGI25151J46595_100165902 326
64 3300003214 JGI25165J46597_1000024 JGI25165J46597_1000024205 326
65 3300003215 JGI25153J46596_10000027 JGI25153J46596_10000027193 326
66 3300003759 Ga0055525_1000118 Ga0055525_100011897 326
67 3300003762 Ga0055542_1000076 Ga0055542_100007665 326
68 3300003763 Ga0055529_1000004 Ga0055529_100000479 326
69 3300003771 Ga0055526_1001321 Ga0055526_100132115 326
70 3300003773 Ga0055537_1003479 Ga0055537_10034792 326
71 3300003791 Ga0055530_10000084 Ga0055530_1000008485 326
72 3300003791 Ga0055530_10005398 Ga0055530_100053981 326
73 3300003792 Ga0055540_1001052 Ga0055540_10010526 326
74 3300003794 Ga0055531_10000090 Ga0055531_1000009076 326
75 3300003794 Ga0055531_10044944 Ga0055531_100449441 326
76 3300003794 Ga0055531_10044946 Ga0055531_100449461 326
77 3300005262 Ga0065165_1010052 Ga0065165_10100521 326
78 3300005262 Ga0065165_1042206 Ga0065165_10422061 326
79 3300005339 Ga0070660_100360903 Ga0070660_1003609031 326
80 3300005344 Ga0070661_100002129 Ga0070661_1000021293 326
81 3300005347 Ga0070668_100182354 Ga0070668_1001823541 326
82 3300005356 Ga0070674_100002053 Ga0070674_1000020531 326
83 3300005366 Ga0070659_100349909 Ga0070659_1003499092 326
84 3300005455 Ga0070663_100262462 Ga0070663_1002624621 326
85 3300005456 Ga0070678_100000250 Ga0070678_10000025015 326
86 3300005457 Ga0070662_100131727 Ga0070662_1001317271 326
87 3300005539 Ga0068853_100027638 Ga0068853_1000276383 326
88 3300005543 Ga0070672_100097191 Ga0070672_1000971914 326
89 3300005564 Ga0070664_100201224 Ga0070664_1002012242 326
90 3300005578 Ga0068854_100022097 Ga0068854_1000220975 326
91 3300005618 Ga0068864_100000371 Ga0068864_1000003713 326
92 3300005842 Ga0068858_100000166 Ga0068858_10000016635 326
93 3300005844 Ga0068862_100154211 Ga0068862_1001542112 326
94 3300006237 Ga0097621_100026451 Ga0097621_1000264514 326
95 3300009098 Ga0105245_10000430 Ga0105245_1000043026 326
96 3300009148 Ga0105243_10000689 Ga0105243_1000068931 326
97 3300009177 Ga0105248_10026551 Ga0105248_100265519 326
98 3300009545 Ga0105237_10015645 Ga0105237_100156453 326
99 3300009551 Ga0105238_10203528 Ga0105238_102035282 326
100 3300009553 Ga0105249_10070837 Ga0105249_100708373 326
101 3300013102 Ga0157371_10000062 Ga0157371_10000062114 326
102 3300013102 Ga0157371_10326300 Ga0157371_103263001 326
103 3300013104 Ga0157370_10305681 Ga0157370_103056812 326
104 3300013297 Ga0157378_10022815 Ga0157378_100228154 326
105 3300013306 Ga0163162_10009961 Ga0163162_100099612 326
106 3300013306 Ga0163162_10093952 Ga0163162_100939524 326
107 3300013308 Ga0157375_10175710 Ga0157375_101757102 326
108 3300014326 Ga0157380_10018217 Ga0157380_100182172 326
109 3300015690 Ga0183363_1002 Ga0183363_1002389 326
110 3300016635 Ga0183361_10560 Ga0183361_105602 326
111 3300017792 Ga0163161_10061876 Ga0163161_100618763 326
112 3300025226 Ga0209674_102849 Ga0209674_1028494 326
113 3300025230 Ga0209563_100070 Ga0209563_10007026 326
114 3300025245 Ga0207425_1000005 Ga0207425_1000005211 326
115 3300025253 Ga0209677_107720 Ga0209677_1077203 326
116 3300025254 Ga0209148_1000008 Ga0209148_1000008571 326
117 3300025258 Ga0209129_1000228 Ga0209129_10002285 326
118 3300025261 Ga0209233_1000084 Ga0209233_1000084106 326
119 3300025263 Ga0209565_1000231 Ga0209565_100023167 326
120 3300025272 Ga0209455_1000002 Ga0209455_1000002853 326
121 3300025272 Ga0209455_1015820 Ga0209455_10158203 326
122 3300025273 Ga0209673_1017486 Ga0209673_10174861 326
123 3300025292 Ga0209676_1001342 Ga0209676_10013426 326
124 3300025292 Ga0209676_1042798 Ga0209676_10427982 326
125 3300025294 Ga0209025_1000515 Ga0209025_100051510 326
126 3300025295 Ga0209564_1000680 Ga0209564_100068036 326
127 3300025295 Ga0209564_1012482 Ga0209564_10124823 326
128 3300025297 Ga0209758_1000002 Ga0209758_10000021133 326
129 3300025297 Ga0209758_1000007 Ga0209758_1000007754 326
130 3300025298 Ga0209050_1000001 Ga0209050_10000011121 326
131 3300025298 Ga0209050_1000051 Ga0209050_1000051164 326
132 3300025298 Ga0209050_1000483 Ga0209050_10004832 326
133 3300025298 Ga0209050_1017333 Ga0209050_10173333 326
134 3300025298 Ga0209050_1045283 Ga0209050_10452831 326
135 3300025303 Ga0209051_1000999 Ga0209051_10009997 326
136 3300025304 Ga0209257_1000028 Ga0209257_1000028204 326
137 3300025304 Ga0209257_1001517 Ga0209257_100151712 326
138 3300025304 Ga0209257_1001522 Ga0209257_100152213 326
139 3300025315 Ga0207697_10016191 Ga0207697_100161912 326
140 3300025901 Ga0207688_10021302 Ga0207688_100213023 326
141 3300025904 Ga0207647_10099925 Ga0207647_100999252 326
142 3300025907 Ga0207645_10044628 Ga0207645_100446284 326
143 3300025909 Ga0207705_10000350 Ga0207705_1000035020 326
144 3300025911 Ga0207654_10001225 Ga0207654_1000122511 326
145 3300025913 Ga0207695_10074872 Ga0207695_100748724 326
146 3300025913 Ga0207695_10376939 Ga0207695_103769392 326
147 3300025919 Ga0207657_10003808 Ga0207657_1000380811 326
