F470107
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 622 | 347 | 580 | 480 |
Family's Representative Sequence
| Representative Sequence | 3300028563|Ga0265319_1024086|Ga0265319_10240862 |
| Length | 543 |
| Sequence | MSQEHDVSHPHHPDRRRFLQRAASMSAMGAALPFGLNMGTLTQASAQSAGGNYKALVCLFFNGGNDAFNMVLATDSTSWGHYLHHRRPTDGSTSIALMEAGVAPVNTASGATPERLGGVLPINHAGRSVHAGRTFALHPALTRLQQIHNAGRACVVANVGPLTRPTSKLDYASAAASKPAKLFSHNDQQSTWQSFKPEGASEGWGGLMGDLLMSGNGGGRNATDAAIVQRMFTCMTPAQTSVWLAGRSVLPYQSSGTGIQSLGNSGRIYGNAGLQAAVASVMSTPPSGGSMPNDRASLFVLDQQKLVERALTASALLGSALAPLGTGPWSSPGATNPYSDTLLNYTSPIDGTQKFNGVALQLQMIARLIDTNRTANLGITRQLFMVNMGGFDTHDNQIREQADRLASLDHALSYFDNVLANMPGGDMRSQVTTFTASEFGRSFTSNGDGTDHGWGAHHIVMGGAVNGTEVYGTFPQYSSADTAGNFSSPDQIQNGVLIPTTSVDQYAYTLGKWMGVGTSDLAALLPNLSQFNASTHDLAFMKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 14 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 15 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 16 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 17 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 18 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 19 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 20 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 21 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 22 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 23 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 24 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 25 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 26 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 27 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 28 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 29 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 30 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 31 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 32 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 33 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 34 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 35 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 36 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 37 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 38 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 39 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 42 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 45 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 46 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 47 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 48 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 58 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 64 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 104 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 105 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 223 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 232 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 233 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 234 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 235 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 236 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 239 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 240 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 311 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 319 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 320 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 330 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 332 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 335 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 337 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 341 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 346 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.25 |
| Metatranscriptomes | 0.32 |
| Isolates | 6.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.94 |
| Nodule | 1.45 |
| Rhizoplane | 2.41 |
| Rhizosphere | 61.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007769 | 3300001979 | Bacteria | 4333 |
| 2 | JGI25150J39212_1000845 | 3300002774 | Bacteria | 10242 |
| 3 | JGI25159J45721_1002918 | 3300002987 | Bacteria | 6233 |
| 4 | JGI25151J46595_10000507 | 3300003187 | Bacteria | 36540 |
| 5 | rootH1_10001187 | 3300003316 | Bacteria | 5206 |
| 6 | rootH1_10021293 | 3300003316 | Bacteria | 8669 |
| 7 | rootH1_10034163 | 3300003316 | Bacteria | 3731 |
| 8 | rootH2_10051907 | 3300003320 | Bacteria | 8638 |
| 9 | rootH2_10236065 | 3300003320 | Unclassified | 3878 |
| 10 | rootL2_10026577 | 3300003322 | Bacteria | 4533 |
| 11 | rootL2_10057017 | 3300003322 | Bacteria | 2894 |
| 12 | rootL2_10063119 | 3300003322 | Bacteria | 10161 |
| 13 | rootL2_10069657 | 3300003322 | Bacteria | 5441 |
| 14 | rootH1_10002908 | 3300003316 | Bacteria | 4973 |
| 15 | rootH1_10002908 | 3300003323 | Bacteria | 22675 |
| 16 | rootH1_10048416 | 3300003323 | Bacteria | 5759 |
| 17 | rootH1_10199011 | 3300003323 | Bacteria | 2496 |
| 18 | Ga0055526_1000019 | 3300003771 | Bacteria | 189698 |
| 19 | Ga0055526_1000283 | 3300003771 | Bacteria | 42457 |
| 20 | Ga0055537_1000063 | 3300003773 | Bacteria | 77468 |
| 21 | Ga0055524_1000025 | 3300003775 | Bacteria | 216427 |
| 22 | Ga0055524_1000231 | 3300003775 | Bacteria | 59530 |
| 23 | Ga0055534_1000208 | 3300003784 | Bacteria | 43225 |
| 24 | Ga0055528_1000013 | 3300003790 | Bacteria | 176239 |
| 25 | Ga0055530_10001969 | 3300003791 | Bacteria | 13982 |
| 26 | Ga0055530_10003523 | 3300003791 | Bacteria | 8838 |
| 27 | Ga0055530_10005653 | 3300003791 | Bacteria | 5856 |
| 28 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 29 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 30 | Ga0055540_1000365 | 3300003792 | Bacteria | 38078 |
| 31 | Ga0055531_10000330 | 3300003794 | Bacteria | 46755 |
| 32 | Ga0055531_10000454 | 3300003794 | Bacteria | 38078 |
| 33 | Ga0055531_10004266 | 3300003794 | Bacteria | 8787 |
| 34 | Ga0055531_10005653 | 3300003794 | Bacteria | 7265 |
| 35 | Ga0055543_1004851 | 3300004625 | Bacteria | 3563 |
| 36 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 37 | Ga0065165_1000600 | 3300005262 | Bacteria | 52753 |
| 38 | Ga0065165_1022534 | 3300005262 | Bacteria | 2157 |
| 39 | Ga0070676_10043747 | 3300005328 | Bacteria | 2603 |
| 40 | Ga0070683_100009180 | 3300005329 | Bacteria | 8443 |
| 41 | Ga0070683_100080553 | 3300005329 | Bacteria | 3048 |
| 42 | Ga0070683_100132244 | 3300005329 | Bacteria | 2361 |
| 43 | Ga0070690_100010947 | 3300005330 | Bacteria | 5294 |
| 44 | Ga0070670_100023816 | 3300005331 | Bacteria | 5268 |
| 45 | Ga0070670_100168566 | 3300005331 | Bacteria | 1899 |
| 46 | Ga0070677_10046585 | 3300005333 | Bacteria | 1734 |
| 47 | Ga0068869_100015798 | 3300005334 | Bacteria | 5074 |
| 48 | Ga0070666_10013184 | 3300005335 | Bacteria | 5239 |
| 49 | Ga0068868_100000459 | 3300005338 | Bacteria | 27077 |
| 50 | Ga0068868_100012059 | 3300005338 | Bacteria | 6311 |
| 51 | Ga0070689_100028788 | 3300005340 | Bacteria | 4202 |
| 52 | Ga0070661_100018235 | 3300005344 | Bacteria | 4988 |
| 53 | Ga0070661_100140469 | 3300005344 | Bacteria | 1820 |
| 54 | Ga0070669_100000003 | 3300005353 | Bacteria | 338807 |
| 55 | Ga0070669_100003404 | 3300005353 | Bacteria | 11448 |
| 56 | Ga0070675_100003600 | 3300005354 | Bacteria | 11783 |
| 57 | Ga0070671_100002176 | 3300005355 | Bacteria | 15130 |
| 58 | Ga0070671_100010892 | 3300005355 | Bacteria | 7302 |
| 59 | Ga0070673_100090375 | 3300005364 | Bacteria | 2501 |
| 60 | Ga0070659_100001364 | 3300005366 | Bacteria | 17584 |
| 61 | Ga0070667_100003020 | 3300005367 | Bacteria | 14462 |
| 62 | Ga0070714_100022255 | 3300005435 | Bacteria | 5195 |
| 63 | Ga0070708_100163057 | 3300005445 | Bacteria | 2078 |
| 64 | Ga0070663_100016762 | 3300005455 | Bacteria | 4768 |
| 65 | Ga0070678_100009945 | 3300005456 | Bacteria | 5784 |
| 66 | Ga0068867_100000104 | 3300005459 | Bacteria | 53850 |
| 67 | Ga0068853_100021881 | 3300005539 | Bacteria | 5333 |
| 68 | Ga0068853_100193960 | 3300005539 | Bacteria | 1846 |
| 69 | Ga0070672_100017706 | 3300005543 | Bacteria | 5133 |
| 70 | Ga0070665_100045053 | 3300005548 | Unclassified | 4429 |
| 71 | Ga0068855_100002944 | 3300005563 | Bacteria | 20808 |
| 72 | Ga0068855_100003346 | 3300005563 | Bacteria | 19628 |
| 73 | Ga0068855_100017040 | 3300005563 | Bacteria | 8740 |
| 74 | Ga0068855_100135831 | 3300005563 | Bacteria | 2806 |
| 75 | Ga0070664_100011153 | 3300005564 | Bacteria | 7288 |
| 76 | Ga0070664_100106188 | 3300005564 | Bacteria | 2446 |
| 77 | Ga0068857_100029350 | 3300005577 | Bacteria | 4853 |
| 78 | Ga0068857_100069422 | 3300005577 | Bacteria | 3138 |
| 79 | Ga0068854_100107239 | 3300005578 | Bacteria | 2102 |
| 80 | Ga0068852_100000029 | 3300005616 | Bacteria | 105168 |
| 81 | Ga0068852_100065174 | 3300005616 | Bacteria | 3177 |
| 82 | Ga0068852_100098610 | 3300005616 | Bacteria | 2632 |
| 83 | Ga0068852_100115605 | 3300005616 | Unclassified | 2446 |
| 84 | Ga0068859_100009449 | 3300005617 | Bacteria | 9847 |
| 85 | Ga0068859_100011237 | 3300005617 | Bacteria | 9006 |
| 86 | Ga0068864_100000508 | 3300005618 | Bacteria | 33518 |
| 87 | Ga0068851_10031800 | 3300005834 | Bacteria | 2623 |
| 88 | Ga0068863_100004264 | 3300005841 | Bacteria | 14102 |
| 89 | Ga0068858_100003059 | 3300005842 | Bacteria | 16764 |
| 90 | Ga0068858_100007399 | 3300005842 | Bacteria | 10621 |
| 91 | Ga0068860_100002923 | 3300005843 | Bacteria | 17679 |
| 92 | Ga0068860_100029800 | 3300005843 | Bacteria | 5250 |
| 93 | Ga0068862_100188068 | 3300005844 | Bacteria | 1857 |
| 94 | Ga0075368_10034903 | 3300006042 | Bacteria | 1961 |
| 95 | Ga0075368_10049595 | 3300006042 | Bacteria | 1666 |
| 96 | Ga0070716_100008307 | 3300006173 | Bacteria | 5150 |
| 97 | Ga0075362_10003212 | 3300006177 | Bacteria | 5665 |
| 98 | Ga0075367_10095764 | 3300006178 | Bacteria | 1810 |
| 99 | Ga0075366_10000953 | 3300006195 | Bacteria | 14096 |
| 100 | Ga0075366_10006014 | 3300006195 | Bacteria | 6612 |
| 101 | Ga0075366_10006123 | 3300006195 | Bacteria | 6559 |
| 102 | Ga0075366_10006670 | 3300006195 | Bacteria | 6336 |
| 103 | Ga0075366_10010043 | 3300006195 | Bacteria | 5305 |
| 104 | Ga0075366_10013544 | 3300006195 | Bacteria | 4647 |
| 105 | Ga0075366_10080707 | 3300006195 | Bacteria | 1943 |
| 106 | Ga0097621_100024443 | 3300006237 | Bacteria | 4718 |
| 107 | Ga0097621_100084865 | 3300006237 | Bacteria | 2641 |
| 108 | Ga0075370_10002530 | 3300006353 | Bacteria | 8492 |
| 109 | Ga0075370_10006406 | 3300006353 | Bacteria | 5917 |
| 110 | Ga0075370_10014495 | 3300006353 | Bacteria | 4206 |
| 111 | Ga0075370_10020690 | 3300006353 | Bacteria | 3599 |
| 112 | Ga0075370_10047533 | 3300006353 | Bacteria | 2430 |