148 3300025920 Ga0207649_10003468 Ga0207649_100034685 326
149 3300025927 Ga0207687_10010931 Ga0207687_100109312 326
150 3300025932 Ga0207690_10009597 Ga0207690_100095976 326
151 3300025933 Ga0207706_10033446 Ga0207706_100334461 326
152 3300025935 Ga0207709_10000005 Ga0207709_10000005546 326
153 3300025937 Ga0207669_10000356 Ga0207669_1000035613 326
154 3300025940 Ga0207691_10079463 Ga0207691_100794635 326
155 3300025940 Ga0207691_10320225 Ga0207691_103202251 326
156 3300025941 Ga0207711_10015217 Ga0207711_100152172 326
157 3300025949 Ga0207667_10000001 Ga0207667_100000011066 326
158 3300025972 Ga0207668_10173148 Ga0207668_101731482 326
159 3300025981 Ga0207640_10013176 Ga0207640_100131765 326
160 3300025981 Ga0207640_10107715 Ga0207640_101077154 326
161 3300026035 Ga0207703_10000711 Ga0207703_1000071133 326
162 3300026041 Ga0207639_10002702 Ga0207639_100027029 326
163 3300026041 Ga0207639_10034637 Ga0207639_100346374 326
164 3300026041 Ga0207639_10045705 Ga0207639_100457053 326
165 3300026067 Ga0207678_10044072 Ga0207678_100440726 326
166 3300026078 Ga0207702_10016086 Ga0207702_100160866 326
167 3300026095 Ga0207676_10000351 Ga0207676_1000035136 326
168 3300026121 Ga0207683_10000605 Ga0207683_1000060520 326
169 3300026142 Ga0207698_10017172 Ga0207698_100171725 326
170 3300028379 Ga0268266_10269125 Ga0268266_102691252 326
171 3300028380 Ga0268265_10177676 Ga0268265_101776761 326
172 3300028786 Ga0307517_10065908 Ga0307517_100659087 326
173 3300028786 Ga0307517_10115951 Ga0307517_101159512 326
174 3300031456 Ga0307513_10024830 Ga0307513_100248305 326
175 3300031456 Ga0307513_10073482 Ga0307513_100734825 326
176 3300031456 Ga0307513_10080558 Ga0307513_100805584 326
177 3300031507 Ga0307509_10124251 Ga0307509_101242513 326
178 3300031616 Ga0307508_10000166 Ga0307508_1000016641 326
179 3300031911 Ga0307412_10059577 Ga0307412_100595773 326
180 3300033180 Ga0307510_10000081 Ga0307510_1000008124 326
181 3300038443 Ga0395901_0101671 Ga0395901_0101671_985_1992 326
182 3300041404 Ga0439436_0009278 Ga0439436_0009278_33_1031 326
183 3300041404 Ga0439436_0012005 Ga0439436_0012005_431_1423 326
184 3300041406 Ga0439439_0001789 Ga0439439_0001789_1848_2840 326
185 3300041407 Ga0439447_026022 Ga0439447_026022_322_1320 326
186 3300041410 Ga0439461_0000027 Ga0439461_0000027_6898_7890 326
187 3300041410 Ga0439461_0022496 Ga0439461_0022496_51_1043 326
188 3300041411 Ga0439466_0022164 Ga0439466_0022164_1015_2007 326
189 3300041413 Ga0439465_0000555 Ga0439465_0000555_3856_4848 326
190 3300041413 Ga0439465_0004009 Ga0439465_0004009_1603_2601 326
191 3300041997 Ga0439431_0002380 Ga0439431_0002380_418_1410 326
192 3300041997 Ga0439431_0014035 Ga0439431_0014035_313_1311 326
193 3300042002 Ga0439442_003046 Ga0439442_003046_1878_2870 326
194 3300042004 Ga0439445_0000241 Ga0439445_0000241_5517_6509 326
195 3300042004 Ga0439445_0012089 Ga0439445_0012089_337_1335 326
196 3300042004 Ga0439445_0017551 Ga0439445_0017551_577_1575 326
197 3300042006 Ga0439432_001358 Ga0439432_001358_4138_5130 326
198 3300042006 Ga0439432_015867 Ga0439432_015867_1300_2298 326
199 3300042015 Ga0439462_0001825 Ga0439462_0001825_190_1182 326
200 3300046453 Ga0495627_048963 Ga0495627_048963_184_1176 326
201 3300046460 Ga0495638_0000266 Ga0495638_0000266_4285_5286 326
202 3300046460 Ga0495638_0069487 Ga0495638_0069487_547_1545 326
203 3300046471 Ga0495650_0001698 Ga0495650_0001698_5111_6109 326
204 3300046491 Ga0495584_0005300 Ga0495584_0005300_4434_5432 326
205 3300046492 Ga0495585_0002637 Ga0495585_0002637_7116_8111 326
206 3300046506 Ga0495583_0005610 Ga0495583_0005610_438_1439 326
207 3300046506 Ga0495583_0046945 Ga0495583_0046945_307_1305 326
208 3300046506 Ga0495583_0055122 Ga0495583_0055122_706_1701 326
209 3300046506 Ga0495583_0103147 Ga0495583_0103147_135_1133 326
210 3300046507 Ga0495606_0001895 Ga0495606_0001895_10930_11925 326
211 3300046507 Ga0495606_0027805 Ga0495606_0027805_2017_3015 326
212 3300046513 Ga0495616_0010730 Ga0495616_0010730_2713_3708 326
213 3300046518 Ga0495631_0001519 Ga0495631_0001519_12839_13837 326
214 3300046518 Ga0495631_0069420 Ga0495631_0069420_389_1387 326
215 3300046522 Ga0495643_0000762 Ga0495643_0000762_18652_19650 326
216 3300046522 Ga0495643_0004533 Ga0495643_0004533_32_1030 326
217 3300046524 Ga0495648_0000809 Ga0495648_0000809_5247_6245 326
218 3300046524 Ga0495648_0010353 Ga0495648_0010353_699_1706 326
219 3300046524 Ga0495648_0079506 Ga0495648_0079506_803_1798 326
220 3300046524 Ga0495648_0164057 Ga0495648_0164057_67_1062 326
221 3300046525 Ga0495663_0031422 Ga0495663_0031422_555_1535 326
222 3300046528 Ga0495642_0022746 Ga0495642_0022746_106_1104 326
223 3300046530 Ga0495654_0001867 Ga0495654_0001867_8388_9368 326
224 3300046558 Ga0495633_0002763 Ga0495633_0002763_1202_2200 326
225 3300046616 Ga0495668_0000059 Ga0495668_0000059_177385_178383 326