| 113 | Ga0068871_100002115 | 3300006358 | Bacteria | 13446 |
| 114 | Ga0068871_100009407 | 3300006358 | Bacteria | 7080 |
| 115 | Ga0097620_100009449 | 3300006931 | Bacteria | 9847 |
| 116 | Ga0097620_100011237 | 3300006931 | Bacteria | 9006 |
| 117 | Ga0099823_1000486 | 3300006944 | Bacteria | 26577 |
| 118 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 119 | Ga0079104_1000026 | 3300006946 | Bacteria | 216566 |
| 120 | Ga0099826_10000005 | 3300006948 | Bacteria | 465206 |
| 121 | Ga0105244_10014545 | 3300009036 | Bacteria | 4545 |
| 122 | Ga0105250_10011713 | 3300009092 | Bacteria | 3634 |
| 123 | Ga0105240_10000065 | 3300009093 | Bacteria | 213992 |
| 124 | Ga0105240_10001689 | 3300009093 | Bacteria | 37381 |
| 125 | Ga0105240_10002980 | 3300009093 | Bacteria | 26646 |
| 126 | Ga0105240_10019655 | 3300009093 | Bacteria | 9021 |
| 127 | Ga0105245_10031127 | 3300009098 | Unclassified | 4720 |
| 128 | Ga0105247_10010043 | 3300009101 | Bacteria | 5732 |
| 129 | Ga0105243_10028774 | 3300009148 | Bacteria | 4268 |
| 130 | Ga0105243_10065810 | 3300009148 | Bacteria | 2913 |
| 131 | Ga0105243_10095312 | 3300009148 | Bacteria | 2459 |
| 132 | Ga0105241_10000041 | 3300009174 | Bacteria | 107393 |
| 133 | Ga0105241_10015877 | 3300009174 | Bacteria | 5516 |
| 134 | Ga0105242_10002719 | 3300009176 | Bacteria | 13857 |
| 135 | Ga0105242_10004451 | 3300009176 | Bacteria | 10893 |
| 136 | Ga0105248_10001095 | 3300009177 | Bacteria | 29976 |
| 137 | Ga0105248_10007574 | 3300009177 | Bacteria | 11925 |
| 138 | Ga0105248_10007741 | 3300009177 | Bacteria | 11797 |
| 139 | Ga0105248_10017921 | 3300009177 | Bacteria | 7814 |
| 140 | Ga0105248_10053312 | 3300009177 | Bacteria | 4538 |
| 141 | Ga0105237_10038549 | 3300009545 | Bacteria | 4826 |
| 142 | Ga0105237_10101519 | 3300009545 | Bacteria | 2869 |
| 143 | Ga0105238_10000801 | 3300009551 | Bacteria | 32620 |
| 144 | Ga0105238_10001399 | 3300009551 | Bacteria | 24200 |
| 145 | Ga0105238_10022854 | 3300009551 | Bacteria | 6374 |
| 146 | Ga0105238_10067384 | 3300009551 | Bacteria | 3581 |
| 147 | Ga0105239_10003395 | 3300010375 | Bacteria | 19535 |
| 148 | Ga0105239_10017636 | 3300010375 | Bacteria | 7896 |
| 149 | Ga0105239_10094985 | 3300010375 | Bacteria | 3294 |
| 150 | Ga0157370_10000009 | 3300013104 | Bacteria | 231270 |
| 151 | Ga0157370_10004596 | 3300013104 | Bacteria | 15797 |
| 152 | Ga0157369_10000022 | 3300013105 | Bacteria | 233081 |
| 153 | Ga0157369_10005047 | 3300013105 | Bacteria | 15454 |
| 154 | Ga0157369_10050421 | 3300013105 | Bacteria | 4508 |
| 155 | Ga0157369_10056323 | 3300013105 | Bacteria | 4242 |
| 156 | Ga0157374_10001997 | 3300013296 | Bacteria | 17129 |
| 157 | Ga0157374_10007172 | 3300013296 | Bacteria | 9495 |
| 158 | Ga0157374_10026227 | 3300013296 | Bacteria | 5243 |
| 159 | Ga0157374_10059589 | 3300013296 | Bacteria | 3570 |
| 160 | Ga0157374_10081211 | 3300013296 | Bacteria | 3076 |
| 161 | Ga0157374_10086228 | 3300013296 | Bacteria | 2987 |
| 162 | Ga0157378_10002642 | 3300013297 | Bacteria | 15975 |
| 163 | Ga0157378_10021006 | 3300013297 | Bacteria | 5744 |
| 164 | Ga0157378_10041080 | 3300013297 | Bacteria | 4102 |
| 165 | Ga0157372_10000040 | 3300013307 | Bacteria | 163677 |
| 166 | Ga0157372_10033363 | 3300013307 | Bacteria | 5654 |
| 167 | Ga0157372_10109399 | 3300013307 | Bacteria | 3165 |
| 168 | Ga0163163_10004179 | 3300014325 | Bacteria | 12301 |
| 169 | Ga0163163_10004762 | 3300014325 | Bacteria | 11640 |
| 170 | Ga0163163_10045881 | 3300014325 | Bacteria | 4291 |
| 171 | Ga0163163_10198094 | 3300014325 | Bacteria | 2057 |
| 172 | Ga0182008_10010462 | 3300014497 | Bacteria | 4963 |
| 173 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 174 | Ga0157379_10002001 | 3300014968 | Bacteria | 16874 |
| 175 | Ga0157379_10017963 | 3300014968 | Bacteria | 6233 |
| 176 | Ga0157379_10023321 | 3300014968 | Bacteria | 5491 |
| 177 | Ga0183363_1015 | 3300015690 | Bacteria | 74376 |
| 178 | Ga0163161_10013846 | 3300017792 | Bacteria | 5618 |
| 179 | Ga0213876_10012608 | 3300021384 | Bacteria | 4497 |
| 180 | Ga0207425_1000297 | 3300025245 | Bacteria | 36240 |
| 181 | Ga0209129_1004819 | 3300025258 | Bacteria | 5084 |
| 182 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 183 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 184 | Ga0209673_1002870 | 3300025273 | Bacteria | 10968 |
| 185 | Ga0209130_1000046 | 3300025284 | Bacteria | 236658 |
| 186 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 187 | Ga0209675_1001875 | 3300025291 | Bacteria | 11364 |
| 188 | Ga0209676_1000383 | 3300025292 | Bacteria | 81259 |
| 189 | Ga0209025_1000104 | 3300025294 | Bacteria | 226895 |
| 190 | Ga0209025_1009487 | 3300025294 | Bacteria | 6767 |
| 191 | Ga0209025_1019246 | 3300025294 | Bacteria | 3807 |
| 192 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 193 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 194 | Ga0209758_1000470 | 3300025297 | Bacteria | 66488 |
| 195 | Ga0209050_1000457 | 3300025298 | Bacteria | 73281 |
| 196 | Ga0209050_1000952 | 3300025298 | Bacteria | 37637 |
| 197 | Ga0209050_1002564 | 3300025298 | Bacteria | 15154 |
| 198 | Ga0209050_1003116 | 3300025298 | Bacteria | 12700 |
| 199 | Ga0209050_1007715 | 3300025298 | Bacteria | 5943 |
| 200 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 201 | Ga0209256_1000040 | 3300025299 | Bacteria | 366839 |
| 202 | Ga0209256_1000112 | 3300025299 | Bacteria | 178432 |
| 203 | Ga0209256_1001512 | 3300025299 | Bacteria | 23519 |
| 204 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 205 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 206 | Ga0209051_1000259 | 3300025303 | Bacteria | 88311 |
| 207 | Ga0209051_1001071 | 3300025303 | Bacteria | 25392 |
| 208 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 209 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 210 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 211 | Ga0209257_1000079 | 3300025304 | Bacteria | 316420 |
| 212 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 213 | Ga0209257_1001479 | 3300025304 | Bacteria | 27607 |
| 214 | Ga0209257_1012510 | 3300025304 | Bacteria | 3908 |
| 215 | Ga0207656_10041693 | 3300025321 | Unclassified | 1951 |
| 216 | Ga0207696_1018588 | 3300025711 | Bacteria | 2278 |
| 217 | Ga0207682_10014949 | 3300025893 | Bacteria | 3023 |
| 218 | Ga0207680_10003657 | 3300025903 | Bacteria | 7226 |
| 219 | Ga0207645_10050339 | 3300025907 | Bacteria | 2660 |
| 220 | Ga0207705_10092283 | 3300025909 | Bacteria | 2218 |
| 221 | Ga0207654_10000071 | 3300025911 | Bacteria | 66350 |
| 222 | Ga0207695_10000052 | 3300025913 | Bacteria | 398089 |
| 223 | Ga0207695_10000108 | 3300025913 | Bacteria | 252306 |
| 224 | Ga0207695_10000871 | 3300025913 | Bacteria | 54947 |
| 225 | Ga0207695_10001287 | 3300025913 | Bacteria | 42580 |
| 226 | Ga0207695_10007296 | 3300025913 | Bacteria | 14115 |
| 227 | Ga0207695_10034453 | 3300025913 | Bacteria | 5506 |
| 228 | Ga0207671_10041368 | 3300025914 | Bacteria | 3411 |
| 229 | Ga0207649_10002578 | 3300025920 | Bacteria | 10084 |
| 230 | Ga0207649_10032172 | 3300025920 | Bacteria | 3124 |
| 231 | Ga0207649_10114977 | 3300025920 | Bacteria | 1804 |
| 232 | Ga0207681_10000007 | 3300025923 | Bacteria | 483669 |
| 233 | Ga0207681_10003171 | 3300025923 | Bacteria | 10324 |
| 234 | Ga0207694_10000325 | 3300025924 | Bacteria | 44875 |
| 235 | Ga0207694_10001907 | 3300025924 | Bacteria | 17284 |
| 236 | Ga0207694_10029904 | 3300025924 | Bacteria | 4159 |
| 237 | Ga0207650_10030324 | 3300025925 | Bacteria | 3894 |
| 238 | Ga0207650_10035438 | 3300025925 | Bacteria | 3624 |
| 239 | Ga0207659_10003304 | 3300025926 | Bacteria | 9661 |
| 240 | Ga0207687_10005795 | 3300025927 | Bacteria | 8174 |
| 241 | Ga0207687_10014384 | 3300025927 | Bacteria | 5177 |
| 242 | Ga0207644_10003061 | 3300025931 | Bacteria | 10764 |
| 243 | Ga0207644_10017370 | 3300025931 | Bacteria | 4857 |
| 244 | Ga0207644_10021046 | 3300025931 | Bacteria | 4440 |
| 245 | Ga0207690_10019544 | 3300025932 | Bacteria | 4174 |
| 246 | Ga0207706_10018657 | 3300025933 | Bacteria | 6242 |
| 247 | Ga0207686_10013295 | 3300025934 | Bacteria | 4552 |
| 248 | Ga0207709_10000079 | 3300025935 | Bacteria | 166220 |
| 249 | Ga0207709_10003711 | 3300025935 | Bacteria | 8997 |
| 250 | Ga0207670_10019961 | 3300025936 | Bacteria | 4106 |
| 251 | Ga0207669_10023996 | 3300025937 | Bacteria | 3270 |
| 252 | Ga0207704_10039101 | 3300025938 | Bacteria | 2758 |
| 253 | Ga0207665_10023938 | 3300025939 | Bacteria | 4023 |
| 254 | Ga0207665_10071907 | 3300025939 | Bacteria | 2362 |
| 255 | Ga0207691_10023893 | 3300025940 | Bacteria | 5752 |
| 256 | Ga0207691_10106302 | 3300025940 | Bacteria | 2500 |
| 257 | Ga0207711_10005291 | 3300025941 | Bacteria | 10937 |
| 258 | Ga0207711_10005714 | 3300025941 | Bacteria | 10495 |
| 259 | Ga0207711_10009838 | 3300025941 | Bacteria | 7951 |
| 260 | Ga0207711_10086363 | 3300025941 | Bacteria | 2750 |
| 261 | Ga0207689_10000130 | 3300025942 | Bacteria | 63848 |
| 262 | Ga0207661_10025351 | 3300025944 | Bacteria | 4505 |
| 263 | Ga0207661_10068305 | 3300025944 | Bacteria | 2894 |
| 264 | Ga0207679_10003600 | 3300025945 | Bacteria | 9610 |
| 265 | Ga0207679_10015513 | 3300025945 | Bacteria | 5037 |
| 266 | Ga0207679_10037210 | 3300025945 | Bacteria | 3458 |
| 267 | Ga0207667_10006870 | 3300025949 | Bacteria | 13747 |
| 268 | Ga0207667_10110980 | 3300025949 | Bacteria | 2829 |
| 269 | Ga0207658_10002873 | 3300025986 | Bacteria | 12339 |
| 270 | Ga0207677_10002815 | 3300026023 | Bacteria | 9177 |
| 271 | Ga0207677_10009409 | 3300026023 | Bacteria | 5501 |
| 272 | Ga0207703_10012835 | 3300026035 | Bacteria | 6533 |
| 273 | Ga0207639_10000180 | 3300026041 | Bacteria | 49455 |
| 274 | Ga0207639_10078531 | 3300026041 | Unclassified | 2605 |
| 275 | Ga0207678_10012387 | 3300026067 | Bacteria | 7485 |
| 276 | Ga0207702_10013479 | 3300026078 | Bacteria | 6792 |
| 277 | Ga0207702_10065861 | 3300026078 | Bacteria | 3103 |
| 278 | Ga0207702_10251827 | 3300026078 | Bacteria | 1659 |
| 279 | Ga0207641_10002565 | 3300026088 | Bacteria | 16707 |
| 280 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 281 | Ga0207676_10004582 | 3300026095 | Bacteria | 9791 |
| 282 | Ga0207674_10000910 | 3300026116 | Bacteria | 38534 |
| 283 | Ga0207674_10153284 | 3300026116 | Bacteria | 2260 |
| 284 | Ga0207683_10056178 | 3300026121 | Bacteria | 3452 |
| 285 | Ga0207683_10085729 | 3300026121 | Bacteria | 2800 |
| 286 | Ga0207698_10000007 | 3300026142 | Bacteria | 289457 |
| 287 | Ga0207698_10016734 | 3300026142 | Bacteria | 4954 |
| 288 | Ga0207698_10021579 | 3300026142 | Bacteria | 4458 |
| 289 | Ga0207698_10034846 | 3300026142 | Bacteria | 3675 |
| 290 | Ga0207698_10066809 | 3300026142 | Bacteria | 2832 |
| 291 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 292 | Ga0209281_1000067 | 3300027111 | Bacteria | 284517 |
| 293 | Ga0209389_1019082 | 3300027296 | Bacteria | 6150 |
| 294 | Ga0209970_1000371 | 3300027614 | Bacteria | 7551 |
| 295 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 296 | Ga0209813_10005387 | 3300027866 | Bacteria | 3102 |
| 297 | Ga0209974_10003224 | 3300027876 | Bacteria | 5898 |
| 298 | Ga0209974_10007078 | 3300027876 | Bacteria | 3876 |
| 299 | Ga0268265_10243245 | 3300028380 | Bacteria | 1589 |
| 300 | Ga0268264_10003544 | 3300028381 | Bacteria | 13439 |
| 301 | Ga0265319_1024086 | 3300028563 | Bacteria | 2196 |
| 302 | Ga0307517_10034295 | 3300028786 | Bacteria | 5784 |
| 303 | Ga0307517_10076967 | 3300028786 | Bacteria | 2906 |
| 304 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 305 | Ga0307515_10000123 | 3300028794 | Bacteria | 186601 |
| 306 | Ga0307515_10000821 | 3300028794 | Bacteria | 71579 |
| 307 | Ga0307515_10007649 | 3300028794 | Bacteria | 21312 |
| 308 | Ga0307515_10011224 | 3300028794 | Bacteria | 17013 |
| 309 | Ga0307515_10052885 | 3300028794 | Bacteria | 6009 |
| 310 | Ga0307515_10053868 | 3300028794 | Bacteria | 5921 |
| 311 | Ga0307515_10054206 | 3300028794 | Bacteria | 5893 |
| 312 | Ga0307515_10068407 | 3300028794 | Bacteria | 4879 |
| 313 | Ga0307515_10143864 | 3300028794 | Bacteria | 2539 |
| 314 | Ga0265338_10013956 | 3300028800 | Bacteria | 9010 |
| 315 | Ga0265338_10114529 | 3300028800 | Unclassified | 2164 |
| 316 | Ga0307512_10010148 | 3300030522 | Bacteria | 9006 |
| 317 | Ga0307512_10022819 | 3300030522 | Bacteria | 5609 |
| 318 | Ga0307512_10070486 | 3300030522 | Bacteria | 2603 |
| 319 | Ga0265760_10015107 | 3300031090 | Bacteria | 2213 |
| 320 | Ga0265330_10000828 | 3300031235 | Bacteria | 19434 |
| 321 | Ga0265330_10011853 | 3300031235 | Bacteria | 4081 |
| 322 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 323 | Ga0265328_10008184 | 3300031239 | Bacteria | 4326 |
| 324 | Ga0265325_10000664 | 3300031241 | Bacteria | 25082 |
| 325 | Ga0265339_10000089 | 3300031249 | Bacteria | 77145 |
| 326 | Ga0265331_10058357 | 3300031250 | Bacteria | 1827 |
| 327 | Ga0265327_10001820 | 3300031251 | Bacteria | 24933 |
| 328 | Ga0265316_10000668 | 3300031344 | Bacteria | 38227 |
| 329 | Ga0265316_10000687 | 3300031344 | Bacteria | 37565 |
| 330 | Ga0265316_10033744 | 3300031344 | Bacteria | 4165 |
| 331 | Ga0307513_10003902 | 3300031456 | Bacteria | 20051 |
| 332 | Ga0307513_10004611 | 3300031456 | Bacteria | 18355 |
| 333 | Ga0307513_10013254 | 3300031456 | Bacteria | 10122 |
| 334 | Ga0307513_10056384 | 3300031456 | Bacteria | 4195 |
| 335 | Ga0307513_10091445 | 3300031456 | Bacteria | 3101 |
| 336 | Ga0307513_10104709 | 3300031456 | Bacteria | 2841 |
| 337 | Ga0307509_10000293 | 3300031507 | Bacteria | 82770 |
| 338 | Ga0307509_10003313 | 3300031507 | Bacteria | 24671 |
| 339 | Ga0307509_10021372 | 3300031507 | Bacteria | 7317 |
| 340 | Ga0307509_10113167 | 3300031507 | Bacteria | 2712 |
| 341 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 342 | Ga0307408_100000298 | 3300031548 | Bacteria | 47947 |
| 343 | Ga0307408_100032935 | 3300031548 | Bacteria | 3617 |
| 344 | Ga0265313_10006038 | 3300031595 | Bacteria | 8738 |
| 345 | Ga0265313_10020751 | 3300031595 | Bacteria | 3615 |
| 346 | Ga0265313_10023895 | 3300031595 | Bacteria | 3281 |
| 347 | Ga0307508_10000134 | 3300031616 | Bacteria | 87501 |
| 348 | Ga0307508_10000524 | 3300031616 | Bacteria | 45505 |
| 349 | Ga0307514_10022006 | 3300031649 | Bacteria | 5190 |
| 350 | Ga0265314_10000081 | 3300031711 | Bacteria | 143776 |
| 351 | Ga0265342_10003868 | 3300031712 | Bacteria | 12046 |
| 352 | Ga0265342_10005184 | 3300031712 | Bacteria | 10016 |
| 353 | Ga0307516_10000672 | 3300031730 | Bacteria | 46304 |
| 354 | Ga0307516_10013080 | 3300031730 | Bacteria | 8874 |
| 355 | Ga0307516_10029199 | 3300031730 | Bacteria | 5576 |
| 356 | Ga0307413_10066872 | 3300031824 | Bacteria | 2245 |
| 357 | Ga0307518_10117944 | 3300031838 | Bacteria | 1882 |
| 358 | Ga0307406_10000234 | 3300031901 | Bacteria | 33721 |
| 359 | Ga0307414_10058803 | 3300032004 | Bacteria | 2710 |
| 360 | Ga0307411_10040292 | 3300032005 | Bacteria | 2962 |
| 361 | Ga0307510_10000207 | 3300033180 | Bacteria | 51708 |
| 362 | Ga0307510_10005691 | 3300033180 | Bacteria | 14850 |
| 363 | Ga0307510_10054384 | 3300033180 | Bacteria | 4193 |
| 364 | Ga0307510_10065288 | 3300033180 | Bacteria | 3688 |
| 365 | Ga0373939_0000004 | 3300035114 | Bacteria | 106519 |
| 366 | Ga0373960_0001935 | 3300035121 | Bacteria | 4644 |
| 367 | Ga0395899_0021331 | 3300037312 | Bacteria | 4913 |
| 368 | Ga0395905_0000117 | 3300037471 | Bacteria | 133291 |
| 369 | Ga0395905_0001029 | 3300037471 | Bacteria | 35545 |
| 370 | Ga0395905_0014246 | 3300037471 | Bacteria | 7596 |
| 371 | Ga0395905_0058968 | 3300037471 | Bacteria | 3589 |
| 372 | Ga0395901_0116165 | 3300038443 | Bacteria | 2811 |
| 373 | Ga0436365_0860276 | 3300039437 | Bacteria | 4987 |
| 374 | Ga0439461_0001755 | 3300041410 | Bacteria | 3390 |
| 375 | Ga0439462_0000640 | 3300042015 | Bacteria | 7031 |
| 376 | Ga0450888_000211 | 3300042126 | Bacteria | 5225 |
| 377 | Ga0450891_000495 | 3300042129 | Bacteria | 4115 |
| 378 | Ga0450903_004917 | 3300042138 | Bacteria | 2253 |
| 379 | Ga0450889_000406 | 3300042144 | Bacteria | 4808 |
| 380 | Ga0450918_000112 | 3300042531 | Bacteria | 17468 |
| 381 | Ga0450893_0004099 | 3300042532 | Bacteria | 2317 |
| 382 | Ga0451577_0002719 | 3300042876 | Bacteria | 20577 |
| 383 | Ga0451577_0012040 | 3300042876 | Bacteria | 8138 |
| 384 | Ga0451577_0023261 | 3300042876 | Bacteria | 5652 |
| 385 | Ga0451577_0085649 | 3300042876 | Bacteria | 2812 |
| 386 | Ga0466969_0019479 | 3300044656 | Bacteria | 3526 |
| 387 | Ga0466969_0067618 | 3300044656 | Bacteria | 1724 |
| 388 | Ga0453683_0058409 | 3300044673 | Bacteria | 2413 |
| 389 | Ga0466965_0011906 | 3300044683 | Bacteria | 4083 |
| 390 | Ga0466965_0067857 | 3300044683 | Bacteria | 1790 |
| 391 | Ga0466966_0073230 | 3300044684 | Bacteria | 2143 |
| 392 | Ga0466961_0010615 | 3300044693 | Bacteria | 5878 |
| 393 | Ga0466963_0005063 | 3300044694 | Bacteria | 7701 |
| 394 | Ga0453684_0017908 | 3300044712 | Bacteria | 10930 |
| 395 | Ga0453684_0115348 | 3300044712 | Bacteria | 3255 |
| 396 | Ga0453684_0194796 | 3300044712 | Bacteria | 2368 |
| 397 | Ga0453684_0272682 | 3300044712 | Bacteria | 1932 |
| 398 | Ga0466970_0093423 | 3300044765 | Bacteria | 1634 |
| 399 | Ga0466960_0021626 | 3300044901 | Bacteria | 2867 |
| 400 | Ga0451576_0004176 | 3300045051 | Bacteria | 19014 |
| 401 | Ga0451576_0006080 | 3300045051 | Bacteria | 14882 |
| 402 | Ga0451576_0069102 | 3300045051 | Bacteria | 3675 |
| 403 | Ga0451576_0132700 | 3300045051 | Bacteria | 2596 |
| 404 | Ga0466967_0000280 | 3300045976 | Bacteria | 22598 |
| 405 | Ga0495617_000033 | 3300046452 | Bacteria | 147979 |
| 406 | Ga0495627_011912 | 3300046453 | Bacteria | 3101 |
| 407 | Ga0495592_0000555 | 3300046454 | Bacteria | 26626 |
| 408 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 409 | Ga0495638_0000436 | 3300046460 | Bacteria | 50390 |
| 410 | Ga0495638_0006325 | 3300046460 | Bacteria | 8631 |
| 411 | Ga0495638_0046824 | 3300046460 | Bacteria | 2715 |
| 412 | Ga0495650_0000115 | 3300046471 | Bacteria | 190869 |
| 413 | Ga0495650_0000648 | 3300046471 | Bacteria | 45807 |
| 414 | Ga0495650_0000909 | 3300046471 | Bacteria | 34900 |
| 415 | Ga0495650_0001166 | 3300046471 | Bacteria | 28063 |
| 416 | Ga0495650_0001915 | 3300046471 | Bacteria | 18439 |
| 417 | Ga0495580_0126585 | 3300046472 | Bacteria | 1773 |
| 418 | Ga0495639_0072794 | 3300046475 | Bacteria | 1590 |
| 419 | Ga0495607_0008173 | 3300046501 | Bacteria | 7172 |
| 420 | Ga0495583_0000709 | 3300046506 | Bacteria | 42771 |
| 421 | Ga0495606_0000053 | 3300046507 | Bacteria | 200818 |
| 422 | Ga0495606_0007009 | 3300046507 | Bacteria | 10229 |
| 423 | Ga0495606_0016008 | 3300046507 | Bacteria | 5743 |
| 424 | Ga0495606_0025808 | 3300046507 | Bacteria | 4199 |
| 425 | Ga0495606_0039977 | 3300046507 | Bacteria | 3155 |
| 426 | Ga0495610_0000181 | 3300046512 | Bacteria | 70215 |
| 427 | Ga0495610_0003889 | 3300046512 | Bacteria | 11333 |
| 428 | Ga0495610_0012165 | 3300046512 | Bacteria | 5200 |
| 429 | Ga0495610_0014665 | 3300046512 | Bacteria | 4594 |
| 430 | Ga0495610_0047952 | 3300046512 | Bacteria | 2099 |
| 431 | Ga0495616_0028134 | 3300046513 | Bacteria | 2977 |
| 432 | Ga0495631_0000408 | 3300046518 | Bacteria | 29643 |
| 433 | Ga0495632_0017181 | 3300046519 | Bacteria | 4001 |
| 434 | Ga0495637_0000207 | 3300046520 | Bacteria | 46156 |
| 435 | Ga0495643_0000195 | 3300046522 | Bacteria | 96110 |
| 436 | Ga0495643_0000516 | 3300046522 | Bacteria | 48137 |
| 437 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 438 | Ga0495642_0005491 | 3300046528 | Bacteria | 4868 |
| 439 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 440 | Ga0495609_0001952 | 3300046538 | Bacteria | 13103 |
| 441 | Ga0495609_0009864 | 3300046538 | Bacteria | 4604 |
| 442 | Ga0495609_0012100 | 3300046538 | Bacteria | 4096 |
| 443 | Ga0495621_0001025 | 3300046539 | Bacteria | 7160 |
| 444 | Ga0495597_0000322 | 3300046542 | Bacteria | 43315 |
| 445 | Ga0495597_0000936 | 3300046542 | Bacteria | 22526 |
| 446 | Ga0495622_0000810 | 3300046557 | Bacteria | 17296 |
| 447 | Ga0495622_0071767 | 3300046557 | Bacteria | 1598 |
| 448 | Ga0495633_0000382 | 3300046558 | Bacteria | 46834 |
| 449 | Ga0495633_0006458 | 3300046558 | Bacteria | 6943 |
| 450 | Ga0495633_0011051 | 3300046558 | Bacteria | 4898 |
| 451 | Ga0495633_0020109 | 3300046558 | Bacteria | 3363 |
| 452 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 453 | Ga0495668_0000931 | 3300046616 | Bacteria | 32633 |
| 454 | Ga0495668_0001037 | 3300046616 | Bacteria | 29441 |
| 455 | Ga0495668_0004618 | 3300046616 | Bacteria | 9680 |
| 456 | Ga0495668_0005457 | 3300046616 | Bacteria | 8612 |
| 457 | Ga0495625_0000124 | 3300046660 | Bacteria | 120849 |
| 458 | Ga0495625_0001378 | 3300046660 | Bacteria | 29876 |
| 459 | Ga0495625_0002387 | 3300046660 | Bacteria | 20399 |
| 460 | Ga0495625_0006874 | 3300046660 | Bacteria | 10045 |
| 461 | Ga0495625_0007589 | 3300046660 | Bacteria | 9417 |
| 462 | Ga0495625_0013475 | 3300046660 | Bacteria | 6568 |
| 463 | Ga0495625_0019381 | 3300046660 | Bacteria | 5279 |
| 464 | Ga0495661_0070356 | 3300046665 | Bacteria | 2048 |
| 465 | Ga0495658_0008123 | 3300046683 | Bacteria | 5197 |
| 466 | Ga0495658_0027845 | 3300046683 | Bacteria | 3045 |
| 467 | Ga0495658_0055156 | 3300046683 | Bacteria | 2263 |