226 3300046616 Ga0495668_0002552 Ga0495668_0002552_8051_9031 326
227 3300046648 Ga0495611_0008277 Ga0495611_0008277_667_1665 326
228 3300046660 Ga0495625_0000274 Ga0495625_0000274_59368_60369 326
229 3300046660 Ga0495625_0001644 Ga0495625_0001644_10609_11607 326
230 3300046660 Ga0495625_0003774 Ga0495625_0003774_4882_5880 326
231 3300046660 Ga0495625_0004006 Ga0495625_0004006_346_1344 326
232 3300046684 Ga0495669_0000107 Ga0495669_0000107_41405_42403 326
233 3300046691 Ga0495670_0000036 Ga0495670_0000036_39936_40940 326
234 3300046691 Ga0495670_0045474 Ga0495670_0045474_92_1087 326
235 3300046692 Ga0495671_0016420 Ga0495671_0016420_1112_2113 326
236 3300046694 Ga0495649_0016788 Ga0495649_0016788_869_1867 326
237 3300046809 Ga0495600_0055656 Ga0495600_0055656_53_1051 326
238 3300046810 Ga0495660_0132605 Ga0495660_0132605_45_1043 326
239 3300047443 Ga0495687_000181 Ga0495687_000181_6185_7183 326
240 3300047443 Ga0495687_000286 Ga0495687_000286_14220_15215 326
241 3300047445 Ga0495677_0005239 Ga0495677_0005239_2404_3405 326
242 3300047445 Ga0495677_0043446 Ga0495677_0043446_95_1093 326
243 3300047470 Ga0495681_0004350 Ga0495681_0004350_690_1685 326
244 3300047472 Ga0495686_0000209 Ga0495686_0000209_18791_19786 326
245 3300047472 Ga0495686_0019543 Ga0495686_0019543_2386_3444 326
246 3300048905 Ga0496102_0000497 Ga0496102_0000497_29059_30057 326
247 3300048906 Ga0496103_0000205 Ga0496103_0000205_29683_30681 326
248 3300048908 Ga0496105_0000881 Ga0496105_0000881_6455_7453 326
249 3300048914 Ga0496111_0005587 Ga0496111_0005587_6391_7389 326
250 3300048917 Ga0496114_0037394 Ga0496114_0037394_32_1030 326
251 3300048918 Ga0496115_0000197 Ga0496115_0000197_28236_29234 326
252 3300048918 Ga0496115_0000522 Ga0496115_0000522_13849_14847 326
253 3300048918 Ga0496115_0313552 Ga0496115_0313552_269_1270 326
254 3300048919 Ga0496116_0000685 Ga0496116_0000685_27146_28144 326
255 3300048920 Ga0496117_0000628 Ga0496117_0000628_29076_30074 326
256 3300048921 Ga0496118_0000154 Ga0496118_0000154_46154_47152 326
257 3300048922 Ga0496119_0001965 Ga0496119_0001965_18271_19269 326
258 3300048923 Ga0496120_0013373 Ga0496120_0013373_639_1637 326
259 3300048924 Ga0496121_0000335 Ga0496121_0000335_75235_76239 326
260 3300048924 Ga0496121_0000986 Ga0496121_0000986_22840_23838 326
261 3300048924 Ga0496121_0172496 Ga0496121_0172496_287_1282 326
262 3300048925 Ga0496122_0048012 Ga0496122_0048012_2141_3139 326
263 3300048926 Ga0496123_0010147 Ga0496123_0010147_807_1805 326
264 3300048926 Ga0496123_0018742 Ga0496123_0018742_3012_4043 326
265 3300048927 Ga0496124_0000655 Ga0496124_0000655_29085_30083 326
266 3300048927 Ga0496124_0001312 Ga0496124_0001312_1131_2162 326
267 3300048927 Ga0496124_0037572 Ga0496124_0037572_608_1606 326
268 3300048927 Ga0496124_0052849 Ga0496124_0052849_575_1606 326
269 3300048928 Ga0496125_0001506 Ga0496125_0001506_25584_26582 326
270 3300048929 Ga0496126_0000501 Ga0496126_0000501_46873_47871 326
271 3300049758 Ga0501241_010062 Ga0501241_010062_670_1668 326
272 3300053079 Ga0500610_0028866 Ga0500610_0028866_1094_2092 326
273 3300053087 Ga0500643_000001 Ga0500643_000001_261178_262185 326
274 3300053087 Ga0500643_000467 Ga0500643_000467_28551_29531 326
275 3300053087 Ga0500643_000850 Ga0500643_000850_722_1720 326
276 3300053087 Ga0500643_006324 Ga0500643_006324_1785_2777 326
277 3300053094 Ga0500566_0000251 Ga0500566_0000251_16775_17773 326
278 3300053096 Ga0500641_0000748 Ga0500641_0000748_5492_6493 326
279 3300053119 Ga0500595_001306 Ga0500595_001306_7996_8997 326
280 3300053119 Ga0500595_016196 Ga0500595_016196_1638_2636 326
281 3300053130 Ga0500642_0001077 Ga0500642_0001077_667_1665 326
282 3300053134 Ga0500658_0002012 Ga0500658_0002012_4315_5319 326
283 3300053134 Ga0500658_0009116 Ga0500658_0009116_1488_2480 326
284 3300053134 Ga0500658_0040720 Ga0500658_0040720_569_1564 326
285 3300053140 Ga0500573_0000040 Ga0500573_0000040_25457_26494 326
286 3300053157 Ga0500624_000075 Ga0500624_000075_46567_47574 326
287 3300053158 Ga0500627_0002029 Ga0500627_0002029_4600_5580 326
288 3300053158 Ga0500627_0024189 Ga0500627_0024189_691_1698 326
289 3300053177 Ga0500636_0031239 Ga0500636_0031239_2078_3076 326
290 3300053178 Ga0500637_0000049 Ga0500637_0000049_33163_34170 326
291 3300053730 Ga0500645_000389 Ga0500645_000389_832_1830 326
292 3300053735 Ga0500596_002758 Ga0500596_002758_899_1897 326
293 3300059421 Ga0590071_010536 Ga0590071_010536_694_1689 326
294 iso_pu_bacteria 2928027323 2928028272 326
295 iso_pu_bacteria 2984555340 2984556243 326
296 iso_pu_bacteria 2984564862 2984565589 326
297 iso_pu_bacteria 2990265787 2990265902 326
298 iso_pu_bacteria 2993356040 2993356660 326
299 iso_pu_bacteria 2993693658 2993696307 326
300 3300005331 Ga0070670_100057367 Ga0070670_1000573673 327
301 3300005347 Ga0070668_100000021 Ga0070668_10000002144 327
302 3300005355 Ga0070671_100000114 Ga0070671_10000011416 327
303 3300005530 Ga0070679_100098272 Ga0070679_1000982723 327
304 3300005548 Ga0070665_100073658 Ga0070665_1000736582 327
305 3300005563 Ga0068855_100001082 Ga0068855_10000108224 327
306 3300005617 Ga0068859_100036585 Ga0068859_1000365853 327
307 3300005841 Ga0068863_100000043 Ga0068863_10000004345 327
308 3300005843 Ga0068860_100261637 Ga0068860_1002616372 327
309 3300005844 Ga0068862_100038858 Ga0068862_1000388583 327
310 3300006931 Ga0097620_100036585 Ga0097620_1000365853 327
311 3300009093 Ga0105240_10011621 Ga0105240_100116214 327
312 3300009551 Ga0105238_10047423 Ga0105238_100474234 327
313 3300009553 Ga0105249_10003685 Ga0105249_100036856 327
314 3300013296 Ga0157374_10163835 Ga0157374_101638352 327
315 3300025920 Ga0207649_10068638 Ga0207649_100686383 327
316 3300025921 Ga0207652_10122250 Ga0207652_101222502 327
317 3300025924 Ga0207694_10264461 Ga0207694_102644612 327
318 3300025931 Ga0207644_10000077 Ga0207644_1000007743 327
319 3300025949 Ga0207667_10005618 Ga0207667_1000561811 327
320 3300025961 Ga0207712_10015689 Ga0207712_100156892 327
321 3300025972 Ga0207668_10000068 Ga0207668_1000006844 327
322 3300026078 Ga0207702_10134773 Ga0207702_101347732 327
323 3300026088 Ga0207641_10000031 Ga0207641_1000003148 327
324 3300028379 Ga0268266_10070814 Ga0268266_100708143 327
325 3300028380 Ga0268265_10038178 Ga0268265_100381783 327
326 3300028381 Ga0268264_10119827 Ga0268264_101198272 327
327 3300002067 JGI24735J21928_10006836 JGI24735J21928_100068362 328
328 3300002075 JGI24738J21930_10002202 JGI24738J21930_100022023 328
329 3300003214 JGI25165J46597_1000040 JGI25165J46597_100004082 328
330 3300003762 Ga0055542_1004902 Ga0055542_10049022 328
331 3300005289 Ga0065704_10087891 Ga0065704_100878913 328
332 3300005327 Ga0070658_10000022 Ga0070658_10000022110 328
333 3300005327 Ga0070658_10024485 Ga0070658_100244855 328
334 3300005327 Ga0070658_10055698 Ga0070658_100556982 328
335 3300005327 Ga0070658_10169110 Ga0070658_101691102 328
336 3300005331 Ga0070670_100003193 Ga0070670_10000319313 328
337 3300005335 Ga0070666_10000054 Ga0070666_1000005471 328
338 3300005339 Ga0070660_100000568 Ga0070660_10000056814 328
339 3300005339 Ga0070660_100000801 Ga0070660_10000080117 328
340 3300005347 Ga0070668_100004064 Ga0070668_1000040647 328
341 3300005353 Ga0070669_100000097 Ga0070669_10000009777 328
342 3300005353 Ga0070669_100032516 Ga0070669_1000325161 328
343 3300005355 Ga0070671_100000041 Ga0070671_10000004183 328
344 3300005356 Ga0070674_100157323 Ga0070674_1001573232 328
345 3300005366 Ga0070659_100051584 Ga0070659_1000515843 328
346 3300005367 Ga0070667_100000030 Ga0070667_10000003089 328
347 3300005457 Ga0070662_100023766 Ga0070662_1000237664 328
348 3300005539 Ga0068853_100038790 Ga0068853_1000387904 328
349 3300005539 Ga0068853_100063651 Ga0068853_1000636514 328
350 3300005548 Ga0070665_100000011 Ga0070665_100000011434 328
351 3300005548 Ga0070665_100355272 Ga0070665_1003552722 328
352 3300005548 Ga0070665_100414951 Ga0070665_1004149512 328
353 3300005563 Ga0068855_100000371 Ga0068855_10000037134 328
354 3300005563 Ga0068855_100150685 Ga0068855_1001506853 328
355 3300005577 Ga0068857_100016268 Ga0068857_1000162684 328
356 3300005578 Ga0068854_100014314 Ga0068854_1000143143 328
357 3300005578 Ga0068854_100065251 Ga0068854_1000652514 328
358 3300005614 Ga0068856_100011374 Ga0068856_10001137410 328
359 3300005614 Ga0068856_100207705 Ga0068856_1002077052 328
360 3300005616 Ga0068852_100002341 Ga0068852_10000234110 328
361 3300005616 Ga0068852_100205455 Ga0068852_1002054553 328
362 3300005617 Ga0068859_100001817 Ga0068859_1000018175 328
363 3300005618 Ga0068864_100003001 Ga0068864_1000030013 328
364 3300005719 Ga0068861_100009406 Ga0068861_1000094065 328
365 3300005834 Ga0068851_10020928 Ga0068851_100209282 328
366 3300005841 Ga0068863_100000049 Ga0068863_100000049107 328
367 3300005841 Ga0068863_100002305 Ga0068863_1000023059 328
368 3300005842 Ga0068858_100003256 Ga0068858_10000325616 328
369 3300005843 Ga0068860_100001377 Ga0068860_10000137710 328
370 3300005843 Ga0068860_100087306 Ga0068860_1000873063 328
371 3300005843 Ga0068860_100121565 Ga0068860_1001215652 328
372 3300005844 Ga0068862_100000576 Ga0068862_10000057637 328
373 3300006237 Ga0097621_100035801 Ga0097621_1000358011 328
374 3300006353 Ga0075370_10041560 Ga0075370_100415602 328
375 3300006846 Ga0075430_100014766 Ga0075430_1000147666 328
376 3300006931 Ga0097620_100001817 Ga0097620_1000018175 328
377 3300009011 Ga0105251_10088608 Ga0105251_100886082 328
378 3300009093 Ga0105240_10017250 Ga0105240_100172505 328
379 3300009093 Ga0105240_10088337 Ga0105240_100883372 328
380 3300009101 Ga0105247_10010807 Ga0105247_100108072 328
381 3300009101 Ga0105247_10023908 Ga0105247_100239084 328
382 3300009177 Ga0105248_10016882 Ga0105248_100168829 328
383 3300009545 Ga0105237_10003433 Ga0105237_100034338 328