| 468 | Ga0495669_0009656 | 3300046684 | Bacteria | 4071 |
| 469 | Ga0495649_0005207 | 3300046694 | Bacteria | 8327 |
| 470 | Ga0495649_0012321 | 3300046694 | Bacteria | 4983 |
| 471 | Ga0495660_0012961 | 3300046810 | Bacteria | 4833 |
| 472 | Ga0495660_0028502 | 3300046810 | Bacteria | 3155 |
| 473 | Ga0495660_0073756 | 3300046810 | Bacteria | 1804 |
| 474 | Ga0495672_0000398 | 3300047320 | Bacteria | 52924 |
| 475 | Ga0495687_000719 | 3300047443 | Bacteria | 36657 |
| 476 | Ga0495687_001182 | 3300047443 | Bacteria | 25172 |
| 477 | Ga0495687_006047 | 3300047443 | Bacteria | 7538 |
| 478 | Ga0495687_032737 | 3300047443 | Bacteria | 2368 |
| 479 | Ga0495677_0002811 | 3300047445 | Bacteria | 6790 |
| 480 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 481 | Ga0495681_0017829 | 3300047470 | Bacteria | 3931 |
| 482 | Ga0495686_0001694 | 3300047472 | Bacteria | 22811 |
| 483 | Ga0495686_0011656 | 3300047472 | Bacteria | 6189 |
| 484 | Ga0495686_0024618 | 3300047472 | Bacteria | 3953 |
| 485 | Ga0495686_0036736 | 3300047472 | Bacteria | 3143 |
| 486 | Ga0495686_0040601 | 3300047472 | Bacteria | 2967 |
| 487 | Ga0495593_0003185 | 3300047673 | Bacteria | 9855 |
| 488 | Ga0495614_0003925 | 3300048089 | Bacteria | 6678 |
| 489 | Ga0496100_0070902 | 3300048903 | Bacteria | 2325 |
| 490 | Ga0496101_0063906 | 3300048904 | Bacteria | 2680 |
| 491 | Ga0496102_0029736 | 3300048905 | Bacteria | 4889 |
| 492 | Ga0496108_0066961 | 3300048911 | Bacteria | 3029 |
| 493 | Ga0496109_0033424 | 3300048912 | Bacteria | 4627 |
| 494 | Ga0496109_0038751 | 3300048912 | Bacteria | 4311 |
| 495 | Ga0496110_0016350 | 3300048913 | Bacteria | 6195 |
| 496 | Ga0496110_0045911 | 3300048913 | Bacteria | 3820 |
| 497 | Ga0496110_0089314 | 3300048913 | Bacteria | 2754 |
| 498 | Ga0496114_0012042 | 3300048917 | Bacteria | 6920 |
| 499 | Ga0496114_0197243 | 3300048917 | Bacteria | 1762 |
| 500 | Ga0496115_0015447 | 3300048918 | Bacteria | 5791 |
| 501 | Ga0496116_0023363 | 3300048919 | Bacteria | 4606 |
| 502 | Ga0496117_0019331 | 3300048920 | Bacteria | 5601 |
| 503 | Ga0496121_0066366 | 3300048924 | Bacteria | 2930 |
| 504 | Ga0496123_0016544 | 3300048926 | Bacteria | 5980 |
| 505 | Ga0496123_0016684 | 3300048926 | Bacteria | 5947 |
| 506 | Ga0496123_0057100 | 3300048926 | Bacteria | 2544 |
| 507 | Ga0496124_0070178 | 3300048927 | Bacteria | 2907 |
| 508 | Ga0496124_0093200 | 3300048927 | Bacteria | 2452 |
| 509 | Ga0496125_0020270 | 3300048928 | Bacteria | 6243 |
| 510 | Ga0496126_0000286 | 3300048929 | Bacteria | 106913 |
| 511 | Ga0496126_0038132 | 3300048929 | Bacteria | 4473 |
| 512 | Ga0496126_0082898 | 3300048929 | Bacteria | 2831 |
| 513 | Ga0501310_000422 | 3300049130 | Bacteria | 3732 |
| 514 | Ga0495678_000291 | 3300049459 | Bacteria | 55271 |
| 515 | Ga0495678_011834 | 3300049459 | Bacteria | 4160 |
| 516 | Ga0495678_012811 | 3300049459 | Bacteria | 3960 |
| 517 | Ga0501033_0096855 | 3300049570 | Bacteria | 2156 |
| 518 | Ga0501039_0001422 | 3300049575 | Bacteria | 17622 |
| 519 | Ga0501042_0025892 | 3300049578 | Bacteria | 4123 |
| 520 | Ga0501076_0003274 | 3300049592 | Bacteria | 11341 |
| 521 | Ga0501211_000098 | 3300049658 | Bacteria | 6418 |
| 522 | Ga0501222_006910 | 3300049662 | Bacteria | 1519 |
| 523 | Ga0501223_006978 | 3300049663 | Bacteria | 2320 |
| 524 | Ga0501221_001202 | 3300049704 | Bacteria | 4286 |
| 525 | Ga0501079_0015539 | 3300049741 | Bacteria | 5811 |
| 526 | Ga0501080_0005820 | 3300049742 | Bacteria | 11037 |
| 527 | Ga0501081_0000516 | 3300049743 | Bacteria | 21719 |
| 528 | Ga0501083_0092830 | 3300049744 | Bacteria | 1993 |
| 529 | Ga0501266_000571 | 3300049763 | Bacteria | 4884 |
| 530 | Ga0501267_000375 | 3300049764 | Bacteria | 3395 |
| 531 | Ga0501272_003063 | 3300049769 | Bacteria | 1681 |
| 532 | Ga0501045_0011790 | 3300049824 | Bacteria | 6141 |
| 533 | nmdc:mga03n38_17291_c1 | 3300050490 | Bacteria | 2821 |
| 534 | nmdc:mga00v17_78600_c1 | 3300050491 | Bacteria | 2056 |
| 535 | nmdc:mga0k408_19148_c1 | 3300050493 | Bacteria | 3823 |
| 536 | nmdc:mga0k408_206_c1 | 3300050493 | Bacteria | 31456 |
| 537 | nmdc:mga0k408_2372_c1 | 3300050493 | Bacteria | 8674 |
| 538 | nmdc:mga0k408_31974_c1 | 3300050493 | Bacteria | 3007 |
| 539 | nmdc:mga0k408_67551_c1 | 3300050493 | Bacteria | 2083 |
| 540 | nmdc:mga0k408_7060_c1 | 3300050493 | Bacteria | 5999 |
| 541 | nmdc:mga0k408_8217_c1 | 3300050493 | Bacteria | 5594 |
| 542 | nmdc:mga0k408_866_c1 | 3300050493 | Bacteria | 16663 |
| 543 | nmdc:mga0k408_98135_c1 | 3300050493 | Bacteria | 1726 |
| 544 | nmdc:mga04h51_8087_c1 | 3300050495 | Bacteria | 2804 |
| 545 | nmdc:mga07m45_1680_c1 | 3300050496 | Bacteria | 10182 |
| 546 | nmdc:mga07m45_3456_c1 | 3300050496 | Bacteria | 7619 |
| 547 | nmdc:mga07m45_52257_c1 | 3300050496 | Bacteria | 2306 |
| 548 | nmdc:mga07m45_63535_c1 | 3300050496 | Bacteria | 2094 |
| 549 | nmdc:mga08x19_34902_c1 | 3300050514 | Bacteria | 3181 |
| 550 | Ga0500610_0000519 | 3300053079 | Bacteria | 11857 |
| 551 | Ga0500610_0000524 | 3300053079 | Bacteria | 11812 |
| 552 | Ga0500651_0000002 | 3300053093 | Bacteria | 476609 |
| 553 | Ga0500651_0000015 | 3300053093 | Bacteria | 161416 |
| 554 | Ga0500651_0005156 | 3300053093 | Bacteria | 7435 |
| 555 | Ga0500571_000017 | 3300053110 | Bacteria | 64361 |
| 556 | Ga0500593_000637 | 3300053117 | Bacteria | 13500 |
| 557 | Ga0500593_000662 | 3300053117 | Bacteria | 13129 |
| 558 | Ga0500594_0001863 | 3300053118 | Bacteria | 4571 |
| 559 | Ga0500595_000044 | 3300053119 | Bacteria | 91895 |
| 560 | Ga0500607_000025 | 3300053121 | Bacteria | 95473 |
| 561 | Ga0500607_005461 | 3300053121 | Bacteria | 8314 |
| 562 | Ga0500618_000258 | 3300053125 | Bacteria | 41850 |
| 563 | Ga0500655_000069 | 3300053133 | Bacteria | 27666 |
| 564 | Ga0500658_0000054 | 3300053134 | Bacteria | 60941 |
| 565 | Ga0500658_0000248 | 3300053134 | Bacteria | 25326 |
| 566 | Ga0500658_0017066 | 3300053134 | Bacteria | 2709 |
| 567 | Ga0500658_0029041 | 3300053134 | Bacteria | 2149 |
| 568 | Ga0500559_0000049 | 3300053136 | Bacteria | 93378 |
| 569 | Ga0500559_0000670 | 3300053136 | Bacteria | 22910 |
| 570 | Ga0500559_0009307 | 3300053136 | Bacteria | 4258 |
| 571 | Ga0500564_012408 | 3300053138 | Bacteria | 3786 |
| 572 | Ga0500568_0001431 | 3300053139 | Bacteria | 15473 |
| 573 | Ga0500568_0007211 | 3300053139 | Bacteria | 5478 |
| 574 | Ga0500586_000361 | 3300053145 | Bacteria | 9043 |
| 575 | Ga0500616_0013029 | 3300053153 | Bacteria | 4843 |
| 576 | Ga0500622_0003710 | 3300053156 | Bacteria | 10014 |
| 577 | Ga0500627_0000836 | 3300053158 | Bacteria | 8244 |
| 578 | Ga0500634_0000599 | 3300053161 | Bacteria | 12040 |
| 579 | Ga0500636_0013941 | 3300053177 | Bacteria | 4725 |
| 580 | Ga0500625_022389 | 3300053729 | Bacteria | 2985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10007574 | Ga0105248_100075745 | 363 |
| 2 | 3300048903 | Ga0496100_0070902 | Ga0496100_0070902_53_1219 | 363 |
| 3 | 3300003771 | Ga0055526_1000019 | Ga0055526_1000019159 | 413 |
| 4 | 3300025295 | Ga0209564_1000007 | Ga0209564_100000768 | 413 |
| 5 | 3300031730 | Ga0307516_10000672 | Ga0307516_1000067235 | 415 |
| 6 | 3300046471 | Ga0495650_0000648 | Ga0495650_0000648_41985_43418 | 420 |
| 7 | 3300046616 | Ga0495668_0004618 | Ga0495668_0004618_5854_7287 | 420 |
| 8 | 3300048927 | Ga0496124_0070178 | Ga0496124_0070178_230_1663 | 420 |
| 9 | 3300049662 | Ga0501222_006910 | Ga0501222_006910_42_1322 | 420 |
| 10 | 3300049769 | Ga0501272_003063 | Ga0501272_003063_363_1643 | 420 |
| 11 | 3300053134 | Ga0500658_0029041 | Ga0500658_0029041_664_2127 | 420 |
| 12 | 3300048917 | Ga0496114_0197243 | Ga0496114_0197243_18_1406 | 421 |
| 13 | 3300049570 | Ga0501033_0096855 | Ga0501033_0096855_634_1980 | 423 |
| 14 | 3300049575 | Ga0501039_0001422 | Ga0501039_0001422_7474_8820 | 423 |
| 15 | 3300049578 | Ga0501042_0025892 | Ga0501042_0025892_971_2317 | 423 |
| 16 | 3300049592 | Ga0501076_0003274 | Ga0501076_0003274_1625_2971 | 423 |
| 17 | 3300049741 | Ga0501079_0015539 | Ga0501079_0015539_3714_5060 | 423 |
| 18 | 3300049742 | Ga0501080_0005820 | Ga0501080_0005820_7200_8546 | 423 |
| 19 | 3300049743 | Ga0501081_0000516 | Ga0501081_0000516_16832_18178 | 423 |
| 20 | 3300049744 | Ga0501083_0092830 | Ga0501083_0092830_91_1437 | 423 |
| 21 | 3300049824 | Ga0501045_0011790 | Ga0501045_0011790_2419_3765 | 423 |
| 22 | 3300005353 | Ga0070669_100003404 | Ga0070669_1000034047 | 426 |
| 23 | 3300025923 | Ga0207681_10003171 | Ga0207681_100031719 | 426 |
| 24 | 3300003320 | rootH2_10236065 | rootH2_102360652 | 427 |
| 25 | 3300009093 | Ga0105240_10000065 | Ga0105240_100000652 | 427 |
| 26 | 3300009093 | Ga0105240_10002980 | Ga0105240_100029807 | 427 |
| 27 | 3300009093 | Ga0105240_10019655 | Ga0105240_100196557 | 427 |
| 28 | 3300009098 | Ga0105245_10031127 | Ga0105245_100311272 | 427 |
| 29 | 3300009101 | Ga0105247_10010043 | Ga0105247_100100433 | 427 |
| 30 | 3300009174 | Ga0105241_10000041 | Ga0105241_1000004186 | 427 |
| 31 | 3300009174 | Ga0105241_10015877 | Ga0105241_100158772 | 427 |
| 32 | 3300009177 | Ga0105248_10001095 | Ga0105248_1000109519 | 427 |
| 33 | 3300009545 | Ga0105237_10038549 | Ga0105237_100385492 | 427 |
| 34 | 3300009545 | Ga0105237_10101519 | Ga0105237_101015193 | 427 |
| 35 | 3300009551 | Ga0105238_10000801 | Ga0105238_1000080124 | 427 |
| 36 | 3300009551 | Ga0105238_10001399 | Ga0105238_1000139918 | 427 |
| 37 | 3300010375 | Ga0105239_10003395 | Ga0105239_1000339512 | 427 |
| 38 | 3300013104 | Ga0157370_10000009 | Ga0157370_10000009178 | 427 |
| 39 | 3300013105 | Ga0157369_10000022 | Ga0157369_1000002219 | 427 |
| 40 | 3300013105 | Ga0157369_10050421 | Ga0157369_100504212 | 427 |
| 41 | 3300013296 | Ga0157374_10001997 | Ga0157374_100019974 | 427 |
| 42 | 3300013296 | Ga0157374_10007172 | Ga0157374_100071727 | 427 |
| 43 | 3300013296 | Ga0157374_10059589 | Ga0157374_100595894 | 427 |
| 44 | 3300013297 | Ga0157378_10002642 | Ga0157378_100026425 | 427 |
| 45 | 3300013297 | Ga0157378_10021006 | Ga0157378_100210062 | 427 |
| 46 | 3300013307 | Ga0157372_10000040 | Ga0157372_10000040123 | 427 |
| 47 | 3300013307 | Ga0157372_10109399 | Ga0157372_101093993 | 427 |
| 48 | 3300014325 | Ga0163163_10004762 | Ga0163163_1000476210 | 427 |
| 49 | 3300014968 | Ga0157379_10002001 | Ga0157379_1000200113 | 427 |
| 50 | 3300030522 | Ga0307512_10010148 | Ga0307512_100101483 | 427 |
| 51 | 3300031507 | Ga0307509_10000293 | Ga0307509_1000029346 | 427 |
| 52 | 3300031649 | Ga0307514_10022006 | Ga0307514_100220063 | 427 |
| 53 | 3300033180 | Ga0307510_10005691 | Ga0307510_100056917 | 427 |
| 54 | 3300044694 | Ga0466963_0005063 | Ga0466963_0005063_6148_7524 | 427 |