384 3300009545 Ga0105237_10101634 Ga0105237_101016344 328
385 3300009551 Ga0105238_10320305 Ga0105238_103203051 328
386 3300009553 Ga0105249_10000065 Ga0105249_1000006557 328
387 3300009553 Ga0105249_10000424 Ga0105249_1000042439 328
388 3300013100 Ga0157373_10028936 Ga0157373_100289366 328
389 3300013104 Ga0157370_10000117 Ga0157370_1000011746 328
390 3300013105 Ga0157369_10002806 Ga0157369_100028067 328
391 3300013105 Ga0157369_10009587 Ga0157369_100095872 328
392 3300013306 Ga0163162_10003734 Ga0163162_100037345 328
393 3300013307 Ga0157372_10100207 Ga0157372_101002072 328
394 3300014325 Ga0163163_10255124 Ga0163163_102551242 328
395 3300014968 Ga0157379_10284618 Ga0157379_102846181 328
396 3300021384 Ga0213876_10003358 Ga0213876_100033589 328
397 3300021388 Ga0213875_10000135 Ga0213875_1000013595 328
398 3300025231 Ga0207427_101501 Ga0207427_10150110 328
399 3300025250 Ga0209026_1000641 Ga0209026_100064112 328
400 3300025254 Ga0209148_1000147 Ga0209148_1000147133 328
401 3300025254 Ga0209148_1002072 Ga0209148_10020723 328
402 3300025261 Ga0209233_1000003 Ga0209233_1000003401 328
403 3300025272 Ga0209455_1003120 Ga0209455_10031205 328
404 3300025272 Ga0209455_1013427 Ga0209455_10134272 328
405 3300025900 Ga0207710_10011684 Ga0207710_100116843 328
406 3300025904 Ga0207647_10035059 Ga0207647_100350592 328
407 3300025904 Ga0207647_10035686 Ga0207647_100356863 328
408 3300025909 Ga0207705_10000236 Ga0207705_1000023644 328
409 3300025909 Ga0207705_10011211 Ga0207705_100112118 328
410 3300025909 Ga0207705_10118700 Ga0207705_101187002 328
411 3300025909 Ga0207705_10129683 Ga0207705_101296831 328
412 3300025913 Ga0207695_10020519 Ga0207695_100205198 328
413 3300025913 Ga0207695_10062774 Ga0207695_100627742 328
414 3300025914 Ga0207671_10004798 Ga0207671_100047988 328
415 3300025914 Ga0207671_10113452 Ga0207671_101134522 328
416 3300025919 Ga0207657_10000837 Ga0207657_100008376 328
417 3300025919 Ga0207657_10001189 Ga0207657_1000118915 328
418 3300025923 Ga0207681_10220131 Ga0207681_102201312 328
419 3300025925 Ga0207650_10011625 Ga0207650_100116255 328
420 3300025932 Ga0207690_10023901 Ga0207690_100239013 328
421 3300025933 Ga0207706_10007744 Ga0207706_100077446 328
422 3300025941 Ga0207711_10008299 Ga0207711_100082995 328
423 3300025941 Ga0207711_10041833 Ga0207711_100418334 328
424 3300025949 Ga0207667_10000017 Ga0207667_10000017312 328
425 3300025949 Ga0207667_10024489 Ga0207667_100244897 328
426 3300025949 Ga0207667_10399124 Ga0207667_103991242 328
427 3300025961 Ga0207712_10000002 Ga0207712_10000002316 328
428 3300025961 Ga0207712_10013167 Ga0207712_100131673 328
429 3300025972 Ga0207668_10000066 Ga0207668_1000006626 328
430 3300025972 Ga0207668_10011349 Ga0207668_100113497 328
431 3300025981 Ga0207640_10000653 Ga0207640_100006535 328
432 3300025981 Ga0207640_10105705 Ga0207640_101057051 328
433 3300025986 Ga0207658_10000019 Ga0207658_1000001990 328
434 3300025986 Ga0207658_10029314 Ga0207658_100293144 328
435 3300026041 Ga0207639_10027527 Ga0207639_100275274 328
436 3300026041 Ga0207639_10141987 Ga0207639_101419872 328
437 3300026041 Ga0207639_10186971 Ga0207639_101869712 328
438 3300026067 Ga0207678_10000656 Ga0207678_1000065622 328
439 3300026067 Ga0207678_10115873 Ga0207678_101158731 328
440 3300026078 Ga0207702_10006436 Ga0207702_1000643612 328
441 3300026078 Ga0207702_10278811 Ga0207702_102788112 328
442 3300026088 Ga0207641_10000029 Ga0207641_10000029106 328
443 3300026088 Ga0207641_10058731 Ga0207641_100587313 328
444 3300026116 Ga0207674_10007690 Ga0207674_100076907 328
445 3300026116 Ga0207674_10042262 Ga0207674_100422622 328
446 3300026118 Ga0207675_100000732 Ga0207675_1000007325 328
447 3300026142 Ga0207698_10000385 Ga0207698_1000038526 328
448 3300028379 Ga0268266_10000058 Ga0268266_1000005897 328
449 3300028379 Ga0268266_10000171 Ga0268266_1000017173 328
450 3300028381 Ga0268264_10000562 Ga0268264_1000056224 328
451 3300028381 Ga0268264_10074261 Ga0268264_100742612 328
452 3300031731 Ga0307405_10005990 Ga0307405_100059903 328
453 3300031852 Ga0307410_10025284 Ga0307410_100252842 328
454 3300031901 Ga0307406_10111940 Ga0307406_101119402 328
455 3300032002 Ga0307416_100027869 Ga0307416_1000278693 328
456 3300032126 Ga0307415_100040481 Ga0307415_1000404812 328
457 3300037312 Ga0395899_0002159 Ga0395899_0002159_3226_4236 328
458 3300037471 Ga0395905_0067724 Ga0395905_0067724_2116_3117 328
459 3300039437 Ga0436365_0380590 Ga0436365_0380590_59298_60326 328
460 3300039437 Ga0436365_0478409 Ga0436365_0478409_7792_8799 328
461 3300039437 Ga0436365_0567097 Ga0436365_0567097_2734_3759 328
462 3300042005 Ga0439448_0002591 Ga0439448_0002591_2402_3427 328
463 3300042005 Ga0439448_0010657 Ga0439448_0010657_1202_2209 328
464 3300042012 Ga0439455_0001161 Ga0439455_0001161_2313_3338 328
465 3300042012 Ga0439455_0022726 Ga0439455_0022726_26_1033 328
466 3300042157 Ga0439458_0002017 Ga0439458_0002017_2353_3360 328
467 3300044658 Ga0466972_0000559 Ga0466972_0000559_8798_9847 328
468 3300044693 Ga0466961_0010692 Ga0466961_0010692_1319_2332 328
469 3300044765 Ga0466970_0042819 Ga0466970_0042819_1271_2284 328
470 3300045049 Ga0466959_0011041 Ga0466959_0011041_1941_2954 328
471 3300045836 Ga0466958_0024547 Ga0466958_0024547_1522_2535 328
472 3300046460 Ga0495638_0029884 Ga0495638_0029884_372_1376 328
473 3300046471 Ga0495650_0001670 Ga0495650_0001670_7494_8498 328
474 3300046513 Ga0495616_0000213 Ga0495616_0000213_12937_13953 328
475 3300046616 Ga0495668_0050121 Ga0495668_0050121_287_1303 328
476 3300047469 Ga0495673_0053086 Ga0495673_0053086_505_1515 328
477 3300047472 Ga0495686_0000366 Ga0495686_0000366_65500_66510 328
478 3300048920 Ga0496117_0124189 Ga0496117_0124189_334_1344 328
479 3300048921 Ga0496118_0135611 Ga0496118_0135611_200_1210 328
480 3300048924 Ga0496121_0000650 Ga0496121_0000650_39853_40863 328
481 3300048927 Ga0496124_0225959 Ga0496124_0225959_322_1326 328
482 3300048928 Ga0496125_0068144 Ga0496125_0068144_847_1848 328
483 3300048929 Ga0496126_0006072 Ga0496126_0006072_8060_9070 328
484 3300049570 Ga0501033_0037409 Ga0501033_0037409_1499_2509 328
485 3300049571 Ga0501034_0095285 Ga0501034_0095285_744_1775 328
486 3300049823 Ga0501044_0009707 Ga0501044_0009707_2618_3628 328
487 3300050509 nmdc:mga0qj67_5921_c1 nmdc:mga0qj67_5921_c1_2165_3181 328
488 3300053151 Ga0500604_0000055 Ga0500604_0000055_35042_36055 328
489 3300053157 Ga0500624_000215 Ga0500624_000215_901_1902 328
490 3300053158 Ga0500627_0002503 Ga0500627_0002503_4225_5241 328
491 3300053739 Ga0500587_000861 Ga0500587_000861_2534_3541 328
492 3300001976 JGI24752J21851_1000253 JGI24752J21851_10002532 329
493 3300001989 JGI24739J22299_10009020 JGI24739J22299_100090203 329
494 3300002077 JGI24744J21845_10003666 JGI24744J21845_100036662 329
495 3300005289 Ga0065704_10094426 Ga0065704_100944262 329
496 3300005295 Ga0065707_10082279 Ga0065707_100822795 329
497 3300005327 Ga0070658_10000050 Ga0070658_100000509 329
498 3300005328 Ga0070676_10001276 Ga0070676_100012765 329
499 3300005331 Ga0070670_100000215 Ga0070670_10000021523 329
500 3300005334 Ga0068869_100000159 Ga0068869_10000015922 329
501 3300005338 Ga0068868_100000074 Ga0068868_10000007444 329
502 3300005339 Ga0070660_100007623 Ga0070660_1000076233 329
503 3300005344 Ga0070661_100212878 Ga0070661_1002128782 329
504 3300005354 Ga0070675_100007766 Ga0070675_1000077663 329
505 3300005355 Ga0070671_100046896 Ga0070671_1000468963 329
506 3300005364 Ga0070673_100000008 Ga0070673_100000008131 329
507 3300005367 Ga0070667_100000188 Ga0070667_10000018832 329
508 3300005367 Ga0070667_100000311 Ga0070667_10000031123 329
509 3300005456 Ga0070678_100151796 Ga0070678_1001517962 329
510 3300005457 Ga0070662_100031618 Ga0070662_1000316183 329
511 3300005459 Ga0068867_100000003 Ga0068867_10000000322 329
512 3300005543 Ga0070672_100009714 Ga0070672_1000097144 329
513 3300005543 Ga0070672_100145215 Ga0070672_1001452152 329
514 3300005578 Ga0068854_100001249 Ga0068854_10000124911 329
515 3300005578 Ga0068854_100047792 Ga0068854_1000477922 329
516 3300005616 Ga0068852_100260231 Ga0068852_1002602312 329
517 3300005616 Ga0068852_100389257 Ga0068852_1003892572 329
518 3300005617 Ga0068859_100015829 Ga0068859_1000158298 329
519 3300005618 Ga0068864_100000080 Ga0068864_10000008074 329
520 3300005841 Ga0068863_100000087 Ga0068863_10000008774 329
521 3300005843 Ga0068860_100000013 Ga0068860_100000013314 329
522 3300005844 Ga0068862_100000101 Ga0068862_10000010174 329
523 3300006881 Ga0068865_100000002 Ga0068865_100000002237 329
524 3300006931 Ga0097620_100015829 Ga0097620_1000158298 329
525 3300009011 Ga0105251_10000248 Ga0105251_1000024827 329
526 3300009098 Ga0105245_10000184 Ga0105245_1000018444 329
527 3300009101 Ga0105247_10001581 Ga0105247_100015817 329
528 3300009148 Ga0105243_10000031 Ga0105243_1000003122 329
529 3300009176 Ga0105242_10000171 Ga0105242_1000017122 329
530 3300009177 Ga0105248_10000029 Ga0105248_10000029122 329
531 3300009177 Ga0105248_10028248 Ga0105248_100282482 329
532 3300009551 Ga0105238_10043691 Ga0105238_100436912 329
533 3300009553 Ga0105249_10000024 Ga0105249_10000024114 329
534 3300011119 Ga0105246_10000056 Ga0105246_1000005621 329
535 3300013297 Ga0157378_10000205 Ga0157378_1000020522 329
536 3300013306 Ga0163162_10245565 Ga0163162_102455651 329
537 3300013308 Ga0157375_10003415 Ga0157375_100034153 329
538 3300014968 Ga0157379_10210980 Ga0157379_102109802 329
539 3300014969 Ga0157376_10000148 Ga0157376_1000014822 329
540 3300025735 Ga0207713_1024835 Ga0207713_10248352 329
541 3300025900 Ga0207710_10001917 Ga0207710_100019172 329
542 3300025907 Ga0207645_10003054 Ga0207645_100030545 329
543 3300025909 Ga0207705_10000014 Ga0207705_10000014393 329