| 55 | 3300045976 | Ga0466967_0000280 | Ga0466967_0000280_18285_19661 | 427 |
| 56 | 3300046454 | Ga0495592_0000555 | Ga0495592_0000555_15367_16839 | 427 |
| 57 | 3300046683 | Ga0495658_0008123 | Ga0495658_0008123_3363_4913 | 427 |
| 58 | 3300050514 | nmdc:mga08x19_34902_c1 | nmdc:mga08x19_34902_c1_143_1468 | 427 |
| 59 | 3300006195 | Ga0075366_10006123 | Ga0075366_100061233 | 429 |
| 60 | 3300006353 | Ga0075370_10006406 | Ga0075370_100064062 | 429 |
| 61 | 3300050493 | nmdc:mga0k408_7060_c1 | nmdc:mga0k408_7060_c1_926_2491 | 429 |
| 62 | 3300050496 | nmdc:mga07m45_1680_c1 | nmdc:mga07m45_1680_c1_7622_9187 | 429 |
| 63 | 3300005353 | Ga0070669_100000003 | Ga0070669_100000003201 | 430 |
| 64 | 3300013296 | Ga0157374_10026227 | Ga0157374_100262272 | 430 |
| 65 | 3300025923 | Ga0207681_10000007 | Ga0207681_10000007149 | 430 |
| 66 | 3300031090 | Ga0265760_10015107 | Ga0265760_100151072 | 430 |
| 67 | 3300046472 | Ga0495580_0126585 | Ga0495580_0126585_38_1423 | 430 |
| 68 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009159 | 432 |
| 69 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023228 | 432 |
| 70 | 3300028794 | Ga0307515_10052885 | Ga0307515_100528853 | 432 |
| 71 | 3300031250 | Ga0265331_10058357 | Ga0265331_100583571 | 432 |
| 72 | 3300031344 | Ga0265316_10033744 | Ga0265316_100337442 | 432 |
| 73 | 3300031507 | Ga0307509_10003313 | Ga0307509_100033132 | 432 |
| 74 | 3300031507 | Ga0307509_10021372 | Ga0307509_100213726 | 432 |
| 75 | 3300031595 | Ga0265313_10020751 | Ga0265313_100207512 | 432 |
| 76 | 3300031616 | Ga0307508_10000524 | Ga0307508_1000052438 | 432 |
| 77 | 3300044683 | Ga0466965_0067857 | Ga0466965_0067857_383_1768 | 432 |
| 78 | 3300044712 | Ga0453684_0194796 | Ga0453684_0194796_822_2231 | 432 |
| 79 | 3300048912 | Ga0496109_0033424 | Ga0496109_0033424_2703_4109 | 432 |
| 80 | 3300048913 | Ga0496110_0016350 | Ga0496110_0016350_2243_3649 | 432 |
| 81 | 3300005455 | Ga0070663_100016762 | Ga0070663_1000167622 | 433 |
| 82 | 3300005616 | Ga0068852_100098610 | Ga0068852_1000986102 | 433 |
| 83 | 3300006042 | Ga0075368_10034903 | Ga0075368_100349032 | 433 |
| 84 | 3300006177 | Ga0075362_10003212 | Ga0075362_100032122 | 433 |
| 85 | 3300006353 | Ga0075370_10047533 | Ga0075370_100475331 | 433 |
| 86 | 3300009148 | Ga0105243_10065810 | Ga0105243_100658102 | 433 |
| 87 | 3300010375 | Ga0105239_10017636 | Ga0105239_100176364 | 433 |
| 88 | 3300025913 | Ga0207695_10034453 | Ga0207695_100344532 | 433 |
| 89 | 3300025914 | Ga0207671_10041368 | Ga0207671_100413682 | 433 |
| 90 | 3300026067 | Ga0207678_10012387 | Ga0207678_100123872 | 433 |
| 91 | 3300026116 | Ga0207674_10153284 | Ga0207674_101532842 | 433 |
| 92 | 3300027866 | Ga0209813_10005387 | Ga0209813_100053872 | 433 |
| 93 | 3300031456 | Ga0307513_10091445 | Ga0307513_100914452 | 433 |
| 94 | 3300046519 | Ga0495632_0017181 | Ga0495632_0017181_1260_2825 | 433 |
| 95 | 3300048929 | Ga0496126_0082898 | Ga0496126_0082898_1031_2455 | 433 |
| 96 | 3300050490 | nmdc:mga03n38_17291_c1 | nmdc:mga03n38_17291_c1_295_1860 | 433 |
| 97 | 3300050491 | nmdc:mga00v17_78600_c1 | nmdc:mga00v17_78600_c1_347_1912 | 433 |
| 98 | 3300050493 | nmdc:mga0k408_31974_c1 | nmdc:mga0k408_31974_c1_650_2215 | 433 |
| 99 | 3300050495 | nmdc:mga04h51_8087_c1 | nmdc:mga04h51_8087_c1_1188_2753 | 433 |
| 100 | 3300053139 | Ga0500568_0007211 | Ga0500568_0007211_3329_4894 | 433 |
| 101 | 3300003323 | rootH1_10002908 | rootH1_1000290817 | 434 |
| 102 | 3300003794 | Ga0055531_10005653 | Ga0055531_100056536 | 434 |
| 103 | 3300005329 | Ga0070683_100132244 | Ga0070683_1001322442 | 434 |
| 104 | 3300005539 | Ga0068853_100021881 | Ga0068853_1000218815 | 434 |
| 105 | 3300005578 | Ga0068854_100107239 | Ga0068854_1001072392 | 434 |
| 106 | 3300005616 | Ga0068852_100115605 | Ga0068852_1001156053 | 434 |
| 107 | 3300006195 | Ga0075366_10080707 | Ga0075366_100807072 | 434 |
| 108 | 3300006353 | Ga0075370_10014495 | Ga0075370_100144952 | 434 |
| 109 | 3300006944 | Ga0099823_1000486 | Ga0099823_100048611 | 434 |
| 110 | 3300009551 | Ga0105238_10067384 | Ga0105238_100673842 | 434 |
| 111 | 3300013296 | Ga0157374_10081211 | Ga0157374_100812112 | 434 |
| 112 | 3300025273 | Ga0209673_1002870 | Ga0209673_10028705 | 434 |
| 113 | 3300025299 | Ga0209256_1001512 | Ga0209256_100151217 | 434 |
| 114 | 3300025303 | Ga0209051_1001071 | Ga0209051_10010718 | 434 |
| 115 | 3300025304 | Ga0209257_1001479 | Ga0209257_100147916 | 434 |
| 116 | 3300025321 | Ga0207656_10041693 | Ga0207656_100416931 | 434 |
| 117 | 3300025909 | Ga0207705_10092283 | Ga0207705_100922831 | 434 |
| 118 | 3300026041 | Ga0207639_10078531 | Ga0207639_100785312 | 434 |
| 119 | 3300027296 | Ga0209389_1019082 | Ga0209389_10190824 | 434 |
| 120 | 3300027876 | Ga0209974_10007078 | Ga0209974_100070782 | 434 |
| 121 | 3300050493 | nmdc:mga0k408_98135_c1 | nmdc:mga0k408_98135_c1_243_1715 | 434 |
| 122 | 3300046475 | Ga0495639_0072794 | Ga0495639_0072794_170_1564 | 435 |
| 123 | 3300047469 | Ga0495673_0000005 | Ga0495673_0000005_868449_869846 | 435 |
| 124 | 3300031507 | Ga0307509_10113167 | Ga0307509_101131672 | 436 |
| 125 | 3300003775 | Ga0055524_1000231 | Ga0055524_100023122 | 439 |
| 126 | 3300014325 | Ga0163163_10045881 | Ga0163163_100458814 | 439 |
| 127 | 3300025298 | Ga0209050_1007715 | Ga0209050_10077154 | 439 |
| 128 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019215 | 439 |
| 129 | 3300031456 | Ga0307513_10003902 | Ga0307513_1000390218 | 439 |
| 130 | 3300031838 | Ga0307518_10117944 | Ga0307518_101179442 | 439 |
| 131 | 3300048917 | Ga0496114_0012042 | Ga0496114_0012042_3896_5365 | 439 |
| 132 | 3300005564 | Ga0070664_100106188 | Ga0070664_1001061881 | 440 |
| 133 | 3300006195 | Ga0075366_10000953 | Ga0075366_100009532 | 440 |
| 134 | 3300025945 | Ga0207679_10015513 | Ga0207679_100155134 | 440 |
| 135 | 3300050493 | nmdc:mga0k408_2372_c1 | nmdc:mga0k408_2372_c1_5948_7450 | 440 |
| 136 | 3300006173 | Ga0070716_100008307 | Ga0070716_1000083073 | 441 |
| 137 | 3300025939 | Ga0207665_10023938 | Ga0207665_100239381 | 441 |
| 138 | 3300003316 | rootH1_10034163 | rootH1_100341632 | 442 |
| 139 | 3300006195 | Ga0075366_10006670 | Ga0075366_100066702 | 442 |
| 140 | 3300025939 | Ga0207665_10071907 | Ga0207665_100719072 | 442 |
| 141 | 3300046660 | Ga0495625_0013475 | Ga0495625_0013475_2315_3883 | 442 |
| 142 | 3300046694 | Ga0495649_0005207 | Ga0495649_0005207_3361_4926 | 442 |
| 143 | 3300047443 | Ga0495687_000719 | Ga0495687_000719_31579_33144 | 442 |
| 144 | 3300050493 | nmdc:mga0k408_8217_c1 | nmdc:mga0k408_8217_c1_295_1860 | 442 |
| 145 | 3300014968 | Ga0157379_10023321 | Ga0157379_100233213 | 443 |
| 146 | 3300006195 | Ga0075366_10013544 | Ga0075366_100135442 | 444 |
| 147 | 3300028786 | Ga0307517_10034295 | Ga0307517_100342952 | 444 |
| 148 | 3300046460 | Ga0495638_0006325 | Ga0495638_0006325_2238_3713 | 444 |
| 149 | 3300046460 | Ga0495638_0046824 | Ga0495638_0046824_778_2208 | 444 |
| 150 | 3300050493 | nmdc:mga0k408_866_c1 | nmdc:mga0k408_866_c1_13502_14938 | 444 |
| 151 | iso_pu_bacteria | 2857558681 | 2857560118 | 444 |
| 152 | iso_pu_bacteria | 2857564685 | 2857566695 | 444 |
| 153 | 3300002987 | JGI25159J45721_1002918 | JGI25159J45721_10029184 | 445 |
| 154 | 3300003771 | Ga0055526_1000283 | Ga0055526_100028322 | 445 |
| 155 | 3300003773 | Ga0055537_1000063 | Ga0055537_100006328 | 445 |
| 156 | 3300003784 | Ga0055534_1000208 | Ga0055534_10002089 | 445 |
| 157 | 3300003790 | Ga0055528_1000013 | Ga0055528_1000013121 | 445 |
| 158 | 3300005262 | Ga0065165_1000005 | Ga0065165_100000556 | 445 |
| 159 | 3300005262 | Ga0065165_1022534 | Ga0065165_10225342 | 445 |
| 160 | 3300025263 | Ga0209565_1000003 | Ga0209565_1000003524 | 445 |
| 161 | 3300025273 | Ga0209673_1000003 | Ga0209673_1000003410 | 445 |
| 162 | 3300025284 | Ga0209130_1000046 | Ga0209130_100004696 | 445 |
| 163 | 3300025291 | Ga0209675_1000003 | Ga0209675_1000003514 | 445 |
| 164 | 3300025295 | Ga0209564_1000012 | Ga0209564_1000012322 | 445 |
| 165 | 3300025299 | Ga0209256_1000112 | Ga0209256_100011265 | 445 |
| 166 | 3300028794 | Ga0307515_10000821 | Ga0307515_1000082127 | 445 |
| 167 | 3300028800 | Ga0265338_10013956 | Ga0265338_100139563 | 445 |
| 168 | 3300031235 | Ga0265330_10011853 | Ga0265330_100118532 | 445 |
| 169 | 3300031239 | Ga0265328_10008184 | Ga0265328_100081843 | 445 |
| 170 | 3300031595 | Ga0265313_10023895 | Ga0265313_100238952 | 445 |
| 171 | 3300031711 | Ga0265314_10000081 | Ga0265314_100000819 | 445 |
| 172 | 3300046457 | Ga0495590_0000005 | Ga0495590_0000005_2645_4072 | 445 |
| 173 | 3300046501 | Ga0495607_0008173 | Ga0495607_0008173_3108_4529 | 445 |
| 174 | 3300046512 | Ga0495610_0003889 | Ga0495610_0003889_1821_3251 | 445 |
| 175 | 3300046522 | Ga0495643_0000516 | Ga0495643_0000516_44225_45652 | 445 |
| 176 | 3300046538 | Ga0495609_0001952 | Ga0495609_0001952_9291_10712 | 445 |
| 177 | 3300046542 | Ga0495597_0000936 | Ga0495597_0000936_2492_3919 | 445 |
| 178 | 3300046616 | Ga0495668_0000006 | Ga0495668_0000006_3211_4635 | 445 |
| 179 | 3300046616 | Ga0495668_0001037 | Ga0495668_0001037_2525_3952 | 445 |
| 180 | 3300046616 | Ga0495668_0005457 | Ga0495668_0005457_5702_7123 | 445 |
| 181 | 3300046660 | Ga0495625_0007589 | Ga0495625_0007589_3646_5067 | 445 |
| 182 | 3300046684 | Ga0495669_0009656 | Ga0495669_0009656_685_2106 | 445 |
| 183 | 3300046810 | Ga0495660_0028502 | Ga0495660_0028502_1714_3135 | 445 |
| 184 | 3300047443 | Ga0495687_001182 | Ga0495687_001182_2429_3862 | 445 |
| 185 | 3300047443 | Ga0495687_032737 | Ga0495687_032737_516_1937 | 445 |
| 186 | 3300047445 | Ga0495677_0002811 | Ga0495677_0002811_2940_4361 | 445 |
| 187 | 3300047470 | Ga0495681_0017829 | Ga0495681_0017829_1815_3236 | 445 |
| 188 | 3300047472 | Ga0495686_0001694 | Ga0495686_0001694_18909_20333 | 445 |
| 189 | 3300049459 | Ga0495678_012811 | Ga0495678_012811_200_1627 | 445 |
| 190 | iso_pu_bacteria | 2842711865 | 2842716519 | 445 |
| 191 | 3300003320 | rootH2_10051907 | rootH2_100519074 | 446 |
| 192 | 3300005329 | Ga0070683_100009180 | Ga0070683_1000091805 | 446 |
| 193 | 3300005329 | Ga0070683_100080553 | Ga0070683_1000805532 | 446 |
| 194 | 3300005334 | Ga0068869_100015798 | Ga0068869_1000157982 | 446 |
| 195 | 3300005338 | Ga0068868_100000459 | Ga0068868_1000004595 | 446 |
| 196 | 3300005355 | Ga0070671_100010892 | Ga0070671_1000108925 | 446 |
| 197 | 3300005367 | Ga0070667_100003020 | Ga0070667_1000030202 | 446 |
| 198 | 3300005435 | Ga0070714_100022255 | Ga0070714_1000222554 | 446 |
| 199 | 3300005539 | Ga0068853_100193960 | Ga0068853_1001939601 | 446 |
| 200 | 3300005548 | Ga0070665_100045053 | Ga0070665_1000450532 | 446 |
| 201 | 3300005563 | Ga0068855_100002944 | Ga0068855_10000294411 | 446 |
| 202 | 3300005563 | Ga0068855_100003346 | Ga0068855_10000334617 | 446 |
| 203 | 3300005563 | Ga0068855_100017040 | Ga0068855_1000170402 | 446 |
| 204 | 3300005577 | Ga0068857_100029350 | Ga0068857_1000293502 | 446 |
| 205 | 3300005616 | Ga0068852_100000029 | Ga0068852_10000002984 | 446 |
| 206 | 3300005617 | Ga0068859_100009449 | Ga0068859_1000094492 | 446 |
| 207 | 3300005841 | Ga0068863_100004264 | Ga0068863_1000042644 | 446 |
| 208 | 3300005842 | Ga0068858_100003059 | Ga0068858_1000030595 | 446 |
| 209 | 3300005843 | Ga0068860_100002923 | Ga0068860_10000292314 | 446 |
| 210 | 3300006358 | Ga0068871_100002115 | Ga0068871_10000211510 | 446 |
| 211 | 3300006931 | Ga0097620_100009449 | Ga0097620_1000094492 | 446 |
| 212 | 3300009093 | Ga0105240_10001689 | Ga0105240_100016893 | 446 |
| 213 | 3300009177 | Ga0105248_10007741 | Ga0105248_100077413 | 446 |
| 214 | 3300009551 | Ga0105238_10022854 | Ga0105238_100228542 | 446 |
| 215 | 3300013105 | Ga0157369_10056323 | Ga0157369_100563232 | 446 |
| 216 | 3300013307 | Ga0157372_10033363 | Ga0157372_100333633 | 446 |
| 217 | 3300025911 | Ga0207654_10000071 | Ga0207654_1000007135 | 446 |
| 218 | 3300025913 | Ga0207695_10000052 | Ga0207695_10000052183 | 446 |
| 219 | 3300025913 | Ga0207695_10000108 | Ga0207695_10000108195 | 446 |
| 220 | 3300025913 | Ga0207695_10000871 | Ga0207695_1000087138 | 446 |
| 221 | 3300025913 | Ga0207695_10001287 | Ga0207695_1000128728 | 446 |
| 222 | 3300025913 | Ga0207695_10007296 | Ga0207695_100072966 | 446 |
| 223 | 3300025920 | Ga0207649_10032172 | Ga0207649_100321723 | 446 |
| 224 | 3300025920 | Ga0207649_10114977 | Ga0207649_101149772 | 446 |
| 225 | 3300025924 | Ga0207694_10000325 | Ga0207694_100003257 | 446 |
| 226 | 3300025924 | Ga0207694_10001907 | Ga0207694_100019072 | 446 |
| 227 | 3300025924 | Ga0207694_10029904 | Ga0207694_100299041 | 446 |
| 228 | 3300025927 | Ga0207687_10005795 | Ga0207687_100057953 | 446 |
| 229 | 3300025927 | Ga0207687_10014384 | Ga0207687_100143843 | 446 |
| 230 | 3300025931 | Ga0207644_10017370 | Ga0207644_100173702 | 446 |
| 231 | 3300025941 | Ga0207711_10005714 | Ga0207711_100057142 | 446 |
| 232 | 3300025941 | Ga0207711_10009838 | Ga0207711_100098383 | 446 |
| 233 | 3300025942 | Ga0207689_10000130 | Ga0207689_100001302 | 446 |
| 234 | 3300025944 | Ga0207661_10025351 | Ga0207661_100253511 | 446 |
| 235 | 3300025944 | Ga0207661_10068305 | Ga0207661_100683052 | 446 |
| 236 | 3300025949 | Ga0207667_10006870 | Ga0207667_1000687011 | 446 |
| 237 | 3300025986 | Ga0207658_10002873 | Ga0207658_100028733 | 446 |
| 238 | 3300026023 | Ga0207677_10002815 | Ga0207677_100028152 | 446 |
| 239 | 3300026035 | Ga0207703_10012835 | Ga0207703_100128354 | 446 |
| 240 | 3300026041 | Ga0207639_10000180 | Ga0207639_1000018028 | 446 |
| 241 | 3300026078 | Ga0207702_10013479 | Ga0207702_100134794 | 446 |
| 242 | 3300026078 | Ga0207702_10065861 | Ga0207702_100658612 | 446 |
| 243 | 3300026088 | Ga0207641_10002565 | Ga0207641_100025651 | 446 |
| 244 | 3300026116 | Ga0207674_10000910 | Ga0207674_100009109 | 446 |
| 245 | 3300026142 | Ga0207698_10000007 | Ga0207698_10000007182 | 446 |
| 246 | 3300026142 | Ga0207698_10034846 | Ga0207698_100348462 | 446 |
| 247 | 3300026142 | Ga0207698_10066809 | Ga0207698_100668092 | 446 |
| 248 | 3300028381 | Ga0268264_10003544 | Ga0268264_100035447 | 446 |
| 249 | 3300028800 | Ga0265338_10114529 | Ga0265338_101145292 | 446 |
| 250 | 3300031235 | Ga0265330_10000828 | Ga0265330_1000082813 | 446 |
| 251 | 3300031241 | Ga0265325_10000664 | Ga0265325_1000066417 | 446 |
| 252 | 3300031249 | Ga0265339_10000089 | Ga0265339_1000008936 | 446 |
| 253 | 3300031344 | Ga0265316_10000687 | Ga0265316_1000068731 | 446 |
| 254 | 3300031595 | Ga0265313_10006038 | Ga0265313_100060383 | 446 |
| 255 | 3300031712 | Ga0265342_10003868 | Ga0265342_100038686 | 446 |
| 256 | 3300031712 | Ga0265342_10005184 | Ga0265342_100051842 | 446 |
| 257 | 3300033180 | Ga0307510_10065288 | Ga0307510_100652883 | 446 |
| 258 | 3300042876 | Ga0451577_0023261 | Ga0451577_0023261_4132_5511 | 446 |
| 259 | 3300046471 | Ga0495650_0000115 | Ga0495650_0000115_138560_139987 | 446 |
| 260 | 3300046507 | Ga0495606_0000053 | Ga0495606_0000053_4228_5661 | 446 |
| 261 | 3300046507 | Ga0495606_0039977 | Ga0495606_0039977_250_1677 | 446 |
| 262 | 3300046512 | Ga0495610_0000181 | Ga0495610_0000181_15906_17339 | 446 |
| 263 | 3300046558 | Ga0495633_0020109 | Ga0495633_0020109_1692_3125 | 446 |
| 264 | 3300046616 | Ga0495668_0000931 | Ga0495668_0000931_27535_28968 | 446 |
| 265 | 3300046660 | Ga0495625_0019381 | Ga0495625_0019381_2983_4410 | 446 |
| 266 | 3300046665 | Ga0495661_0070356 | Ga0495661_0070356_181_1608 | 446 |
| 267 | 3300047472 | Ga0495686_0011656 | Ga0495686_0011656_2551_3984 | 446 |
| 268 | 3300047472 | Ga0495686_0024618 | Ga0495686_0024618_930_2357 | 446 |
| 269 | 3300048918 | Ga0496115_0015447 | Ga0496115_0015447_2986_4425 | 446 |
| 270 | 3300048929 | Ga0496126_0000286 | Ga0496126_0000286_41108_42535 | 446 |
| 271 | 3300053093 | Ga0500651_0000002 | Ga0500651_0000002_313873_315300 | 446 |
| 272 | 3300053119 | Ga0500595_000044 | Ga0500595_000044_80179_81606 | 446 |
| 273 | 3300003775 | Ga0055524_1000025 | Ga0055524_100002573 | 447 |
| 274 | 3300006948 | Ga0099826_10000005 | Ga0099826_10000005112 | 447 |
| 275 | 3300025299 | Ga0209256_1000040 | Ga0209256_1000040112 | 447 |
| 276 | 3300027666 | Ga0209282_1000003 | Ga0209282_1000003688 | 447 |
| 277 | 3300046520 | Ga0495637_0000207 | Ga0495637_0000207_42304_43737 | 447 |
| 278 | 3300046530 | Ga0495654_0000002 | Ga0495654_0000002_969954_971387 | 447 |
| 279 | 3300053125 | Ga0500618_000258 | Ga0500618_000258_3548_4978 | 447 |
| 280 | 3300053136 | Ga0500559_0000670 | Ga0500559_0000670_2466_3965 | 447 |
| 281 | iso_pu_bacteria | 2643221544 | 2643745946 | 447 |
| 282 | iso_pu_bacteria | 2643221585 | 2643936919 | 447 |
| 283 | iso_pu_bacteria | 2643221656 | 2644318084 | 447 |
| 284 | 3300004625 | Ga0055543_1004851 | Ga0055543_10048513 | 448 |
| 285 | 3300005262 | Ga0065165_1000600 | Ga0065165_100060037 | 448 |
| 286 | 3300009036 | Ga0105244_10014545 | Ga0105244_100145452 | 448 |
| 287 | 3300037312 | Ga0395899_0021331 | Ga0395899_0021331_2445_3881 | 448 |
| 288 | 3300037471 | Ga0395905_0058968 | Ga0395905_0058968_193_1629 | 448 |
| 289 | 3300038443 | Ga0395901_0116165 | Ga0395901_0116165_275_1711 | 448 |
| 290 | 3300044656 | Ga0466969_0067618 | Ga0466969_0067618_157_1596 | 448 |
| 291 | 3300044684 | Ga0466966_0073230 | Ga0466966_0073230_585_2024 | 448 |
| 292 | 3300046452 | Ga0495617_000033 | Ga0495617_000033_144108_145541 | 448 |
| 293 | 3300046471 | Ga0495650_0001166 | Ga0495650_0001166_3353_4792 | 448 |
| 294 | 3300046507 | Ga0495606_0007009 | Ga0495606_0007009_2273_3703 | 448 |
| 295 | 3300046507 | Ga0495606_0016008 | Ga0495606_0016008_1056_2489 | 448 |
| 296 | 3300046512 | Ga0495610_0003889 | Ga0495610_0003889_7613_9043 | 448 |
| 297 | 3300046810 | Ga0495660_0012961 | Ga0495660_0012961_975_2411 | 448 |
| 298 | 3300048929 | Ga0496126_0038132 | Ga0496126_0038132_2958_4394 | 448 |
| 299 | 3300050496 | nmdc:mga07m45_52257_c1 | nmdc:mga07m45_52257_c1_507_2060 | 448 |
| 300 | iso_pu_bacteria | 2643221639 | 2644220840 | 448 |
| 301 | iso_pu_bacteria | 2643221646 | 2644256551 | 448 |
| 302 | iso_pu_bacteria | 2830075706 | 2830076674 | 448 |
| 303 | 3300002774 | JGI25150J39212_1000845 | JGI25150J39212_10008452 | 449 |
| 304 | 3300003791 | Ga0055530_10001969 | Ga0055530_100019693 | 449 |
| 305 | 3300003792 | Ga0055540_1000007 | Ga0055540_1000007144 | 449 |
| 306 | 3300006042 | Ga0075368_10049595 | Ga0075368_100495951 | 449 |
| 307 | 3300025245 | Ga0207425_1000297 | Ga0207425_100029712 | 449 |
| 308 | 3300025294 | Ga0209025_1009487 | Ga0209025_10094872 | 449 |
| 309 | 3300025297 | Ga0209758_1000470 | Ga0209758_100047037 | 449 |
| 310 | 3300025298 | Ga0209050_1002564 | Ga0209050_10025644 | 449 |
| 311 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004197 | 449 |
| 312 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038331 | 449 |
| 313 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044228 | 449 |
| 314 | 3300031730 | Ga0307516_10013080 | Ga0307516_100130803 | 449 |
| 315 | 3300033180 | Ga0307510_10000207 | Ga0307510_1000020726 | 449 |
| 316 | 3300033180 | Ga0307510_10054384 | Ga0307510_100543842 | 449 |
| 317 | 3300046460 | Ga0495638_0000436 | Ga0495638_0000436_2535_3971 | 449 |
| 318 | 3300046471 | Ga0495650_0000909 | Ga0495650_0000909_13843_15285 | 449 |
| 319 | 3300046471 | Ga0495650_0001915 | Ga0495650_0001915_14609_16045 | 449 |
| 320 | 3300046506 | Ga0495583_0000709 | Ga0495583_0000709_2389_3825 | 449 |
| 321 | 3300046507 | Ga0495606_0025808 | Ga0495606_0025808_2658_4100 | 449 |
| 322 | 3300046512 | Ga0495610_0012165 | Ga0495610_0012165_2454_3887 | 449 |
| 323 | 3300046512 | Ga0495610_0047952 | Ga0495610_0047952_537_2009 | 449 |
| 324 | 3300046522 | Ga0495643_0000195 | Ga0495643_0000195_3050_4483 | 449 |
| 325 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_392635_394071 | 449 |
| 326 | 3300046528 | Ga0495642_0005491 | Ga0495642_0005491_2363_3799 | 449 |
| 327 | 3300046538 | Ga0495609_0009864 | Ga0495609_0009864_3118_4554 | 449 |
| 328 | 3300046542 | Ga0495597_0000322 | Ga0495597_0000322_39565_40998 | 449 |
| 329 | 3300046557 | Ga0495622_0000810 | Ga0495622_0000810_13499_14935 | 449 |
| 330 | 3300046558 | Ga0495633_0000382 | Ga0495633_0000382_2876_4312 | 449 |
| 331 | 3300046558 | Ga0495633_0006458 | Ga0495633_0006458_2573_4009 | 449 |
| 332 | 3300046558 | Ga0495633_0011051 | Ga0495633_0011051_970_2403 | 449 |
| 333 | 3300046660 | Ga0495625_0000124 | Ga0495625_0000124_117018_118454 | 449 |
| 334 | 3300046660 | Ga0495625_0001378 | Ga0495625_0001378_158_1708 | 449 |
| 335 | 3300046660 | Ga0495625_0006874 | Ga0495625_0006874_6125_7558 | 449 |
| 336 | 3300046694 | Ga0495649_0012321 | Ga0495649_0012321_2241_3674 | 449 |
| 337 | 3300047320 | Ga0495672_0000398 | Ga0495672_0000398_49057_50490 | 449 |
| 338 | 3300047472 | Ga0495686_0036736 | Ga0495686_0036736_181_1731 | 449 |
| 339 | 3300048927 | Ga0496124_0093200 | Ga0496124_0093200_136_1578 | 449 |
| 340 | 3300049459 | Ga0495678_000291 | Ga0495678_000291_2365_3798 | 449 |
| 341 | 3300049459 | Ga0495678_011834 | Ga0495678_011834_186_1622 | 449 |
| 342 | 3300053093 | Ga0500651_0005156 | Ga0500651_0005156_3477_4949 | 449 |
| 343 | 3300053118 | Ga0500594_0001863 | Ga0500594_0001863_2197_3669 | 449 |
| 344 | 3300053136 | Ga0500559_0000049 | Ga0500559_0000049_24053_25525 | 449 |
| 345 | 3300053145 | Ga0500586_000361 | Ga0500586_000361_5117_6550 | 449 |
| 346 | 3300053156 | Ga0500622_0003710 | Ga0500622_0003710_3080_4552 | 449 |
| 347 | 3300044656 | Ga0466969_0019479 | Ga0466969_0019479_477_1985 | 450 |