544 3300025919 Ga0207657_10016781 Ga0207657_100167814 329
545 3300025924 Ga0207694_10025630 Ga0207694_100256302 329
546 3300025924 Ga0207694_10087684 Ga0207694_100876844 329
547 3300025925 Ga0207650_10000261 Ga0207650_1000026128 329
548 3300025926 Ga0207659_10017796 Ga0207659_100177963 329
549 3300025927 Ga0207687_10001967 Ga0207687_100019674 329
550 3300025932 Ga0207690_10006218 Ga0207690_100062186 329
551 3300025934 Ga0207686_10000178 Ga0207686_1000017835 329
552 3300025935 Ga0207709_10000237 Ga0207709_1000023722 329
553 3300025938 Ga0207704_10000003 Ga0207704_1000000322 329
554 3300025940 Ga0207691_10057992 Ga0207691_100579922 329
555 3300025940 Ga0207691_10120038 Ga0207691_101200382 329
556 3300025941 Ga0207711_10000004 Ga0207711_10000004384 329
557 3300025941 Ga0207711_10020471 Ga0207711_100204714 329
558 3300025942 Ga0207689_10001018 Ga0207689_1000101822 329
559 3300025960 Ga0207651_10000003 Ga0207651_1000000322 329
560 3300025961 Ga0207712_10000034 Ga0207712_10000034114 329
561 3300025961 Ga0207712_10002044 Ga0207712_100020443 329
562 3300025961 Ga0207712_10099057 Ga0207712_100990572 329
563 3300025981 Ga0207640_10002633 Ga0207640_100026336 329
564 3300025986 Ga0207658_10000145 Ga0207658_1000014547 329
565 3300025986 Ga0207658_10000239 Ga0207658_1000023928 329
566 3300026023 Ga0207677_10000194 Ga0207677_1000019422 329
567 3300026088 Ga0207641_10000010 Ga0207641_1000001027 329
568 3300026088 Ga0207641_10006908 Ga0207641_100069084 329
569 3300026088 Ga0207641_10012604 Ga0207641_100126044 329
570 3300026089 Ga0207648_10000007 Ga0207648_10000007170 329
571 3300026095 Ga0207676_10000036 Ga0207676_1000003670 329
572 3300026121 Ga0207683_10004322 Ga0207683_100043221 329
573 3300026142 Ga0207698_10073492 Ga0207698_100734922 329
574 3300028380 Ga0268265_10000059 Ga0268265_1000005923 329
575 3300028381 Ga0268264_10000039 Ga0268264_10000039309 329
576 3300031456 Ga0307513_10036193 Ga0307513_100361933 329
577 3300031731 Ga0307405_10004519 Ga0307405_100045192 329
578 3300032002 Ga0307416_100078608 Ga0307416_1000786083 329
579 3300046460 Ga0495638_0017145 Ga0495638_0017145_2891_3898 329
580 3300046506 Ga0495583_0000023 Ga0495583_0000023_96531_97538 329
581 3300046507 Ga0495606_0001237 Ga0495606_0001237_32786_33859 329
582 3300046616 Ga0495668_0036035 Ga0495668_0036035_1739_2749 329
583 3300047472 Ga0495686_0000132 Ga0495686_0000132_34761_35771 329
584 3300047472 Ga0495686_0000741 Ga0495686_0000741_6045_7136 329
585 3300047472 Ga0495686_0007896 Ga0495686_0007896_6278_7291 329
586 3300047472 Ga0495686_0116934 Ga0495686_0116934_235_1248 329
587 3300048904 Ga0496101_0043257 Ga0496101_0043257_1284_2273 329
588 3300048920 Ga0496117_0018287 Ga0496117_0018287_270_1280 329
589 3300048920 Ga0496117_0106479 Ga0496117_0106479_418_1482 329
590 3300048921 Ga0496118_0000335 Ga0496118_0000335_43075_44064 329
591 3300048921 Ga0496118_0008136 Ga0496118_0008136_6634_7650 329
592 3300048924 Ga0496121_0051848 Ga0496121_0051848_1009_2019 329
593 3300048925 Ga0496122_0002744 Ga0496122_0002744_512_1552 329
594 3300048925 Ga0496122_0014321 Ga0496122_0014321_1201_2211 329
595 3300048926 Ga0496123_0001272 Ga0496123_0001272_22763_23803 329
596 3300048926 Ga0496123_0006046 Ga0496123_0006046_4627_5637 329
597 3300048926 Ga0496123_0154106 Ga0496123_0154106_128_1135 329
598 3300048927 Ga0496124_0033521 Ga0496124_0033521_579_1619 329
599 3300049515 Ga0501292_000008 Ga0501292_000008_5763_6767 329
600 3300049523 Ga0501300_000388 Ga0501300_000388_153_1157 329
601 3300049569 Ga0501032_0065491 Ga0501032_0065491_708_1727 329
602 3300049581 Ga0501047_0005316 Ga0501047_0005316_8401_9420 329
603 3300049662 Ga0501222_000204 Ga0501222_000204_4340_5344 329
604 3300049663 Ga0501223_001803 Ga0501223_001803_3508_4512 329
605 3300049665 Ga0501227_012280 Ga0501227_012280_632_1636 329
606 3300049686 Ga0501257_000122 Ga0501257_000122_654_1664 329
607 3300049690 Ga0501261_000020 Ga0501261_000020_29447_30574 329
608 3300049775 Ga0501279_000002 Ga0501279_000002_77695_78699 329
609 3300049776 Ga0501280_000010 Ga0501280_000010_41142_42146 329
610 3300049776 Ga0501280_003806 Ga0501280_003806_183_1193 329
611 3300049778 Ga0501282_001212 Ga0501282_001212_604_1608 329
612 3300049779 Ga0501283_002667 Ga0501283_002667_1192_2196 329
613 3300049822 Ga0501035_0063647 Ga0501035_0063647_735_1754 329
614 3300053087 Ga0500643_003366 Ga0500643_003366_1128_2183 329
615 3300053103 Ga0500555_000335 Ga0500555_000335_8127_9134 329
616 3300053116 Ga0500592_000174 Ga0500592_000174_8838_9863 329
617 3300053142 Ga0500577_0043027 Ga0500577_0043027_281_1288 329
618 3300053153 Ga0500616_0109638 Ga0500616_0109638_15_1046 329
619 3300053158 Ga0500627_0022883 Ga0500627_0022883_1349_2374 329
620 iso_pu_bacteria 2582581305 2585261495 329
621 iso_pu_bacteria 2643221560 2643819135 329
622 iso_pu_bacteria 2643221605 2644040226 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

6

244

0.93

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

249

0.89

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

9

312

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

8

183

0.83

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

9

244

0.8

PF07993

NAD_binding_4

Male sterility protein

36

211

0.8

PF05368

NmrA

NmrA-like family

8

131

0.79

PF13460

NAD_binding_10

NAD(P)H-binding

12

195

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hzj-assembly1.cif.gz_B human udp-galactose 4-epimerase: accommodation of udp-n-acetylglucosamine within the active site 0.9646 5 326
2udp-assembly1.cif.gz_A udp-galactose 4-epimerase complexed with udp-phenol 0.9623 4 327
5gy7-assembly1.cif.gz_B x-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis. 0.9618 4 327
4lis-assembly1.cif.gz_A crystal structure of udp-galactose-4-epimerase from aspergillus nidulans 0.9594 4 325
6k0g-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with nad+ and udp 0.9588 5 327
ID Description Score Start End Superfamily
af_A0A1D6K005_288_418_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9647 199 326 3.90.25.10
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.964 5 256 3.40.50.720
4wokA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9631 4 256 3.40.50.720
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 5 256 3.40.50.720
4wokA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9538 4 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3AIA0-F1-model_v4 UDP-glucose 4-epimerase 0.9866 211 328 GO:0016853
GO:0033499
AF-A0A2V8WCR2-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.986 4 182 GO:0016853
GO:0033499
AF-A0A6B3GTU6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9827 4 79
AF-A0A6G3XIY6-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9817 4 115 GO:0016853
GO:0033499
AF-A0A8B3RRD1-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9804 4 106 GO:0016853
GO:0033499

Feature Viewer

pLDDT pTM Quality
93.89 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map