| 348 | 3300044683 | Ga0466965_0011906 | Ga0466965_0011906_249_1757 | 450 |
| 349 | 3300044693 | Ga0466961_0010615 | Ga0466961_0010615_368_1876 | 450 |
| 350 | 3300044765 | Ga0466970_0093423 | Ga0466970_0093423_83_1591 | 450 |
| 351 | 3300044901 | Ga0466960_0021626 | Ga0466960_0021626_236_1744 | 450 |
| 352 | 3300046538 | Ga0495609_0012100 | Ga0495609_0012100_2462_3895 | 450 |
| 353 | 3300047443 | Ga0495687_006047 | Ga0495687_006047_3674_5107 | 450 |
| 354 | 3300048905 | Ga0496102_0029736 | Ga0496102_0029736_3390_4856 | 450 |
| 355 | 3300053117 | Ga0500593_000662 | Ga0500593_000662_7560_9026 | 450 |
| 356 | iso_pu_bacteria | 2585428062 | 2587756170 | 450 |
| 357 | iso_pu_bacteria | 2585428062 | 2587758192 | 450 |
| 358 | 3300003316 | rootH1_10021293 | rootH1_100212936 | 451 |
| 359 | 3300003322 | rootL2_10063119 | rootL2_100631197 | 451 |
| 360 | 3300003323 | rootH1_10199011 | rootH1_101990112 | 451 |
| 361 | 3300003791 | Ga0055530_10003523 | Ga0055530_100035235 | 451 |
| 362 | 3300003792 | Ga0055540_1000002 | Ga0055540_1000002224 | 451 |
| 363 | 3300003794 | Ga0055531_10004266 | Ga0055531_100042667 | 451 |
| 364 | 3300005328 | Ga0070676_10043747 | Ga0070676_100437472 | 451 |
| 365 | 3300005330 | Ga0070690_100010947 | Ga0070690_1000109472 | 451 |
| 366 | 3300005333 | Ga0070677_10046585 | Ga0070677_100465852 | 451 |
| 367 | 3300005335 | Ga0070666_10013184 | Ga0070666_100131845 | 451 |
| 368 | 3300005338 | Ga0068868_100012059 | Ga0068868_1000120591 | 451 |
| 369 | 3300005340 | Ga0070689_100028788 | Ga0070689_1000287883 | 451 |
| 370 | 3300005344 | Ga0070661_100018235 | Ga0070661_1000182353 | 451 |
| 371 | 3300005354 | Ga0070675_100003600 | Ga0070675_1000036006 | 451 |
| 372 | 3300005366 | Ga0070659_100001364 | Ga0070659_10000136415 | 451 |
| 373 | 3300005456 | Ga0070678_100009945 | Ga0070678_1000099453 | 451 |
| 374 | 3300005564 | Ga0070664_100011153 | Ga0070664_1000111535 | 451 |
| 375 | 3300005617 | Ga0068859_100011237 | Ga0068859_1000112375 | 451 |
| 376 | 3300005618 | Ga0068864_100000508 | Ga0068864_10000050823 | 451 |
| 377 | 3300005834 | Ga0068851_10031800 | Ga0068851_100318002 | 451 |
| 378 | 3300005842 | Ga0068858_100007399 | Ga0068858_1000073996 | 451 |
| 379 | 3300005843 | Ga0068860_100029800 | Ga0068860_1000298003 | 451 |
| 380 | 3300006353 | Ga0075370_10020690 | Ga0075370_100206902 | 451 |
| 381 | 3300006931 | Ga0097620_100011237 | Ga0097620_1000112373 | 451 |
| 382 | 3300009177 | Ga0105248_10053312 | Ga0105248_100533123 | 451 |
| 383 | 3300013296 | Ga0157374_10086228 | Ga0157374_100862282 | 451 |
| 384 | 3300014325 | Ga0163163_10004179 | Ga0163163_100041794 | 451 |
| 385 | 3300014968 | Ga0157379_10017963 | Ga0157379_100179632 | 451 |
| 386 | 3300021384 | Ga0213876_10012608 | Ga0213876_100126084 | 451 |
| 387 | 3300025298 | Ga0209050_1000457 | Ga0209050_100045754 | 451 |
| 388 | 3300025303 | Ga0209051_1000024 | Ga0209051_1000024225 | 451 |
| 389 | 3300025304 | Ga0209257_1000079 | Ga0209257_1000079225 | 451 |
| 390 | 3300025893 | Ga0207682_10014949 | Ga0207682_100149492 | 451 |
| 391 | 3300025903 | Ga0207680_10003657 | Ga0207680_100036572 | 451 |
| 392 | 3300025907 | Ga0207645_10050339 | Ga0207645_100503392 | 451 |
| 393 | 3300025920 | Ga0207649_10002578 | Ga0207649_100025787 | 451 |
| 394 | 3300025926 | Ga0207659_10003304 | Ga0207659_100033045 | 451 |
| 395 | 3300025931 | Ga0207644_10021046 | Ga0207644_100210463 | 451 |
| 396 | 3300025932 | Ga0207690_10019544 | Ga0207690_100195442 | 451 |
| 397 | 3300025936 | Ga0207670_10019961 | Ga0207670_100199612 | 451 |
| 398 | 3300025938 | Ga0207704_10039101 | Ga0207704_100391012 | 451 |
| 399 | 3300025941 | Ga0207711_10086363 | Ga0207711_100863632 | 451 |
| 400 | 3300025945 | Ga0207679_10003600 | Ga0207679_100036005 | 451 |
| 401 | 3300026023 | Ga0207677_10009409 | Ga0207677_100094093 | 451 |
| 402 | 3300026095 | Ga0207676_10004582 | Ga0207676_100045823 | 451 |
| 403 | 3300026121 | Ga0207683_10056178 | Ga0207683_100561782 | 451 |
| 404 | 3300031548 | Ga0307408_100000046 | Ga0307408_10000004687 | 451 |
| 405 | 3300039437 | Ga0436365_0860276 | Ga0436365_0860276_1179_2558 | 451 |
| 406 | 3300041410 | Ga0439461_0001755 | Ga0439461_0001755_773_2146 | 451 |
| 407 | 3300042126 | Ga0450888_000211 | Ga0450888_000211_3378_4757 | 451 |
| 408 | 3300042129 | Ga0450891_000495 | Ga0450891_000495_1545_2924 | 451 |
| 409 | 3300042138 | Ga0450903_004917 | Ga0450903_004917_546_1925 | 451 |
| 410 | 3300042144 | Ga0450889_000406 | Ga0450889_000406_2555_3934 | 451 |
| 411 | 3300042531 | Ga0450918_000112 | Ga0450918_000112_12222_13721 | 451 |
| 412 | 3300042532 | Ga0450893_0004099 | Ga0450893_0004099_856_2235 | 451 |
| 413 | 3300048912 | Ga0496109_0038751 | Ga0496109_0038751_601_2079 | 451 |
| 414 | 3300049130 | Ga0501310_000422 | Ga0501310_000422_2008_3381 | 451 |
| 415 | 3300049658 | Ga0501211_000098 | Ga0501211_000098_3598_4971 | 451 |
| 416 | 3300049663 | Ga0501223_006978 | Ga0501223_006978_831_2204 | 451 |
| 417 | 3300049704 | Ga0501221_001202 | Ga0501221_001202_1331_2704 | 451 |
| 418 | 3300049764 | Ga0501267_000375 | Ga0501267_000375_1015_2388 | 451 |
| 419 | 3300050496 | nmdc:mga07m45_3456_c1 | nmdc:mga07m45_3456_c1_1995_3368 | 451 |
| 420 | iso_pu_bacteria | 2643221644 | 2644247780 | 451 |
| 421 | 3300003316 | rootH1_10001187 | rootH1_100011872 | 452 |
| 422 | 3300003322 | rootL2_10069657 | rootL2_100696573 | 452 |
| 423 | 3300003794 | Ga0055531_10000330 | Ga0055531_1000033012 | 452 |
| 424 | 3300005344 | Ga0070661_100140469 | Ga0070661_1001404691 | 452 |
| 425 | 3300014325 | Ga0163163_10198094 | Ga0163163_101980942 | 452 |
| 426 | 3300015690 | Ga0183363_1015 | Ga0183363_101549 | 452 |
| 427 | 3300025298 | Ga0209050_1003116 | Ga0209050_10031163 | 452 |
| 428 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032357 | 452 |
| 429 | 3300025304 | Ga0209257_1012510 | Ga0209257_10125102 | 452 |
| 430 | 3300026078 | Ga0207702_10251827 | Ga0207702_102518271 | 452 |
| 431 | 3300028794 | Ga0307515_10007649 | Ga0307515_1000764920 | 452 |
| 432 | 3300028794 | Ga0307515_10143864 | Ga0307515_101438642 | 452 |
| 433 | 3300031251 | Ga0265327_10001820 | Ga0265327_100018203 | 452 |
| 434 | 3300035114 | Ga0373939_0000004 | Ga0373939_0000004_58312_59688 | 452 |
| 435 | 3300035121 | Ga0373960_0001935 | Ga0373960_0001935_2420_3796 | 452 |
| 436 | 3300037471 | Ga0395905_0000117 | Ga0395905_0000117_75045_76643 | 452 |
| 437 | 3300042876 | Ga0451577_0002719 | Ga0451577_0002719_10233_11600 | 452 |
| 438 | 3300045051 | Ga0451576_0004176 | Ga0451576_0004176_3874_5241 | 452 |
| 439 | 3300045051 | Ga0451576_0132700 | Ga0451576_0132700_534_1910 | 452 |
| 440 | 3300047472 | Ga0495686_0040601 | Ga0495686_0040601_336_1721 | 452 |
| 441 | iso_pu_bacteria | 2643221654 | 2644305647 | 452 |
| 442 | 3300003322 | rootL2_10026577 | rootL2_100265772 | 453 |
| 443 | 3300003322 | rootL2_10057017 | rootL2_100570173 | 453 |
| 444 | 3300003323 | rootH1_10048416 | rootH1_100484162 | 453 |
| 445 | 3300005364 | Ga0070673_100090375 | Ga0070673_1000903752 | 453 |
| 446 | 3300006237 | Ga0097621_100084865 | Ga0097621_1000848652 | 453 |
| 447 | 3300013297 | Ga0157378_10041080 | Ga0157378_100410803 | 453 |
| 448 | 3300025925 | Ga0207650_10030324 | Ga0207650_100303242 | 453 |
| 449 | 3300025945 | Ga0207679_10037210 | Ga0207679_100372102 | 453 |
| 450 | 3300028786 | Ga0307517_10076967 | Ga0307517_100769672 | 453 |
| 451 | 3300028794 | Ga0307515_10053868 | Ga0307515_100538683 | 453 |
| 452 | 3300031730 | Ga0307516_10029199 | Ga0307516_100291992 | 453 |
| 453 | 3300037471 | Ga0395905_0001029 | Ga0395905_0001029_5204_6583 | 453 |
| 454 | 3300046660 | Ga0495625_0002387 | Ga0495625_0002387_16292_17815 | 453 |
| 455 | 3300050493 | nmdc:mga0k408_206_c1 | nmdc:mga0k408_206_c1_9164_10693 | 453 |
| 456 | 3300005459 | Ga0068867_100000104 | Ga0068867_10000010443 | 454 |
| 457 | 3300006195 | Ga0075366_10010043 | Ga0075366_100100432 | 454 |
| 458 | 3300009148 | Ga0105243_10028774 | Ga0105243_100287742 | 454 |
| 459 | 3300014745 | Ga0157377_10000010 | Ga0157377_10000010360 | 454 |
| 460 | 3300025935 | Ga0207709_10003711 | Ga0207709_100037113 | 454 |
| 461 | 3300026089 | Ga0207648_10000002 | Ga0207648_10000002296 | 454 |
| 462 | 3300028794 | Ga0307515_10000013 | Ga0307515_1000001351 | 454 |
| 463 | 3300028794 | Ga0307515_10011224 | Ga0307515_1001122411 | 454 |
| 464 | 3300031456 | Ga0307513_10004611 | Ga0307513_100046116 | 454 |
| 465 | 3300031456 | Ga0307513_10013254 | Ga0307513_100132547 | 454 |
| 466 | 3300042876 | Ga0451577_0085649 | Ga0451577_0085649_774_2330 | 454 |
| 467 | 3300044712 | Ga0453684_0017908 | Ga0453684_0017908_3472_5025 | 454 |
| 468 | 3300045051 | Ga0451576_0006080 | Ga0451576_0006080_9473_11029 | 454 |
| 469 | 3300046512 | Ga0495610_0014665 | Ga0495610_0014665_1230_2780 | 454 |
| 470 | 3300048913 | Ga0496110_0089314 | Ga0496110_0089314_1086_2693 | 454 |
| 471 | 3300050493 | nmdc:mga0k408_19148_c1 | nmdc:mga0k408_19148_c1_1357_2904 | 454 |
| 472 | 3300053134 | Ga0500658_0017066 | Ga0500658_0017066_1048_2598 | 454 |
| 473 | 3300028794 | Ga0307515_10000123 | Ga0307515_1000012331 | 455 |
| 474 | 3300030522 | Ga0307512_10022819 | Ga0307512_100228193 | 455 |
| 475 | 3300030522 | Ga0307512_10070486 | Ga0307512_100704861 | 455 |
| 476 | 3300031548 | Ga0307408_100032935 | Ga0307408_1000329351 | 455 |
| 477 | 3300031616 | Ga0307508_10000134 | Ga0307508_1000013420 | 455 |
| 478 | 3300046683 | Ga0495658_0027845 | Ga0495658_0027845_1269_2822 | 455 |
| 479 | 3300048913 | Ga0496110_0045911 | Ga0496110_0045911_875_2398 | 455 |
| 480 | 3300005331 | Ga0070670_100023816 | Ga0070670_1000238163 | 456 |
| 481 | 3300005331 | Ga0070670_100168566 | Ga0070670_1001685661 | 456 |
| 482 | 3300005355 | Ga0070671_100002176 | Ga0070671_1000021766 | 456 |
| 483 | 3300005445 | Ga0070708_100163057 | Ga0070708_1001630572 | 456 |
| 484 | 3300005543 | Ga0070672_100017706 | Ga0070672_1000177063 | 456 |
| 485 | 3300005844 | Ga0068862_100188068 | Ga0068862_1001880682 | 456 |
| 486 | 3300006237 | Ga0097621_100024443 | Ga0097621_1000244433 | 456 |
| 487 | 3300006358 | Ga0068871_100009407 | Ga0068871_1000094073 | 456 |
| 488 | 3300009148 | Ga0105243_10095312 | Ga0105243_100953122 | 456 |
| 489 | 3300009176 | Ga0105242_10004451 | Ga0105242_100044516 | 456 |
| 490 | 3300009177 | Ga0105248_10017921 | Ga0105248_100179212 | 456 |
| 491 | 3300025925 | Ga0207650_10035438 | Ga0207650_100354382 | 456 |
| 492 | 3300025931 | Ga0207644_10003061 | Ga0207644_100030612 | 456 |
| 493 | 3300025934 | Ga0207686_10013295 | Ga0207686_100132953 | 456 |
| 494 | 3300025940 | Ga0207691_10023893 | Ga0207691_100238934 | 456 |
| 495 | 3300025941 | Ga0207711_10005291 | Ga0207711_100052914 | 456 |
| 496 | 3300026142 | Ga0207698_10021579 | Ga0207698_100215793 | 456 |
| 497 | 3300037471 | Ga0395905_0014246 | Ga0395905_0014246_2187_3740 | 456 |
| 498 | 3300048911 | Ga0496108_0066961 | Ga0496108_0066961_278_1831 | 456 |
| 499 | 3300050493 | nmdc:mga0k408_67551_c1 | nmdc:mga0k408_67551_c1_343_1896 | 456 |
| 500 | 3300031456 | Ga0307513_10056384 | Ga0307513_100563842 | 457 |
| 501 | 3300028794 | Ga0307515_10054206 | Ga0307515_100542063 | 458 |
| 502 | 3300028563 | Ga0265319_1024086 | Ga0265319_10240862 | 459 |
| 503 | 3300031344 | Ga0265316_10000668 | Ga0265316_100006683 | 459 |
| 504 | 3300031824 | Ga0307413_10066872 | Ga0307413_100668722 | 460 |
| 505 | 3300032004 | Ga0307414_10058803 | Ga0307414_100588032 | 460 |
| 506 | 3300032005 | Ga0307411_10040292 | Ga0307411_100402922 | 460 |
| 507 | 3300046453 | Ga0495627_011912 | Ga0495627_011912_1485_2966 | 460 |
| 508 | 3300053079 | Ga0500610_0000519 | Ga0500610_0000519_2177_3652 | 460 |
| 509 | 3300053079 | Ga0500610_0000524 | Ga0500610_0000524_2177_3652 | 460 |
| 510 | 3300053117 | Ga0500593_000637 | Ga0500593_000637_2797_4272 | 460 |
| 511 | 3300053121 | Ga0500607_000025 | Ga0500607_000025_54386_55861 | 460 |
| 512 | 3300053158 | Ga0500627_0000836 | Ga0500627_0000836_2788_4269 | 460 |
| 513 | 3300053161 | Ga0500634_0000599 | Ga0500634_0000599_2832_4307 | 460 |
| 514 | 3300042015 | Ga0439462_0000640 | Ga0439462_0000640_447_1856 | 461 |
| 515 | 3300028380 | Ga0268265_10243245 | Ga0268265_102432451 | 465 |
| 516 | 3300046810 | Ga0495660_0073756 | Ga0495660_0073756_50_1525 | 465 |
| 517 | 3300025940 | Ga0207691_10106302 | Ga0207691_101063024 | 469 |
| 518 | iso_pu_bacteria | 2547132374 | 2548501838 | 469 |
| 519 | iso_pu_bacteria | 2643221609 | 2644060026 | 469 |
| 520 | iso_pu_bacteria | 2643221611 | 2644072630 | 469 |
| 521 | iso_pu_bacteria | 2643221717 | 2644646436 | 469 |
| 522 | iso_pu_bacteria | 2738543012 | 2739245654 | 469 |
| 523 | iso_pu_bacteria | 2816332133 | 2816470442 | 469 |
| 524 | iso_pu_bacteria | 2721755523 | 2722883036 | 470 |
| 525 | iso_pu_bacteria | 2839138175 | 2839143834 | 470 |
| 526 | 3300027614 | Ga0209970_1000371 | Ga0209970_10003713 | 472 |
| 527 | iso_pu_bacteria | 2643221570 | 2643864049 | 472 |
| 528 | iso_pu_bacteria | 2643221596 | 2643992359 | 472 |
| 529 | iso_pu_bacteria | 2643221652 | 2644292294 | 472 |
| 530 | iso_pu_bacteria | 2990710928 | 2990714580 | 472 |
| 531 | 3300006178 | Ga0075367_10095764 | Ga0075367_100957641 | 473 |
| 532 | 3300009176 | Ga0105242_10002719 | Ga0105242_100027192 | 473 |
| 533 | 3300049763 | Ga0501266_000571 | Ga0501266_000571_2750_4201 | 473 |
| 534 | 3300006946 | Ga0079104_1000026 | Ga0079104_1000026219 | 474 |
| 535 | 3300009092 | Ga0105250_10011713 | Ga0105250_100117132 | 474 |
| 536 | 3300025711 | Ga0207696_1018588 | Ga0207696_10185882 | 474 |
| 537 | 3300025935 | Ga0207709_10000079 | Ga0207709_1000007914 | 474 |
| 538 | 3300027111 | Ga0209281_1000067 | Ga0209281_1000067277 | 474 |
| 539 | 3300027876 | Ga0209974_10003224 | Ga0209974_100032247 | 477 |
| 540 | 3300028794 | Ga0307515_10068407 | Ga0307515_100684075 | 477 |
| 541 | 3300031238 | Ga0265332_10000006 | Ga0265332_10000006143 | 477 |
| 542 | 3300031456 | Ga0307513_10104709 | Ga0307513_101047092 | 477 |
| 543 | 3300031548 | Ga0307408_100000298 | Ga0307408_10000029827 | 477 |
| 544 | 3300031548 | Ga0307408_100000298 | Ga0307408_10000029829 | 477 |
| 545 | 3300031901 | Ga0307406_10000234 | Ga0307406_1000023419 | 477 |
| 546 | 3300031901 | Ga0307406_10000234 | Ga0307406_1000023421 | 477 |
| 547 | 3300042876 | Ga0451577_0012040 | Ga0451577_0012040_6530_7987 | 477 |
| 548 | 3300044673 | Ga0453683_0058409 | Ga0453683_0058409_901_2358 | 477 |
| 549 | 3300044712 | Ga0453684_0115348 | Ga0453684_0115348_1478_2935 | 477 |
| 550 | 3300044712 | Ga0453684_0272682 | Ga0453684_0272682_152_1609 | 477 |
| 551 | 3300045051 | Ga0451576_0069102 | Ga0451576_0069102_1361_2818 | 477 |
| 552 | 3300025937 | Ga0207669_10023996 | Ga0207669_100239962 | 478 |
| 553 | 3300026121 | Ga0207683_10085729 | Ga0207683_100857292 | 478 |
| 554 | iso_pu_bacteria | 2904541872 | 2904544978 | 478 |
| 555 | iso_pu_bacteria | 2929160207 | 2929163350 | 478 |
| 556 | 3300048926 | Ga0496123_0057100 | Ga0496123_0057100_743_2212 | 479 |
| 557 | iso_pu_bacteria | 2945984333 | 2945985688 | 479 |
| 558 | iso_pu_bacteria | 2738541277 | 2738717832 | 481 |
| 559 | iso_pu_bacteria | 2738543019 | 2739278518 | 481 |
| 560 | iso_pu_bacteria | 2599185214 | 2599623835 | 482 |
| 561 | iso_pu_bacteria | 2599185226 | 2599671546 | 482 |
| 562 | iso_pu_bacteria | 2599185227 | 2599681441 | 482 |
| 563 | iso_pu_bacteria | 2599185229 | 2599693156 | 482 |
| 564 | iso_pu_bacteria | 2643221672 | 2644400394 | 482 |
| 565 | iso_pu_bacteria | 2831265667 | 2831266440 | 482 |
| 566 | iso_pu_bacteria | 2838054893 | 2838057438 | 482 |
| 567 | iso_pu_bacteria | 2885198086 | 2885204576 | 482 |
| 568 | iso_pu_bacteria | 2885211737 | 2885218229 | 482 |
| 569 | iso_pu_bacteria | 2928084124 | 2928084448 | 482 |
| 570 | 3300003187 | JGI25151J46595_10000507 | JGI25151J46595_1000050729 | 483 |
| 571 | 3300005563 | Ga0068855_100135831 | Ga0068855_1001358313 | 483 |
| 572 | 3300005577 | Ga0068857_100069422 | Ga0068857_1000694222 | 483 |
| 573 | 3300005616 | Ga0068852_100065174 | Ga0068852_1000651744 | 483 |
| 574 | 3300006195 | Ga0075366_10006014 | Ga0075366_100060147 | 483 |
| 575 | 3300006353 | Ga0075370_10002530 | Ga0075370_100025308 | 483 |
| 576 | 3300010375 | Ga0105239_10094985 | Ga0105239_100949852 | 483 |
| 577 | 3300013104 | Ga0157370_10004596 | Ga0157370_100045969 | 483 |
| 578 | 3300013105 | Ga0157369_10005047 | Ga0157369_100050477 | 483 |
| 579 | 3300014497 | Ga0182008_10010462 | Ga0182008_100104624 | 483 |
| 580 | 3300025258 | Ga0209129_1004819 | Ga0209129_10048192 | 483 |
| 581 | 3300025294 | Ga0209025_1000104 | Ga0209025_1000104154 | 483 |
| 582 | 3300025949 | Ga0207667_10110980 | Ga0207667_101109802 | 483 |
| 583 | 3300026142 | Ga0207698_10016734 | Ga0207698_100167342 | 483 |
| 584 | 3300050496 | nmdc:mga07m45_63535_c1 | nmdc:mga07m45_63535_c1_278_1753 | 483 |
| 585 | 3300046557 | Ga0495622_0071767 | Ga0495622_0071767_20_1501 | 485 |
| 586 | 3300048904 | Ga0496101_0063906 | Ga0496101_0063906_260_1717 | 485 |
| 587 | 3300053136 | Ga0500559_0009307 | Ga0500559_0009307_2243_3703 | 485 |
| 588 | 3300003791 | Ga0055530_10005653 | Ga0055530_100056536 | 486 |
| 589 | 3300003792 | Ga0055540_1000365 | Ga0055540_100036516 | 486 |
| 590 | 3300003794 | Ga0055531_10000454 | Ga0055531_1000045426 | 486 |
| 591 | 3300017792 | Ga0163161_10013846 | Ga0163161_100138465 | 486 |
| 592 | 3300025291 | Ga0209675_1001875 | Ga0209675_10018753 | 486 |
| 593 | 3300025292 | Ga0209676_1000383 | Ga0209676_100038350 | 486 |
| 594 | 3300025294 | Ga0209025_1019246 | Ga0209025_10192462 | 486 |
| 595 | 3300025298 | Ga0209050_1000952 | Ga0209050_10009526 | 486 |
| 596 | 3300025303 | Ga0209051_1000259 | Ga0209051_100025951 | 486 |
| 597 | 3300025304 | Ga0209257_1000116 | Ga0209257_1000116175 | 486 |
| 598 | 3300025933 | Ga0207706_10018657 | Ga0207706_100186574 | 486 |
| 599 | 3300046513 | Ga0495616_0028134 | Ga0495616_0028134_566_2032 | 486 |
| 600 | 3300046518 | Ga0495631_0000408 | Ga0495631_0000408_14805_16271 | 486 |
| 601 | 3300046539 | Ga0495621_0001025 | Ga0495621_0001025_1103_2569 | 486 |
| 602 | 3300046683 | Ga0495658_0055156 | Ga0495658_0055156_83_1549 | 486 |
| 603 | 3300047673 | Ga0495593_0003185 | Ga0495593_0003185_734_2200 | 486 |
| 604 | 3300048089 | Ga0495614_0003925 | Ga0495614_0003925_560_2026 | 486 |
| 605 | 3300048919 | Ga0496116_0023363 | Ga0496116_0023363_501_1961 | 486 |
| 606 | 3300048920 | Ga0496117_0019331 | Ga0496117_0019331_2199_3659 | 486 |
| 607 | 3300048924 | Ga0496121_0066366 | Ga0496121_0066366_751_2211 | 486 |
| 608 | 3300048926 | Ga0496123_0016544 | Ga0496123_0016544_2471_3931 | 486 |
| 609 | 3300048926 | Ga0496123_0016684 | Ga0496123_0016684_2859_4325 | 486 |
| 610 | 3300053093 | Ga0500651_0000015 | Ga0500651_0000015_23597_25063 | 486 |
| 611 | 3300053110 | Ga0500571_000017 | Ga0500571_000017_39575_41041 | 486 |
| 612 | 3300053121 | Ga0500607_005461 | Ga0500607_005461_4479_5939 | 486 |
| 613 | 3300053133 | Ga0500655_000069 | Ga0500655_000069_15685_17151 | 486 |
| 614 | 3300053134 | Ga0500658_0000054 | Ga0500658_0000054_43251_44717 | 486 |
| 615 | 3300053134 | Ga0500658_0000248 | Ga0500658_0000248_321_1787 | 486 |
| 616 | 3300053138 | Ga0500564_012408 | Ga0500564_012408_1193_2659 | 486 |
| 617 | 3300053139 | Ga0500568_0001431 | Ga0500568_0001431_8482_9948 | 486 |
| 618 | 3300053153 | Ga0500616_0013029 | Ga0500616_0013029_1787_3253 | 486 |
| 619 | 3300053177 | Ga0500636_0013941 | Ga0500636_0013941_2913_4379 | 486 |
| 620 | 3300053729 | Ga0500625_022389 | Ga0500625_022389_870_2330 | 486 |
| 621 | 3300001979 | JGI24740J21852_10007769 | JGI24740J21852_100077693 | 487 |
| 622 | 3300048928 | Ga0496125_0020270 | Ga0496125_0020270_2770_4233 | 487 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g4g-assembly3.cif.gz_C | full length ectodomain of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) including the smb domains but with a partially disordered active site structure | 0.7496 | 296 | 375 |
| 4gtz-assembly1.cif.gz_A | crystal structure of mouse enpp1 in complex with cmp | 0.7406 | 295 | 380 |
| 4gtz-assembly2.cif.gz_B | crystal structure of mouse enpp1 in complex with cmp | 0.7258 | 317 | 380 |
| 6c01-assembly2.cif.gz_B | human ectonucleotide pyrophosphatase / phosphodiesterase 3 (enpp3, npp3, cd203c) | 0.722 | 295 | 379 |
| 6f2y-assembly2.cif.gz_B | crystal structure of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) in complex with ap4a | 0.7127 | 295 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6PGY9_139_533_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.6518 | 299 | 380 | 3.40.720.10 |
| 2zktA01 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.5716 | 50 | 401 | 3.40.720.10 |
| af_P75785_205_504_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.5567 | 50 | 459 | 3.40.720.10 |
| af_Q19963_189_388_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.5474 | 51 | 399 | 3.40.720.10 |
| af_Q19963_189_388_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.5407 | 51 | 399 | 3.40.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257H587-F1-model_v4 | Tat pathway signal protein | 0.9665 | 117 | 487 |
|
| AF-A0A257H587-F1-model_v4 | Tat pathway signal protein | 0.9639 | 117 | 487 |
|
| AF-A0A1V6EPF6-F1-model_v4 | Tat pathway signal protein | 0.962 | 99 | 487 |
|
| AF-A0A3C0KHH6-F1-model_v4 | Tat pathway signal protein | 0.9595 | 255 | 436 |
|
| AF-A0A1V6EPF6-F1-model_v4 | Tat pathway signal protein | 0.9571 | 99 | 487 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar