F470107

General Info

Members Datasets Scaffolds Average Seq Length
622 347 580 480

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1024086|Ga0265319_10240862
Length 543
Sequence MSQEHDVSHPHHPDRRRFLQRAASMSAMGAALPFGLNMGTLTQASAQSAGGNYKALVCLFFNGGNDAFNMVLATDSTSWGHYLHHRRPTDGSTSIALMEAGVAPVNTASGATPERLGGVLPINHAGRSVHAGRTFALHPALTRLQQIHNAGRACVVANVGPLTRPTSKLDYASAAASKPAKLFSHNDQQSTWQSFKPEGASEGWGGLMGDLLMSGNGGGRNATDAAIVQRMFTCMTPAQTSVWLAGRSVLPYQSSGTGIQSLGNSGRIYGNAGLQAAVASVMSTPPSGGSMPNDRASLFVLDQQKLVERALTASALLGSALAPLGTGPWSSPGATNPYSDTLLNYTSPIDGTQKFNGVALQLQMIARLIDTNRTANLGITRQLFMVNMGGFDTHDNQIREQADRLASLDHALSYFDNVLANMPGGDMRSQVTTFTASEFGRSFTSNGDGTDHGWGAHHIVMGGAVNGTEVYGTFPQYSSADTAGNFSSPDQIQNGVLIPTTSVDQYAYTLGKWMGVGTSDLAALLPNLSQFNASTHDLAFMKA

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
18 2643221656 Pelomonas sp. Root405 Isolate Unclassified
19 2643221672 Variovorax sp. Root434 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2721755523 Delftia sp. HK171 Isolate Unclassified
22 2738541277 Variovorax sp. GV051 Isolate Unclassified
23 2738543012 Acidovorax sp. CF301 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
27 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
30 2842711865 Duganella sp. R-73148 Isolate Unclassified
31 2857558681 Duganella sp. R-74565 Isolate Unclassified
32 2857564685 Duganella sp. R-74599 Isolate Unclassified
33 2885198086 Variovorax sp. 679 Isolate Unclassified
34 2885211737 Variovorax sp. 553 Isolate Unclassified
35 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
39 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
232 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
233 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
234 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
235 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
258 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
263 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
264 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
311 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
312 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
313 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
319 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
320 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
331 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
332 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
333 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
334 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
335 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
336 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
345 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0.32
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.94
Nodule 1.45
Rhizoplane 2.41
Rhizosphere 61.9
Stem 0
Stem Tuber 0
Unclassified 14.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007769 3300001979 Bacteria 4333
2 JGI25150J39212_1000845 3300002774 Bacteria 10242
3 JGI25159J45721_1002918 3300002987 Bacteria 6233
4 JGI25151J46595_10000507 3300003187 Bacteria 36540
5 rootH1_10001187 3300003316 Bacteria 5206
6 rootH1_10021293 3300003316 Bacteria 8669
7 rootH1_10034163 3300003316 Bacteria 3731
8 rootH2_10051907 3300003320 Bacteria 8638
9 rootH2_10236065 3300003320 Unclassified 3878
10 rootL2_10026577 3300003322 Bacteria 4533
11 rootL2_10057017 3300003322 Bacteria 2894
12 rootL2_10063119 3300003322 Bacteria 10161
13 rootL2_10069657 3300003322 Bacteria 5441
14 rootH1_10002908 3300003316 Bacteria 4973
15 rootH1_10002908 3300003323 Bacteria 22675
16 rootH1_10048416 3300003323 Bacteria 5759
17 rootH1_10199011 3300003323 Bacteria 2496
18 Ga0055526_1000019 3300003771 Bacteria 189698
19 Ga0055526_1000283 3300003771 Bacteria 42457
20 Ga0055537_1000063 3300003773 Bacteria 77468
21 Ga0055524_1000025 3300003775 Bacteria 216427
22 Ga0055524_1000231 3300003775 Bacteria 59530
23 Ga0055534_1000208 3300003784 Bacteria 43225
24 Ga0055528_1000013 3300003790 Bacteria 176239
25 Ga0055530_10001969 3300003791 Bacteria 13982
26 Ga0055530_10003523 3300003791 Bacteria 8838
27 Ga0055530_10005653 3300003791 Bacteria 5856
28 Ga0055540_1000002 3300003792 Bacteria 436954
29 Ga0055540_1000007 3300003792 Bacteria 318178
30 Ga0055540_1000365 3300003792 Bacteria 38078
31 Ga0055531_10000330 3300003794 Bacteria 46755
32 Ga0055531_10000454 3300003794 Bacteria 38078
33 Ga0055531_10004266 3300003794 Bacteria 8787
34 Ga0055531_10005653 3300003794 Bacteria 7265
35 Ga0055543_1004851 3300004625 Bacteria 3563
36 Ga0065165_1000005 3300005262 Bacteria 370361
37 Ga0065165_1000600 3300005262 Bacteria 52753
38 Ga0065165_1022534 3300005262 Bacteria 2157
39 Ga0070676_10043747 3300005328 Bacteria 2603
40 Ga0070683_100009180 3300005329 Bacteria 8443
41 Ga0070683_100080553 3300005329 Bacteria 3048
42 Ga0070683_100132244 3300005329 Bacteria 2361
43 Ga0070690_100010947 3300005330 Bacteria 5294
44 Ga0070670_100023816 3300005331 Bacteria 5268
45 Ga0070670_100168566 3300005331 Bacteria 1899
46 Ga0070677_10046585 3300005333 Bacteria 1734
47 Ga0068869_100015798 3300005334 Bacteria 5074
48 Ga0070666_10013184 3300005335 Bacteria 5239
49 Ga0068868_100000459 3300005338 Bacteria 27077
50 Ga0068868_100012059 3300005338 Bacteria 6311
51 Ga0070689_100028788 3300005340 Bacteria 4202
52 Ga0070661_100018235 3300005344 Bacteria 4988
53 Ga0070661_100140469 3300005344 Bacteria 1820
54 Ga0070669_100000003 3300005353 Bacteria 338807
55 Ga0070669_100003404 3300005353 Bacteria 11448
56 Ga0070675_100003600 3300005354 Bacteria 11783
57 Ga0070671_100002176 3300005355 Bacteria 15130
58 Ga0070671_100010892 3300005355 Bacteria 7302
59 Ga0070673_100090375 3300005364 Bacteria 2501
60 Ga0070659_100001364 3300005366 Bacteria 17584
61 Ga0070667_100003020 3300005367 Bacteria 14462
62 Ga0070714_100022255 3300005435 Bacteria 5195
63 Ga0070708_100163057 3300005445 Bacteria 2078
64 Ga0070663_100016762 3300005455 Bacteria 4768
65 Ga0070678_100009945 3300005456 Bacteria 5784
66 Ga0068867_100000104 3300005459 Bacteria 53850
67 Ga0068853_100021881 3300005539 Bacteria 5333
68 Ga0068853_100193960 3300005539 Bacteria 1846
69 Ga0070672_100017706 3300005543 Bacteria 5133
70 Ga0070665_100045053 3300005548 Unclassified 4429
71 Ga0068855_100002944 3300005563 Bacteria 20808
72 Ga0068855_100003346 3300005563 Bacteria 19628
73 Ga0068855_100017040 3300005563 Bacteria 8740
74 Ga0068855_100135831 3300005563 Bacteria 2806
75 Ga0070664_100011153 3300005564 Bacteria 7288
76 Ga0070664_100106188 3300005564 Bacteria 2446
77 Ga0068857_100029350 3300005577 Bacteria 4853
78 Ga0068857_100069422 3300005577 Bacteria 3138
79 Ga0068854_100107239 3300005578 Bacteria 2102
80 Ga0068852_100000029 3300005616 Bacteria 105168
81 Ga0068852_100065174 3300005616 Bacteria 3177
82 Ga0068852_100098610 3300005616 Bacteria 2632
83 Ga0068852_100115605 3300005616 Unclassified 2446
84 Ga0068859_100009449 3300005617 Bacteria 9847
85 Ga0068859_100011237 3300005617 Bacteria 9006
86 Ga0068864_100000508 3300005618 Bacteria 33518
87 Ga0068851_10031800 3300005834 Bacteria 2623
88 Ga0068863_100004264 3300005841 Bacteria 14102
89 Ga0068858_100003059 3300005842 Bacteria 16764
90 Ga0068858_100007399 3300005842 Bacteria 10621
91 Ga0068860_100002923 3300005843 Bacteria 17679
92 Ga0068860_100029800 3300005843 Bacteria 5250
93 Ga0068862_100188068 3300005844 Bacteria 1857
94 Ga0075368_10034903 3300006042 Bacteria 1961
95 Ga0075368_10049595 3300006042 Bacteria 1666
96 Ga0070716_100008307 3300006173 Bacteria 5150
97 Ga0075362_10003212 3300006177 Bacteria 5665
98 Ga0075367_10095764 3300006178 Bacteria 1810
99 Ga0075366_10000953 3300006195 Bacteria 14096
100 Ga0075366_10006014 3300006195 Bacteria 6612
101 Ga0075366_10006123 3300006195 Bacteria 6559
102 Ga0075366_10006670 3300006195 Bacteria 6336
103 Ga0075366_10010043 3300006195 Bacteria 5305
104 Ga0075366_10013544 3300006195 Bacteria 4647
105 Ga0075366_10080707 3300006195 Bacteria 1943
106 Ga0097621_100024443 3300006237 Bacteria 4718
107 Ga0097621_100084865 3300006237 Bacteria 2641
108 Ga0075370_10002530 3300006353 Bacteria 8492
109 Ga0075370_10006406 3300006353 Bacteria 5917
110 Ga0075370_10014495 3300006353 Bacteria 4206
111 Ga0075370_10020690 3300006353 Bacteria 3599
112 Ga0075370_10047533 3300006353 Bacteria 2430
113 Ga0068871_100002115 3300006358 Bacteria 13446
114 Ga0068871_100009407 3300006358 Bacteria 7080
115 Ga0097620_100009449 3300006931 Bacteria 9847
116 Ga0097620_100011237 3300006931 Bacteria 9006
117 Ga0099823_1000486 3300006944 Bacteria 26577
118 Ga0079104_1000009 3300006946 Bacteria 367015
119 Ga0079104_1000026 3300006946 Bacteria 216566
120 Ga0099826_10000005 3300006948 Bacteria 465206
121 Ga0105244_10014545 3300009036 Bacteria 4545
122 Ga0105250_10011713 3300009092 Bacteria 3634
123 Ga0105240_10000065 3300009093 Bacteria 213992
124 Ga0105240_10001689 3300009093 Bacteria 37381
125 Ga0105240_10002980 3300009093 Bacteria 26646
126 Ga0105240_10019655 3300009093 Bacteria 9021
127 Ga0105245_10031127 3300009098 Unclassified 4720
128 Ga0105247_10010043 3300009101 Bacteria 5732
129 Ga0105243_10028774 3300009148 Bacteria 4268
130 Ga0105243_10065810 3300009148 Bacteria 2913
131 Ga0105243_10095312 3300009148 Bacteria 2459
132 Ga0105241_10000041 3300009174 Bacteria 107393
133 Ga0105241_10015877 3300009174 Bacteria 5516
134 Ga0105242_10002719 3300009176 Bacteria 13857
135 Ga0105242_10004451 3300009176 Bacteria 10893
136 Ga0105248_10001095 3300009177 Bacteria 29976
137 Ga0105248_10007574 3300009177 Bacteria 11925
138 Ga0105248_10007741 3300009177 Bacteria 11797
139 Ga0105248_10017921 3300009177 Bacteria 7814
140 Ga0105248_10053312 3300009177 Bacteria 4538
141 Ga0105237_10038549 3300009545 Bacteria 4826
142 Ga0105237_10101519 3300009545 Bacteria 2869
143 Ga0105238_10000801 3300009551 Bacteria 32620
144 Ga0105238_10001399 3300009551 Bacteria 24200
145 Ga0105238_10022854 3300009551 Bacteria 6374
146 Ga0105238_10067384 3300009551 Bacteria 3581
147 Ga0105239_10003395 3300010375 Bacteria 19535
148 Ga0105239_10017636 3300010375 Bacteria 7896
149 Ga0105239_10094985 3300010375 Bacteria 3294
150 Ga0157370_10000009 3300013104 Bacteria 231270
151 Ga0157370_10004596 3300013104 Bacteria 15797
152 Ga0157369_10000022 3300013105 Bacteria 233081
153 Ga0157369_10005047 3300013105 Bacteria 15454
154 Ga0157369_10050421 3300013105 Bacteria 4508
155 Ga0157369_10056323 3300013105 Bacteria 4242
156 Ga0157374_10001997 3300013296 Bacteria 17129
157 Ga0157374_10007172 3300013296 Bacteria 9495
158 Ga0157374_10026227 3300013296 Bacteria 5243
159 Ga0157374_10059589 3300013296 Bacteria 3570
160 Ga0157374_10081211 3300013296 Bacteria 3076
161 Ga0157374_10086228 3300013296 Bacteria 2987
162 Ga0157378_10002642 3300013297 Bacteria 15975
163 Ga0157378_10021006 3300013297 Bacteria 5744
164 Ga0157378_10041080 3300013297 Bacteria 4102
165 Ga0157372_10000040 3300013307 Bacteria 163677
166 Ga0157372_10033363 3300013307 Bacteria 5654
167 Ga0157372_10109399 3300013307 Bacteria 3165
168 Ga0163163_10004179 3300014325 Bacteria 12301
169 Ga0163163_10004762 3300014325 Bacteria 11640
170 Ga0163163_10045881 3300014325 Bacteria 4291
171 Ga0163163_10198094 3300014325 Bacteria 2057
172 Ga0182008_10010462 3300014497 Bacteria 4963
173 Ga0157377_10000010 3300014745 Bacteria 380929
174 Ga0157379_10002001 3300014968 Bacteria 16874
175 Ga0157379_10017963 3300014968 Bacteria 6233
176 Ga0157379_10023321 3300014968 Bacteria 5491
177 Ga0183363_1015 3300015690 Bacteria 74376
178 Ga0163161_10013846 3300017792 Bacteria 5618
179 Ga0213876_10012608 3300021384 Bacteria 4497
180 Ga0207425_1000297 3300025245 Bacteria 36240
181 Ga0209129_1004819 3300025258 Bacteria 5084
182 Ga0209565_1000003 3300025263 Bacteria 1099648
183 Ga0209673_1000003 3300025273 Bacteria 980859
184 Ga0209673_1002870 3300025273 Bacteria 10968
185 Ga0209130_1000046 3300025284 Bacteria 236658
186 Ga0209675_1000003 3300025291 Bacteria 1003982
187 Ga0209675_1001875 3300025291 Bacteria 11364
188 Ga0209676_1000383 3300025292 Bacteria 81259
189 Ga0209025_1000104 3300025294 Bacteria 226895
190 Ga0209025_1009487 3300025294 Bacteria 6767
191 Ga0209025_1019246 3300025294 Bacteria 3807
192 Ga0209564_1000007 3300025295 Bacteria 1028582
193 Ga0209564_1000012 3300025295 Bacteria 792078
194 Ga0209758_1000470 3300025297 Bacteria 66488
195 Ga0209050_1000457 3300025298 Bacteria 73281
196 Ga0209050_1000952 3300025298 Bacteria 37637
197 Ga0209050_1002564 3300025298 Bacteria 15154
198 Ga0209050_1003116 3300025298 Bacteria 12700
199 Ga0209050_1007715 3300025298 Bacteria 5943
200 Ga0209256_1000019 3300025299 Bacteria 558627
201 Ga0209256_1000040 3300025299 Bacteria 366839
202 Ga0209256_1000112 3300025299 Bacteria 178432
203 Ga0209256_1001512 3300025299 Bacteria 23519
204 Ga0209051_1000004 3300025303 Bacteria 1155596
205 Ga0209051_1000024 3300025303 Bacteria 437007
206 Ga0209051_1000259 3300025303 Bacteria 88311
207 Ga0209051_1001071 3300025303 Bacteria 25392
208 Ga0209257_1000032 3300025304 Bacteria 680354
209 Ga0209257_1000038 3300025304 Bacteria 609032
210 Ga0209257_1000044 3300025304 Bacteria 486709
211 Ga0209257_1000079 3300025304 Bacteria 316420
212 Ga0209257_1000116 3300025304 Bacteria 228733
213 Ga0209257_1001479 3300025304 Bacteria 27607
214 Ga0209257_1012510 3300025304 Bacteria 3908
215 Ga0207656_10041693 3300025321 Unclassified 1951
216 Ga0207696_1018588 3300025711 Bacteria 2278
217 Ga0207682_10014949 3300025893 Bacteria 3023
218 Ga0207680_10003657 3300025903 Bacteria 7226
219 Ga0207645_10050339 3300025907 Bacteria 2660
220 Ga0207705_10092283 3300025909 Bacteria 2218
221 Ga0207654_10000071 3300025911 Bacteria 66350
222 Ga0207695_10000052 3300025913 Bacteria 398089
223 Ga0207695_10000108 3300025913 Bacteria 252306
224 Ga0207695_10000871 3300025913 Bacteria 54947
225 Ga0207695_10001287 3300025913 Bacteria 42580
226 Ga0207695_10007296 3300025913 Bacteria 14115
227 Ga0207695_10034453 3300025913 Bacteria 5506
228 Ga0207671_10041368 3300025914 Bacteria 3411
229 Ga0207649_10002578 3300025920 Bacteria 10084
230 Ga0207649_10032172 3300025920 Bacteria 3124
231 Ga0207649_10114977 3300025920 Bacteria 1804
232 Ga0207681_10000007 3300025923 Bacteria 483669
233 Ga0207681_10003171 3300025923 Bacteria 10324
234 Ga0207694_10000325 3300025924 Bacteria 44875
235 Ga0207694_10001907 3300025924 Bacteria 17284
236 Ga0207694_10029904 3300025924 Bacteria 4159
237 Ga0207650_10030324 3300025925 Bacteria 3894
238 Ga0207650_10035438 3300025925 Bacteria 3624
239 Ga0207659_10003304 3300025926 Bacteria 9661
240 Ga0207687_10005795 3300025927 Bacteria 8174
241 Ga0207687_10014384 3300025927 Bacteria 5177
242 Ga0207644_10003061 3300025931 Bacteria 10764
243 Ga0207644_10017370 3300025931 Bacteria 4857
244 Ga0207644_10021046 3300025931 Bacteria 4440
245 Ga0207690_10019544 3300025932 Bacteria 4174
246 Ga0207706_10018657 3300025933 Bacteria 6242
247 Ga0207686_10013295 3300025934 Bacteria 4552
248 Ga0207709_10000079 3300025935 Bacteria 166220
249 Ga0207709_10003711 3300025935 Bacteria 8997
250 Ga0207670_10019961 3300025936 Bacteria 4106
251 Ga0207669_10023996 3300025937 Bacteria 3270
252 Ga0207704_10039101 3300025938 Bacteria 2758
253 Ga0207665_10023938 3300025939 Bacteria 4023
254 Ga0207665_10071907 3300025939 Bacteria 2362
255 Ga0207691_10023893 3300025940 Bacteria 5752
256 Ga0207691_10106302 3300025940 Bacteria 2500
257 Ga0207711_10005291 3300025941 Bacteria 10937
258 Ga0207711_10005714 3300025941 Bacteria 10495
259 Ga0207711_10009838 3300025941 Bacteria 7951
260 Ga0207711_10086363 3300025941 Bacteria 2750
261 Ga0207689_10000130 3300025942 Bacteria 63848
262 Ga0207661_10025351 3300025944 Bacteria 4505
263 Ga0207661_10068305 3300025944 Bacteria 2894
264 Ga0207679_10003600 3300025945 Bacteria 9610
265 Ga0207679_10015513 3300025945 Bacteria 5037
266 Ga0207679_10037210 3300025945 Bacteria 3458
267 Ga0207667_10006870 3300025949 Bacteria 13747
268 Ga0207667_10110980 3300025949 Bacteria 2829
269 Ga0207658_10002873 3300025986 Bacteria 12339
270 Ga0207677_10002815 3300026023 Bacteria 9177
271 Ga0207677_10009409 3300026023 Bacteria 5501
272 Ga0207703_10012835 3300026035 Bacteria 6533
273 Ga0207639_10000180 3300026041 Bacteria 49455
274 Ga0207639_10078531 3300026041 Unclassified 2605
275 Ga0207678_10012387 3300026067 Bacteria 7485
276 Ga0207702_10013479 3300026078 Bacteria 6792
277 Ga0207702_10065861 3300026078 Bacteria 3103
278 Ga0207702_10251827 3300026078 Bacteria 1659
279 Ga0207641_10002565 3300026088 Bacteria 16707
280 Ga0207648_10000002 3300026089 Bacteria 307909
281 Ga0207676_10004582 3300026095 Bacteria 9791
282 Ga0207674_10000910 3300026116 Bacteria 38534
283 Ga0207674_10153284 3300026116 Bacteria 2260
284 Ga0207683_10056178 3300026121 Bacteria 3452
285 Ga0207683_10085729 3300026121 Bacteria 2800
286 Ga0207698_10000007 3300026142 Bacteria 289457
287 Ga0207698_10016734 3300026142 Bacteria 4954
288 Ga0207698_10021579 3300026142 Bacteria 4458
289 Ga0207698_10034846 3300026142 Bacteria 3675
290 Ga0207698_10066809 3300026142 Bacteria 2832
291 Ga0209281_1000023 3300027111 Bacteria 519955
292 Ga0209281_1000067 3300027111 Bacteria 284517
293 Ga0209389_1019082 3300027296 Bacteria 6150
294 Ga0209970_1000371 3300027614 Bacteria 7551
295 Ga0209282_1000003 3300027666 Bacteria 856377
296 Ga0209813_10005387 3300027866 Bacteria 3102
297 Ga0209974_10003224 3300027876 Bacteria 5898
298 Ga0209974_10007078 3300027876 Bacteria 3876
299 Ga0268265_10243245 3300028380 Bacteria 1589
300 Ga0268264_10003544 3300028381 Bacteria 13439
301 Ga0265319_1024086 3300028563 Bacteria 2196
302 Ga0307517_10034295 3300028786 Bacteria 5784
303 Ga0307517_10076967 3300028786 Bacteria 2906
304 Ga0307515_10000013 3300028794 Bacteria 568456
305 Ga0307515_10000123 3300028794 Bacteria 186601
306 Ga0307515_10000821 3300028794 Bacteria 71579
307 Ga0307515_10007649 3300028794 Bacteria 21312
308 Ga0307515_10011224 3300028794 Bacteria 17013
309 Ga0307515_10052885 3300028794 Bacteria 6009
310 Ga0307515_10053868 3300028794 Bacteria 5921
311 Ga0307515_10054206 3300028794 Bacteria 5893
312 Ga0307515_10068407 3300028794 Bacteria 4879
313 Ga0307515_10143864 3300028794 Bacteria 2539
314 Ga0265338_10013956 3300028800 Bacteria 9010
315 Ga0265338_10114529 3300028800 Unclassified 2164
316 Ga0307512_10010148 3300030522 Bacteria 9006
317 Ga0307512_10022819 3300030522 Bacteria 5609
318 Ga0307512_10070486 3300030522 Bacteria 2603
319 Ga0265760_10015107 3300031090 Bacteria 2213
320 Ga0265330_10000828 3300031235 Bacteria 19434
321 Ga0265330_10011853 3300031235 Bacteria 4081
322 Ga0265332_10000006 3300031238 Bacteria 327963
323 Ga0265328_10008184 3300031239 Bacteria 4326
324 Ga0265325_10000664 3300031241 Bacteria 25082
325 Ga0265339_10000089 3300031249 Bacteria 77145
326 Ga0265331_10058357 3300031250 Bacteria 1827
327 Ga0265327_10001820 3300031251 Bacteria 24933
328 Ga0265316_10000668 3300031344 Bacteria 38227
329 Ga0265316_10000687 3300031344 Bacteria 37565
330 Ga0265316_10033744 3300031344 Bacteria 4165
331 Ga0307513_10003902 3300031456 Bacteria 20051
332 Ga0307513_10004611 3300031456 Bacteria 18355
333 Ga0307513_10013254 3300031456 Bacteria 10122
334 Ga0307513_10056384 3300031456 Bacteria 4195
335 Ga0307513_10091445 3300031456 Bacteria 3101
336 Ga0307513_10104709 3300031456 Bacteria 2841
337 Ga0307509_10000293 3300031507 Bacteria 82770
338 Ga0307509_10003313 3300031507 Bacteria 24671
339 Ga0307509_10021372 3300031507 Bacteria 7317
340 Ga0307509_10113167 3300031507 Bacteria 2712
341 Ga0307408_100000046 3300031548 Bacteria 167686
342 Ga0307408_100000298 3300031548 Bacteria 47947
343 Ga0307408_100032935 3300031548 Bacteria 3617
344 Ga0265313_10006038 3300031595 Bacteria 8738
345 Ga0265313_10020751 3300031595 Bacteria 3615
346 Ga0265313_10023895 3300031595 Bacteria 3281
347 Ga0307508_10000134 3300031616 Bacteria 87501
348 Ga0307508_10000524 3300031616 Bacteria 45505
349 Ga0307514_10022006 3300031649 Bacteria 5190
350 Ga0265314_10000081 3300031711 Bacteria 143776
351 Ga0265342_10003868 3300031712 Bacteria 12046
352 Ga0265342_10005184 3300031712 Bacteria 10016
353 Ga0307516_10000672 3300031730 Bacteria 46304
354 Ga0307516_10013080 3300031730 Bacteria 8874
355 Ga0307516_10029199 3300031730 Bacteria 5576
356 Ga0307413_10066872 3300031824 Bacteria 2245
357 Ga0307518_10117944 3300031838 Bacteria 1882
358 Ga0307406_10000234 3300031901 Bacteria 33721
359 Ga0307414_10058803 3300032004 Bacteria 2710
360 Ga0307411_10040292 3300032005 Bacteria 2962
361 Ga0307510_10000207 3300033180 Bacteria 51708
362 Ga0307510_10005691 3300033180 Bacteria 14850
363 Ga0307510_10054384 3300033180 Bacteria 4193
364 Ga0307510_10065288 3300033180 Bacteria 3688
365 Ga0373939_0000004 3300035114 Bacteria 106519
366 Ga0373960_0001935 3300035121 Bacteria 4644
367 Ga0395899_0021331 3300037312 Bacteria 4913
368 Ga0395905_0000117 3300037471 Bacteria 133291
369 Ga0395905_0001029 3300037471 Bacteria 35545
370 Ga0395905_0014246 3300037471 Bacteria 7596
371 Ga0395905_0058968 3300037471 Bacteria 3589
372 Ga0395901_0116165 3300038443 Bacteria 2811
373 Ga0436365_0860276 3300039437 Bacteria 4987
374 Ga0439461_0001755 3300041410 Bacteria 3390
375 Ga0439462_0000640 3300042015 Bacteria 7031
376 Ga0450888_000211 3300042126 Bacteria 5225
377 Ga0450891_000495 3300042129 Bacteria 4115
378 Ga0450903_004917 3300042138 Bacteria 2253
379 Ga0450889_000406 3300042144 Bacteria 4808
380 Ga0450918_000112 3300042531 Bacteria 17468
381 Ga0450893_0004099 3300042532 Bacteria 2317
382 Ga0451577_0002719 3300042876 Bacteria 20577
383 Ga0451577_0012040 3300042876 Bacteria 8138
384 Ga0451577_0023261 3300042876 Bacteria 5652
385 Ga0451577_0085649 3300042876 Bacteria 2812
386 Ga0466969_0019479 3300044656 Bacteria 3526
387 Ga0466969_0067618 3300044656 Bacteria 1724
388 Ga0453683_0058409 3300044673 Bacteria 2413
389 Ga0466965_0011906 3300044683 Bacteria 4083
390 Ga0466965_0067857 3300044683 Bacteria 1790
391 Ga0466966_0073230 3300044684 Bacteria 2143
392 Ga0466961_0010615 3300044693 Bacteria 5878
393 Ga0466963_0005063 3300044694 Bacteria 7701
394 Ga0453684_0017908 3300044712 Bacteria 10930
395 Ga0453684_0115348 3300044712 Bacteria 3255
396 Ga0453684_0194796 3300044712 Bacteria 2368
397 Ga0453684_0272682 3300044712 Bacteria 1932
398 Ga0466970_0093423 3300044765 Bacteria 1634
399 Ga0466960_0021626 3300044901 Bacteria 2867
400 Ga0451576_0004176 3300045051 Bacteria 19014
401 Ga0451576_0006080 3300045051 Bacteria 14882
402 Ga0451576_0069102 3300045051 Bacteria 3675
403 Ga0451576_0132700 3300045051 Bacteria 2596
404 Ga0466967_0000280 3300045976 Bacteria 22598
405 Ga0495617_000033 3300046452 Bacteria 147979
406 Ga0495627_011912 3300046453 Bacteria 3101
407 Ga0495592_0000555 3300046454 Bacteria 26626
408 Ga0495590_0000005 3300046457 Bacteria 384276
409 Ga0495638_0000436 3300046460 Bacteria 50390
410 Ga0495638_0006325 3300046460 Bacteria 8631
411 Ga0495638_0046824 3300046460 Bacteria 2715
412 Ga0495650_0000115 3300046471 Bacteria 190869
413 Ga0495650_0000648 3300046471 Bacteria 45807
414 Ga0495650_0000909 3300046471 Bacteria 34900
415 Ga0495650_0001166 3300046471 Bacteria 28063
416 Ga0495650_0001915 3300046471 Bacteria 18439
417 Ga0495580_0126585 3300046472 Bacteria 1773
418 Ga0495639_0072794 3300046475 Bacteria 1590
419 Ga0495607_0008173 3300046501 Bacteria 7172
420 Ga0495583_0000709 3300046506 Bacteria 42771
421 Ga0495606_0000053 3300046507 Bacteria 200818
422 Ga0495606_0007009 3300046507 Bacteria 10229
423 Ga0495606_0016008 3300046507 Bacteria 5743
424 Ga0495606_0025808 3300046507 Bacteria 4199
425 Ga0495606_0039977 3300046507 Bacteria 3155
426 Ga0495610_0000181 3300046512 Bacteria 70215
427 Ga0495610_0003889 3300046512 Bacteria 11333
428 Ga0495610_0012165 3300046512 Bacteria 5200
429 Ga0495610_0014665 3300046512 Bacteria 4594
430 Ga0495610_0047952 3300046512 Bacteria 2099
431 Ga0495616_0028134 3300046513 Bacteria 2977
432 Ga0495631_0000408 3300046518 Bacteria 29643
433 Ga0495632_0017181 3300046519 Bacteria 4001
434 Ga0495637_0000207 3300046520 Bacteria 46156
435 Ga0495643_0000195 3300046522 Bacteria 96110
436 Ga0495643_0000516 3300046522 Bacteria 48137
437 Ga0495648_0000002 3300046524 Bacteria 593972
438 Ga0495642_0005491 3300046528 Bacteria 4868
439 Ga0495654_0000002 3300046530 Bacteria 1021205
440 Ga0495609_0001952 3300046538 Bacteria 13103
441 Ga0495609_0009864 3300046538 Bacteria 4604
442 Ga0495609_0012100 3300046538 Bacteria 4096
443 Ga0495621_0001025 3300046539 Bacteria 7160
444 Ga0495597_0000322 3300046542 Bacteria 43315
445 Ga0495597_0000936 3300046542 Bacteria 22526
446 Ga0495622_0000810 3300046557 Bacteria 17296
447 Ga0495622_0071767 3300046557 Bacteria 1598
448 Ga0495633_0000382 3300046558 Bacteria 46834
449 Ga0495633_0006458 3300046558 Bacteria 6943
450 Ga0495633_0011051 3300046558 Bacteria 4898
451 Ga0495633_0020109 3300046558 Bacteria 3363
452 Ga0495668_0000006 3300046616 Bacteria 553404
453 Ga0495668_0000931 3300046616 Bacteria 32633
454 Ga0495668_0001037 3300046616 Bacteria 29441
455 Ga0495668_0004618 3300046616 Bacteria 9680
456 Ga0495668_0005457 3300046616 Bacteria 8612
457 Ga0495625_0000124 3300046660 Bacteria 120849
458 Ga0495625_0001378 3300046660 Bacteria 29876
459 Ga0495625_0002387 3300046660 Bacteria 20399
460 Ga0495625_0006874 3300046660 Bacteria 10045
461 Ga0495625_0007589 3300046660 Bacteria 9417
462 Ga0495625_0013475 3300046660 Bacteria 6568
463 Ga0495625_0019381 3300046660 Bacteria 5279
464 Ga0495661_0070356 3300046665 Bacteria 2048
465 Ga0495658_0008123 3300046683 Bacteria 5197
466 Ga0495658_0027845 3300046683 Bacteria 3045
467 Ga0495658_0055156 3300046683 Bacteria 2263
468 Ga0495669_0009656 3300046684 Bacteria 4071
469 Ga0495649_0005207 3300046694 Bacteria 8327
470 Ga0495649_0012321 3300046694 Bacteria 4983
471 Ga0495660_0012961 3300046810 Bacteria 4833
472 Ga0495660_0028502 3300046810 Bacteria 3155
473 Ga0495660_0073756 3300046810 Bacteria 1804
474 Ga0495672_0000398 3300047320 Bacteria 52924
475 Ga0495687_000719 3300047443 Bacteria 36657
476 Ga0495687_001182 3300047443 Bacteria 25172
477 Ga0495687_006047 3300047443 Bacteria 7538
478 Ga0495687_032737 3300047443 Bacteria 2368
479 Ga0495677_0002811 3300047445 Bacteria 6790
480 Ga0495673_0000005 3300047469 Bacteria 943364
481 Ga0495681_0017829 3300047470 Bacteria 3931
482 Ga0495686_0001694 3300047472 Bacteria 22811
483 Ga0495686_0011656 3300047472 Bacteria 6189
484 Ga0495686_0024618 3300047472 Bacteria 3953
485 Ga0495686_0036736 3300047472 Bacteria 3143
486 Ga0495686_0040601 3300047472 Bacteria 2967
487 Ga0495593_0003185 3300047673 Bacteria 9855
488 Ga0495614_0003925 3300048089 Bacteria 6678
489 Ga0496100_0070902 3300048903 Bacteria 2325
490 Ga0496101_0063906 3300048904 Bacteria 2680
491 Ga0496102_0029736 3300048905 Bacteria 4889
492 Ga0496108_0066961 3300048911 Bacteria 3029
493 Ga0496109_0033424 3300048912 Bacteria 4627
494 Ga0496109_0038751 3300048912 Bacteria 4311
495 Ga0496110_0016350 3300048913 Bacteria 6195
496 Ga0496110_0045911 3300048913 Bacteria 3820
497 Ga0496110_0089314 3300048913 Bacteria 2754
498 Ga0496114_0012042 3300048917 Bacteria 6920
499 Ga0496114_0197243 3300048917 Bacteria 1762
500 Ga0496115_0015447 3300048918 Bacteria 5791
501 Ga0496116_0023363 3300048919 Bacteria 4606
502 Ga0496117_0019331 3300048920 Bacteria 5601
503 Ga0496121_0066366 3300048924 Bacteria 2930
504 Ga0496123_0016544 3300048926 Bacteria 5980
505 Ga0496123_0016684 3300048926 Bacteria 5947
506 Ga0496123_0057100 3300048926 Bacteria 2544
507 Ga0496124_0070178 3300048927 Bacteria 2907
508 Ga0496124_0093200 3300048927 Bacteria 2452
509 Ga0496125_0020270 3300048928 Bacteria 6243
510 Ga0496126_0000286 3300048929 Bacteria 106913
511 Ga0496126_0038132 3300048929 Bacteria 4473
512 Ga0496126_0082898 3300048929 Bacteria 2831
513 Ga0501310_000422 3300049130 Bacteria 3732
514 Ga0495678_000291 3300049459 Bacteria 55271
515 Ga0495678_011834 3300049459 Bacteria 4160
516 Ga0495678_012811 3300049459 Bacteria 3960
517 Ga0501033_0096855 3300049570 Bacteria 2156
518 Ga0501039_0001422 3300049575 Bacteria 17622
519 Ga0501042_0025892 3300049578 Bacteria 4123
520 Ga0501076_0003274 3300049592 Bacteria 11341
521 Ga0501211_000098 3300049658 Bacteria 6418
522 Ga0501222_006910 3300049662 Bacteria 1519
523 Ga0501223_006978 3300049663 Bacteria 2320
524 Ga0501221_001202 3300049704 Bacteria 4286
525 Ga0501079_0015539 3300049741 Bacteria 5811
526 Ga0501080_0005820 3300049742 Bacteria 11037
527 Ga0501081_0000516 3300049743 Bacteria 21719
528 Ga0501083_0092830 3300049744 Bacteria 1993
529 Ga0501266_000571 3300049763 Bacteria 4884
530 Ga0501267_000375 3300049764 Bacteria 3395
531 Ga0501272_003063 3300049769 Bacteria 1681
532 Ga0501045_0011790 3300049824 Bacteria 6141
533 nmdc:mga03n38_17291_c1 3300050490 Bacteria 2821
534 nmdc:mga00v17_78600_c1 3300050491 Bacteria 2056
535 nmdc:mga0k408_19148_c1 3300050493 Bacteria 3823
536 nmdc:mga0k408_206_c1 3300050493 Bacteria 31456
537 nmdc:mga0k408_2372_c1 3300050493 Bacteria 8674
538 nmdc:mga0k408_31974_c1 3300050493 Bacteria 3007
539 nmdc:mga0k408_67551_c1 3300050493 Bacteria 2083
540 nmdc:mga0k408_7060_c1 3300050493 Bacteria 5999
541 nmdc:mga0k408_8217_c1 3300050493 Bacteria 5594
542 nmdc:mga0k408_866_c1 3300050493 Bacteria 16663
543 nmdc:mga0k408_98135_c1 3300050493 Bacteria 1726
544 nmdc:mga04h51_8087_c1 3300050495 Bacteria 2804
545 nmdc:mga07m45_1680_c1 3300050496 Bacteria 10182
546 nmdc:mga07m45_3456_c1 3300050496 Bacteria 7619
547 nmdc:mga07m45_52257_c1 3300050496 Bacteria 2306
548 nmdc:mga07m45_63535_c1 3300050496 Bacteria 2094
549 nmdc:mga08x19_34902_c1 3300050514 Bacteria 3181
550 Ga0500610_0000519 3300053079 Bacteria 11857
551 Ga0500610_0000524 3300053079 Bacteria 11812
552 Ga0500651_0000002 3300053093 Bacteria 476609
553 Ga0500651_0000015 3300053093 Bacteria 161416
554 Ga0500651_0005156 3300053093 Bacteria 7435
555 Ga0500571_000017 3300053110 Bacteria 64361
556 Ga0500593_000637 3300053117 Bacteria 13500
557 Ga0500593_000662 3300053117 Bacteria 13129
558 Ga0500594_0001863 3300053118 Bacteria 4571
559 Ga0500595_000044 3300053119 Bacteria 91895
560 Ga0500607_000025 3300053121 Bacteria 95473
561 Ga0500607_005461 3300053121 Bacteria 8314
562 Ga0500618_000258 3300053125 Bacteria 41850
563 Ga0500655_000069 3300053133 Bacteria 27666
564 Ga0500658_0000054 3300053134 Bacteria 60941
565 Ga0500658_0000248 3300053134 Bacteria 25326
566 Ga0500658_0017066 3300053134 Bacteria 2709
567 Ga0500658_0029041 3300053134 Bacteria 2149
568 Ga0500559_0000049 3300053136 Bacteria 93378
569 Ga0500559_0000670 3300053136 Bacteria 22910
570 Ga0500559_0009307 3300053136 Bacteria 4258
571 Ga0500564_012408 3300053138 Bacteria 3786
572 Ga0500568_0001431 3300053139 Bacteria 15473
573 Ga0500568_0007211 3300053139 Bacteria 5478
574 Ga0500586_000361 3300053145 Bacteria 9043
575 Ga0500616_0013029 3300053153 Bacteria 4843
576 Ga0500622_0003710 3300053156 Bacteria 10014
577 Ga0500627_0000836 3300053158 Bacteria 8244
578 Ga0500634_0000599 3300053161 Bacteria 12040
579 Ga0500636_0013941 3300053177 Bacteria 4725
580 Ga0500625_022389 3300053729 Bacteria 2985

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10007574 Ga0105248_100075745 363
2 3300048903 Ga0496100_0070902 Ga0496100_0070902_53_1219 363
3 3300003771 Ga0055526_1000019 Ga0055526_1000019159 413
4 3300025295 Ga0209564_1000007 Ga0209564_100000768 413
5 3300031730 Ga0307516_10000672 Ga0307516_1000067235 415
6 3300046471 Ga0495650_0000648 Ga0495650_0000648_41985_43418 420
7 3300046616 Ga0495668_0004618 Ga0495668_0004618_5854_7287 420
8 3300048927 Ga0496124_0070178 Ga0496124_0070178_230_1663 420
9 3300049662 Ga0501222_006910 Ga0501222_006910_42_1322 420
10 3300049769 Ga0501272_003063 Ga0501272_003063_363_1643 420
11 3300053134 Ga0500658_0029041 Ga0500658_0029041_664_2127 420
12 3300048917 Ga0496114_0197243 Ga0496114_0197243_18_1406 421
13 3300049570 Ga0501033_0096855 Ga0501033_0096855_634_1980 423
14 3300049575 Ga0501039_0001422 Ga0501039_0001422_7474_8820 423
15 3300049578 Ga0501042_0025892 Ga0501042_0025892_971_2317 423
16 3300049592 Ga0501076_0003274 Ga0501076_0003274_1625_2971 423
17 3300049741 Ga0501079_0015539 Ga0501079_0015539_3714_5060 423
18 3300049742 Ga0501080_0005820 Ga0501080_0005820_7200_8546 423
19 3300049743 Ga0501081_0000516 Ga0501081_0000516_16832_18178 423
20 3300049744 Ga0501083_0092830 Ga0501083_0092830_91_1437 423
21 3300049824 Ga0501045_0011790 Ga0501045_0011790_2419_3765 423
22 3300005353 Ga0070669_100003404 Ga0070669_1000034047 426
23 3300025923 Ga0207681_10003171 Ga0207681_100031719 426
24 3300003320 rootH2_10236065 rootH2_102360652 427
25 3300009093 Ga0105240_10000065 Ga0105240_100000652 427
26 3300009093 Ga0105240_10002980 Ga0105240_100029807 427
27 3300009093 Ga0105240_10019655 Ga0105240_100196557 427
28 3300009098 Ga0105245_10031127 Ga0105245_100311272 427
29 3300009101 Ga0105247_10010043 Ga0105247_100100433 427
30 3300009174 Ga0105241_10000041 Ga0105241_1000004186 427
31 3300009174 Ga0105241_10015877 Ga0105241_100158772 427
32 3300009177 Ga0105248_10001095 Ga0105248_1000109519 427
33 3300009545 Ga0105237_10038549 Ga0105237_100385492 427
34 3300009545 Ga0105237_10101519 Ga0105237_101015193 427
35 3300009551 Ga0105238_10000801 Ga0105238_1000080124 427
36 3300009551 Ga0105238_10001399 Ga0105238_1000139918 427
37 3300010375 Ga0105239_10003395 Ga0105239_1000339512 427
38 3300013104 Ga0157370_10000009 Ga0157370_10000009178 427
39 3300013105 Ga0157369_10000022 Ga0157369_1000002219 427
40 3300013105 Ga0157369_10050421 Ga0157369_100504212 427
41 3300013296 Ga0157374_10001997 Ga0157374_100019974 427
42 3300013296 Ga0157374_10007172 Ga0157374_100071727 427
43 3300013296 Ga0157374_10059589 Ga0157374_100595894 427
44 3300013297 Ga0157378_10002642 Ga0157378_100026425 427
45 3300013297 Ga0157378_10021006 Ga0157378_100210062 427
46 3300013307 Ga0157372_10000040 Ga0157372_10000040123 427
47 3300013307 Ga0157372_10109399 Ga0157372_101093993 427
48 3300014325 Ga0163163_10004762 Ga0163163_1000476210 427
49 3300014968 Ga0157379_10002001 Ga0157379_1000200113 427
50 3300030522 Ga0307512_10010148 Ga0307512_100101483 427
51 3300031507 Ga0307509_10000293 Ga0307509_1000029346 427
52 3300031649 Ga0307514_10022006 Ga0307514_100220063 427
53 3300033180 Ga0307510_10005691 Ga0307510_100056917 427
54 3300044694 Ga0466963_0005063 Ga0466963_0005063_6148_7524 427
55 3300045976 Ga0466967_0000280 Ga0466967_0000280_18285_19661 427
56 3300046454 Ga0495592_0000555 Ga0495592_0000555_15367_16839 427
57 3300046683 Ga0495658_0008123 Ga0495658_0008123_3363_4913 427
58 3300050514 nmdc:mga08x19_34902_c1 nmdc:mga08x19_34902_c1_143_1468 427
59 3300006195 Ga0075366_10006123 Ga0075366_100061233 429
60 3300006353 Ga0075370_10006406 Ga0075370_100064062 429
61 3300050493 nmdc:mga0k408_7060_c1 nmdc:mga0k408_7060_c1_926_2491 429
62 3300050496 nmdc:mga07m45_1680_c1 nmdc:mga07m45_1680_c1_7622_9187 429
63 3300005353 Ga0070669_100000003 Ga0070669_100000003201 430
64 3300013296 Ga0157374_10026227 Ga0157374_100262272 430
65 3300025923 Ga0207681_10000007 Ga0207681_10000007149 430
66 3300031090 Ga0265760_10015107 Ga0265760_100151072 430
67 3300046472 Ga0495580_0126585 Ga0495580_0126585_38_1423 430
68 3300006946 Ga0079104_1000009 Ga0079104_1000009159 432
69 3300027111 Ga0209281_1000023 Ga0209281_1000023228 432
70 3300028794 Ga0307515_10052885 Ga0307515_100528853 432
71 3300031250 Ga0265331_10058357 Ga0265331_100583571 432
72 3300031344 Ga0265316_10033744 Ga0265316_100337442 432
73 3300031507 Ga0307509_10003313 Ga0307509_100033132 432
74 3300031507 Ga0307509_10021372 Ga0307509_100213726 432
75 3300031595 Ga0265313_10020751 Ga0265313_100207512 432
76 3300031616 Ga0307508_10000524 Ga0307508_1000052438 432
77 3300044683 Ga0466965_0067857 Ga0466965_0067857_383_1768 432
78 3300044712 Ga0453684_0194796 Ga0453684_0194796_822_2231 432
79 3300048912 Ga0496109_0033424 Ga0496109_0033424_2703_4109 432
80 3300048913 Ga0496110_0016350 Ga0496110_0016350_2243_3649 432
81 3300005455 Ga0070663_100016762 Ga0070663_1000167622 433
82 3300005616 Ga0068852_100098610 Ga0068852_1000986102 433
83 3300006042 Ga0075368_10034903 Ga0075368_100349032 433
84 3300006177 Ga0075362_10003212 Ga0075362_100032122 433
85 3300006353 Ga0075370_10047533 Ga0075370_100475331 433
86 3300009148 Ga0105243_10065810 Ga0105243_100658102 433
87 3300010375 Ga0105239_10017636 Ga0105239_100176364 433
88 3300025913 Ga0207695_10034453 Ga0207695_100344532 433
89 3300025914 Ga0207671_10041368 Ga0207671_100413682 433
90 3300026067 Ga0207678_10012387 Ga0207678_100123872 433
91 3300026116 Ga0207674_10153284 Ga0207674_101532842 433
92 3300027866 Ga0209813_10005387 Ga0209813_100053872 433
93 3300031456 Ga0307513_10091445 Ga0307513_100914452 433
94 3300046519 Ga0495632_0017181 Ga0495632_0017181_1260_2825 433
95 3300048929 Ga0496126_0082898 Ga0496126_0082898_1031_2455 433
96 3300050490 nmdc:mga03n38_17291_c1 nmdc:mga03n38_17291_c1_295_1860 433
97 3300050491 nmdc:mga00v17_78600_c1 nmdc:mga00v17_78600_c1_347_1912 433
98 3300050493 nmdc:mga0k408_31974_c1 nmdc:mga0k408_31974_c1_650_2215 433
99 3300050495 nmdc:mga04h51_8087_c1 nmdc:mga04h51_8087_c1_1188_2753 433
100 3300053139 Ga0500568_0007211 Ga0500568_0007211_3329_4894 433
101 3300003323 rootH1_10002908 rootH1_1000290817 434
102 3300003794 Ga0055531_10005653 Ga0055531_100056536 434
103 3300005329 Ga0070683_100132244 Ga0070683_1001322442 434
104 3300005539 Ga0068853_100021881 Ga0068853_1000218815 434
105 3300005578 Ga0068854_100107239 Ga0068854_1001072392 434
106 3300005616 Ga0068852_100115605 Ga0068852_1001156053 434
107 3300006195 Ga0075366_10080707 Ga0075366_100807072 434
108 3300006353 Ga0075370_10014495 Ga0075370_100144952 434
109 3300006944 Ga0099823_1000486 Ga0099823_100048611 434
110 3300009551 Ga0105238_10067384 Ga0105238_100673842 434
111 3300013296 Ga0157374_10081211 Ga0157374_100812112 434
112 3300025273 Ga0209673_1002870 Ga0209673_10028705 434
113 3300025299 Ga0209256_1001512 Ga0209256_100151217 434
114 3300025303 Ga0209051_1001071 Ga0209051_10010718 434
115 3300025304 Ga0209257_1001479 Ga0209257_100147916 434
116 3300025321 Ga0207656_10041693 Ga0207656_100416931 434
117 3300025909 Ga0207705_10092283 Ga0207705_100922831 434
118 3300026041 Ga0207639_10078531 Ga0207639_100785312 434
119 3300027296 Ga0209389_1019082 Ga0209389_10190824 434
120 3300027876 Ga0209974_10007078 Ga0209974_100070782 434
121 3300050493 nmdc:mga0k408_98135_c1 nmdc:mga0k408_98135_c1_243_1715 434
122 3300046475 Ga0495639_0072794 Ga0495639_0072794_170_1564 435
123 3300047469 Ga0495673_0000005 Ga0495673_0000005_868449_869846 435
124 3300031507 Ga0307509_10113167 Ga0307509_101131672 436
125 3300003775 Ga0055524_1000231 Ga0055524_100023122 439
126 3300014325 Ga0163163_10045881 Ga0163163_100458814 439
127 3300025298 Ga0209050_1007715 Ga0209050_10077154 439
128 3300025299 Ga0209256_1000019 Ga0209256_1000019215 439
129 3300031456 Ga0307513_10003902 Ga0307513_1000390218 439
130 3300031838 Ga0307518_10117944 Ga0307518_101179442 439
131 3300048917 Ga0496114_0012042 Ga0496114_0012042_3896_5365 439
132 3300005564 Ga0070664_100106188 Ga0070664_1001061881 440
133 3300006195 Ga0075366_10000953 Ga0075366_100009532 440
134 3300025945 Ga0207679_10015513 Ga0207679_100155134 440
135 3300050493 nmdc:mga0k408_2372_c1 nmdc:mga0k408_2372_c1_5948_7450 440
136 3300006173 Ga0070716_100008307 Ga0070716_1000083073 441
137 3300025939 Ga0207665_10023938 Ga0207665_100239381 441
138 3300003316 rootH1_10034163 rootH1_100341632 442
139 3300006195 Ga0075366_10006670 Ga0075366_100066702 442
140 3300025939 Ga0207665_10071907 Ga0207665_100719072 442
141 3300046660 Ga0495625_0013475 Ga0495625_0013475_2315_3883 442
142 3300046694 Ga0495649_0005207 Ga0495649_0005207_3361_4926 442
143 3300047443 Ga0495687_000719 Ga0495687_000719_31579_33144 442
144 3300050493 nmdc:mga0k408_8217_c1 nmdc:mga0k408_8217_c1_295_1860 442
145 3300014968 Ga0157379_10023321 Ga0157379_100233213 443
146 3300006195 Ga0075366_10013544 Ga0075366_100135442 444
147 3300028786 Ga0307517_10034295 Ga0307517_100342952 444
148 3300046460 Ga0495638_0006325 Ga0495638_0006325_2238_3713 444
149 3300046460 Ga0495638_0046824 Ga0495638_0046824_778_2208 444
150 3300050493 nmdc:mga0k408_866_c1 nmdc:mga0k408_866_c1_13502_14938 444
151 iso_pu_bacteria 2857558681 2857560118 444
152 iso_pu_bacteria 2857564685 2857566695 444
153 3300002987 JGI25159J45721_1002918 JGI25159J45721_10029184 445
154 3300003771 Ga0055526_1000283 Ga0055526_100028322 445
155 3300003773 Ga0055537_1000063 Ga0055537_100006328 445
156 3300003784 Ga0055534_1000208 Ga0055534_10002089 445
157 3300003790 Ga0055528_1000013 Ga0055528_1000013121 445
158 3300005262 Ga0065165_1000005 Ga0065165_100000556 445
159 3300005262 Ga0065165_1022534 Ga0065165_10225342 445
160 3300025263 Ga0209565_1000003 Ga0209565_1000003524 445
161 3300025273 Ga0209673_1000003 Ga0209673_1000003410 445
162 3300025284 Ga0209130_1000046 Ga0209130_100004696 445
163 3300025291 Ga0209675_1000003 Ga0209675_1000003514 445
164 3300025295 Ga0209564_1000012 Ga0209564_1000012322 445
165 3300025299 Ga0209256_1000112 Ga0209256_100011265 445
166 3300028794 Ga0307515_10000821 Ga0307515_1000082127 445
167 3300028800 Ga0265338_10013956 Ga0265338_100139563 445
168 3300031235 Ga0265330_10011853 Ga0265330_100118532 445
169 3300031239 Ga0265328_10008184 Ga0265328_100081843 445
170 3300031595 Ga0265313_10023895 Ga0265313_100238952 445
171 3300031711 Ga0265314_10000081 Ga0265314_100000819 445
172 3300046457 Ga0495590_0000005 Ga0495590_0000005_2645_4072 445
173 3300046501 Ga0495607_0008173 Ga0495607_0008173_3108_4529 445
174 3300046512 Ga0495610_0003889 Ga0495610_0003889_1821_3251 445
175 3300046522 Ga0495643_0000516 Ga0495643_0000516_44225_45652 445
176 3300046538 Ga0495609_0001952 Ga0495609_0001952_9291_10712 445
177 3300046542 Ga0495597_0000936 Ga0495597_0000936_2492_3919 445
178 3300046616 Ga0495668_0000006 Ga0495668_0000006_3211_4635 445
179 3300046616 Ga0495668_0001037 Ga0495668_0001037_2525_3952 445
180 3300046616 Ga0495668_0005457 Ga0495668_0005457_5702_7123 445
181 3300046660 Ga0495625_0007589 Ga0495625_0007589_3646_5067 445
182 3300046684 Ga0495669_0009656 Ga0495669_0009656_685_2106 445
183 3300046810 Ga0495660_0028502 Ga0495660_0028502_1714_3135 445
184 3300047443 Ga0495687_001182 Ga0495687_001182_2429_3862 445
185 3300047443 Ga0495687_032737 Ga0495687_032737_516_1937 445
186 3300047445 Ga0495677_0002811 Ga0495677_0002811_2940_4361 445
187 3300047470 Ga0495681_0017829 Ga0495681_0017829_1815_3236 445
188 3300047472 Ga0495686_0001694 Ga0495686_0001694_18909_20333 445
189 3300049459 Ga0495678_012811 Ga0495678_012811_200_1627 445
190 iso_pu_bacteria 2842711865 2842716519 445
191 3300003320 rootH2_10051907 rootH2_100519074 446
192 3300005329 Ga0070683_100009180 Ga0070683_1000091805 446
193 3300005329 Ga0070683_100080553 Ga0070683_1000805532 446
194 3300005334 Ga0068869_100015798 Ga0068869_1000157982 446
195 3300005338 Ga0068868_100000459 Ga0068868_1000004595 446
196 3300005355 Ga0070671_100010892 Ga0070671_1000108925 446
197 3300005367 Ga0070667_100003020 Ga0070667_1000030202 446
198 3300005435 Ga0070714_100022255 Ga0070714_1000222554 446
199 3300005539 Ga0068853_100193960 Ga0068853_1001939601 446
200 3300005548 Ga0070665_100045053 Ga0070665_1000450532 446
201 3300005563 Ga0068855_100002944 Ga0068855_10000294411 446
202 3300005563 Ga0068855_100003346 Ga0068855_10000334617 446
203 3300005563 Ga0068855_100017040 Ga0068855_1000170402 446
204 3300005577 Ga0068857_100029350 Ga0068857_1000293502 446
205 3300005616 Ga0068852_100000029 Ga0068852_10000002984 446
206 3300005617 Ga0068859_100009449 Ga0068859_1000094492 446
207 3300005841 Ga0068863_100004264 Ga0068863_1000042644 446
208 3300005842 Ga0068858_100003059 Ga0068858_1000030595 446
209 3300005843 Ga0068860_100002923 Ga0068860_10000292314 446
210 3300006358 Ga0068871_100002115 Ga0068871_10000211510 446
211 3300006931 Ga0097620_100009449 Ga0097620_1000094492 446
212 3300009093 Ga0105240_10001689 Ga0105240_100016893 446
213 3300009177 Ga0105248_10007741 Ga0105248_100077413 446
214 3300009551 Ga0105238_10022854 Ga0105238_100228542 446
215 3300013105 Ga0157369_10056323 Ga0157369_100563232 446
216 3300013307 Ga0157372_10033363 Ga0157372_100333633 446
217 3300025911 Ga0207654_10000071 Ga0207654_1000007135 446
218 3300025913 Ga0207695_10000052 Ga0207695_10000052183 446
219 3300025913 Ga0207695_10000108 Ga0207695_10000108195 446
220 3300025913 Ga0207695_10000871 Ga0207695_1000087138 446
221 3300025913 Ga0207695_10001287 Ga0207695_1000128728 446
222 3300025913 Ga0207695_10007296 Ga0207695_100072966 446
223 3300025920 Ga0207649_10032172 Ga0207649_100321723 446
224 3300025920 Ga0207649_10114977 Ga0207649_101149772 446
225 3300025924 Ga0207694_10000325 Ga0207694_100003257 446
226 3300025924 Ga0207694_10001907 Ga0207694_100019072 446
227 3300025924 Ga0207694_10029904 Ga0207694_100299041 446
228 3300025927 Ga0207687_10005795 Ga0207687_100057953 446
229 3300025927 Ga0207687_10014384 Ga0207687_100143843 446
230 3300025931 Ga0207644_10017370 Ga0207644_100173702 446
231 3300025941 Ga0207711_10005714 Ga0207711_100057142 446
232 3300025941 Ga0207711_10009838 Ga0207711_100098383 446
233 3300025942 Ga0207689_10000130 Ga0207689_100001302 446
234 3300025944 Ga0207661_10025351 Ga0207661_100253511 446
235 3300025944 Ga0207661_10068305 Ga0207661_100683052 446
236 3300025949 Ga0207667_10006870 Ga0207667_1000687011 446
237 3300025986 Ga0207658_10002873 Ga0207658_100028733 446
238 3300026023 Ga0207677_10002815 Ga0207677_100028152 446
239 3300026035 Ga0207703_10012835 Ga0207703_100128354 446
240 3300026041 Ga0207639_10000180 Ga0207639_1000018028 446
241 3300026078 Ga0207702_10013479 Ga0207702_100134794 446
242 3300026078 Ga0207702_10065861 Ga0207702_100658612 446
243 3300026088 Ga0207641_10002565 Ga0207641_100025651 446
244 3300026116 Ga0207674_10000910 Ga0207674_100009109 446
245 3300026142 Ga0207698_10000007 Ga0207698_10000007182 446
246 3300026142 Ga0207698_10034846 Ga0207698_100348462 446
247 3300026142 Ga0207698_10066809 Ga0207698_100668092 446
248 3300028381 Ga0268264_10003544 Ga0268264_100035447 446
249 3300028800 Ga0265338_10114529 Ga0265338_101145292 446
250 3300031235 Ga0265330_10000828 Ga0265330_1000082813 446
251 3300031241 Ga0265325_10000664 Ga0265325_1000066417 446
252 3300031249 Ga0265339_10000089 Ga0265339_1000008936 446
253 3300031344 Ga0265316_10000687 Ga0265316_1000068731 446
254 3300031595 Ga0265313_10006038 Ga0265313_100060383 446
255 3300031712 Ga0265342_10003868 Ga0265342_100038686 446
256 3300031712 Ga0265342_10005184 Ga0265342_100051842 446
257 3300033180 Ga0307510_10065288 Ga0307510_100652883 446
258 3300042876 Ga0451577_0023261 Ga0451577_0023261_4132_5511 446
259 3300046471 Ga0495650_0000115 Ga0495650_0000115_138560_139987 446
260 3300046507 Ga0495606_0000053 Ga0495606_0000053_4228_5661 446
261 3300046507 Ga0495606_0039977 Ga0495606_0039977_250_1677 446
262 3300046512 Ga0495610_0000181 Ga0495610_0000181_15906_17339 446
263 3300046558 Ga0495633_0020109 Ga0495633_0020109_1692_3125 446
264 3300046616 Ga0495668_0000931 Ga0495668_0000931_27535_28968 446
265 3300046660 Ga0495625_0019381 Ga0495625_0019381_2983_4410 446
266 3300046665 Ga0495661_0070356 Ga0495661_0070356_181_1608 446
267 3300047472 Ga0495686_0011656 Ga0495686_0011656_2551_3984 446
268 3300047472 Ga0495686_0024618 Ga0495686_0024618_930_2357 446
269 3300048918 Ga0496115_0015447 Ga0496115_0015447_2986_4425 446
270 3300048929 Ga0496126_0000286 Ga0496126_0000286_41108_42535 446
271 3300053093 Ga0500651_0000002 Ga0500651_0000002_313873_315300 446
272 3300053119 Ga0500595_000044 Ga0500595_000044_80179_81606 446
273 3300003775 Ga0055524_1000025 Ga0055524_100002573 447
274 3300006948 Ga0099826_10000005 Ga0099826_10000005112 447
275 3300025299 Ga0209256_1000040 Ga0209256_1000040112 447
276 3300027666 Ga0209282_1000003 Ga0209282_1000003688 447
277 3300046520 Ga0495637_0000207 Ga0495637_0000207_42304_43737 447
278 3300046530 Ga0495654_0000002 Ga0495654_0000002_969954_971387 447
279 3300053125 Ga0500618_000258 Ga0500618_000258_3548_4978 447
280 3300053136 Ga0500559_0000670 Ga0500559_0000670_2466_3965 447
281 iso_pu_bacteria 2643221544 2643745946 447
282 iso_pu_bacteria 2643221585 2643936919 447
283 iso_pu_bacteria 2643221656 2644318084 447
284 3300004625 Ga0055543_1004851 Ga0055543_10048513 448
285 3300005262 Ga0065165_1000600 Ga0065165_100060037 448
286 3300009036 Ga0105244_10014545 Ga0105244_100145452 448
287 3300037312 Ga0395899_0021331 Ga0395899_0021331_2445_3881 448
288 3300037471 Ga0395905_0058968 Ga0395905_0058968_193_1629 448
289 3300038443 Ga0395901_0116165 Ga0395901_0116165_275_1711 448
290 3300044656 Ga0466969_0067618 Ga0466969_0067618_157_1596 448
291 3300044684 Ga0466966_0073230 Ga0466966_0073230_585_2024 448
292 3300046452 Ga0495617_000033 Ga0495617_000033_144108_145541 448
293 3300046471 Ga0495650_0001166 Ga0495650_0001166_3353_4792 448
294 3300046507 Ga0495606_0007009 Ga0495606_0007009_2273_3703 448
295 3300046507 Ga0495606_0016008 Ga0495606_0016008_1056_2489 448
296 3300046512 Ga0495610_0003889 Ga0495610_0003889_7613_9043 448
297 3300046810 Ga0495660_0012961 Ga0495660_0012961_975_2411 448
298 3300048929 Ga0496126_0038132 Ga0496126_0038132_2958_4394 448
299 3300050496 nmdc:mga07m45_52257_c1 nmdc:mga07m45_52257_c1_507_2060 448
300 iso_pu_bacteria 2643221639 2644220840 448
301 iso_pu_bacteria 2643221646 2644256551 448
302 iso_pu_bacteria 2830075706 2830076674 448
303 3300002774 JGI25150J39212_1000845 JGI25150J39212_10008452 449
304 3300003791 Ga0055530_10001969 Ga0055530_100019693 449
305 3300003792 Ga0055540_1000007 Ga0055540_1000007144 449
306 3300006042 Ga0075368_10049595 Ga0075368_100495951 449
307 3300025245 Ga0207425_1000297 Ga0207425_100029712 449
308 3300025294 Ga0209025_1009487 Ga0209025_10094872 449
309 3300025297 Ga0209758_1000470 Ga0209758_100047037 449
310 3300025298 Ga0209050_1002564 Ga0209050_10025644 449
311 3300025303 Ga0209051_1000004 Ga0209051_1000004197 449
312 3300025304 Ga0209257_1000038 Ga0209257_1000038331 449
313 3300025304 Ga0209257_1000044 Ga0209257_1000044228 449
314 3300031730 Ga0307516_10013080 Ga0307516_100130803 449
315 3300033180 Ga0307510_10000207 Ga0307510_1000020726 449
316 3300033180 Ga0307510_10054384 Ga0307510_100543842 449
317 3300046460 Ga0495638_0000436 Ga0495638_0000436_2535_3971 449
318 3300046471 Ga0495650_0000909 Ga0495650_0000909_13843_15285 449
319 3300046471 Ga0495650_0001915 Ga0495650_0001915_14609_16045 449
320 3300046506 Ga0495583_0000709 Ga0495583_0000709_2389_3825 449
321 3300046507 Ga0495606_0025808 Ga0495606_0025808_2658_4100 449
322 3300046512 Ga0495610_0012165 Ga0495610_0012165_2454_3887 449
323 3300046512 Ga0495610_0047952 Ga0495610_0047952_537_2009 449
324 3300046522 Ga0495643_0000195 Ga0495643_0000195_3050_4483 449
325 3300046524 Ga0495648_0000002 Ga0495648_0000002_392635_394071 449
326 3300046528 Ga0495642_0005491 Ga0495642_0005491_2363_3799 449
327 3300046538 Ga0495609_0009864 Ga0495609_0009864_3118_4554 449
328 3300046542 Ga0495597_0000322 Ga0495597_0000322_39565_40998 449
329 3300046557 Ga0495622_0000810 Ga0495622_0000810_13499_14935 449
330 3300046558 Ga0495633_0000382 Ga0495633_0000382_2876_4312 449
331 3300046558 Ga0495633_0006458 Ga0495633_0006458_2573_4009 449
332 3300046558 Ga0495633_0011051 Ga0495633_0011051_970_2403 449
333 3300046660 Ga0495625_0000124 Ga0495625_0000124_117018_118454 449
334 3300046660 Ga0495625_0001378 Ga0495625_0001378_158_1708 449
335 3300046660 Ga0495625_0006874 Ga0495625_0006874_6125_7558 449
336 3300046694 Ga0495649_0012321 Ga0495649_0012321_2241_3674 449
337 3300047320 Ga0495672_0000398 Ga0495672_0000398_49057_50490 449
338 3300047472 Ga0495686_0036736 Ga0495686_0036736_181_1731 449
339 3300048927 Ga0496124_0093200 Ga0496124_0093200_136_1578 449
340 3300049459 Ga0495678_000291 Ga0495678_000291_2365_3798 449
341 3300049459 Ga0495678_011834 Ga0495678_011834_186_1622 449
342 3300053093 Ga0500651_0005156 Ga0500651_0005156_3477_4949 449
343 3300053118 Ga0500594_0001863 Ga0500594_0001863_2197_3669 449
344 3300053136 Ga0500559_0000049 Ga0500559_0000049_24053_25525 449
345 3300053145 Ga0500586_000361 Ga0500586_000361_5117_6550 449
346 3300053156 Ga0500622_0003710 Ga0500622_0003710_3080_4552 449
347 3300044656 Ga0466969_0019479 Ga0466969_0019479_477_1985 450
348 3300044683 Ga0466965_0011906 Ga0466965_0011906_249_1757 450
349 3300044693 Ga0466961_0010615 Ga0466961_0010615_368_1876 450
350 3300044765 Ga0466970_0093423 Ga0466970_0093423_83_1591 450
351 3300044901 Ga0466960_0021626 Ga0466960_0021626_236_1744 450
352 3300046538 Ga0495609_0012100 Ga0495609_0012100_2462_3895 450
353 3300047443 Ga0495687_006047 Ga0495687_006047_3674_5107 450
354 3300048905 Ga0496102_0029736 Ga0496102_0029736_3390_4856 450
355 3300053117 Ga0500593_000662 Ga0500593_000662_7560_9026 450
356 iso_pu_bacteria 2585428062 2587756170 450
357 iso_pu_bacteria 2585428062 2587758192 450
358 3300003316 rootH1_10021293 rootH1_100212936 451
359 3300003322 rootL2_10063119 rootL2_100631197 451
360 3300003323 rootH1_10199011 rootH1_101990112 451
361 3300003791 Ga0055530_10003523 Ga0055530_100035235 451
362 3300003792 Ga0055540_1000002 Ga0055540_1000002224 451
363 3300003794 Ga0055531_10004266 Ga0055531_100042667 451
364 3300005328 Ga0070676_10043747 Ga0070676_100437472 451
365 3300005330 Ga0070690_100010947 Ga0070690_1000109472 451
366 3300005333 Ga0070677_10046585 Ga0070677_100465852 451
367 3300005335 Ga0070666_10013184 Ga0070666_100131845 451
368 3300005338 Ga0068868_100012059 Ga0068868_1000120591 451
369 3300005340 Ga0070689_100028788 Ga0070689_1000287883 451
370 3300005344 Ga0070661_100018235 Ga0070661_1000182353 451
371 3300005354 Ga0070675_100003600 Ga0070675_1000036006 451
372 3300005366 Ga0070659_100001364 Ga0070659_10000136415 451
373 3300005456 Ga0070678_100009945 Ga0070678_1000099453 451
374 3300005564 Ga0070664_100011153 Ga0070664_1000111535 451
375 3300005617 Ga0068859_100011237 Ga0068859_1000112375 451
376 3300005618 Ga0068864_100000508 Ga0068864_10000050823 451
377 3300005834 Ga0068851_10031800 Ga0068851_100318002 451
378 3300005842 Ga0068858_100007399 Ga0068858_1000073996 451
379 3300005843 Ga0068860_100029800 Ga0068860_1000298003 451
380 3300006353 Ga0075370_10020690 Ga0075370_100206902 451
381 3300006931 Ga0097620_100011237 Ga0097620_1000112373 451
382 3300009177 Ga0105248_10053312 Ga0105248_100533123 451
383 3300013296 Ga0157374_10086228 Ga0157374_100862282 451
384 3300014325 Ga0163163_10004179 Ga0163163_100041794 451
385 3300014968 Ga0157379_10017963 Ga0157379_100179632 451
386 3300021384 Ga0213876_10012608 Ga0213876_100126084 451
387 3300025298 Ga0209050_1000457 Ga0209050_100045754 451
388 3300025303 Ga0209051_1000024 Ga0209051_1000024225 451
389 3300025304 Ga0209257_1000079 Ga0209257_1000079225 451
390 3300025893 Ga0207682_10014949 Ga0207682_100149492 451
391 3300025903 Ga0207680_10003657 Ga0207680_100036572 451
392 3300025907 Ga0207645_10050339 Ga0207645_100503392 451
393 3300025920 Ga0207649_10002578 Ga0207649_100025787 451
394 3300025926 Ga0207659_10003304 Ga0207659_100033045 451
395 3300025931 Ga0207644_10021046 Ga0207644_100210463 451
396 3300025932 Ga0207690_10019544 Ga0207690_100195442 451
397 3300025936 Ga0207670_10019961 Ga0207670_100199612 451
398 3300025938 Ga0207704_10039101 Ga0207704_100391012 451
399 3300025941 Ga0207711_10086363 Ga0207711_100863632 451
400 3300025945 Ga0207679_10003600 Ga0207679_100036005 451
401 3300026023 Ga0207677_10009409 Ga0207677_100094093 451
402 3300026095 Ga0207676_10004582 Ga0207676_100045823 451
403 3300026121 Ga0207683_10056178 Ga0207683_100561782 451
404 3300031548 Ga0307408_100000046 Ga0307408_10000004687 451
405 3300039437 Ga0436365_0860276 Ga0436365_0860276_1179_2558 451
406 3300041410 Ga0439461_0001755 Ga0439461_0001755_773_2146 451
407 3300042126 Ga0450888_000211 Ga0450888_000211_3378_4757 451
408 3300042129 Ga0450891_000495 Ga0450891_000495_1545_2924 451
409 3300042138 Ga0450903_004917 Ga0450903_004917_546_1925 451
410 3300042144 Ga0450889_000406 Ga0450889_000406_2555_3934 451
411 3300042531 Ga0450918_000112 Ga0450918_000112_12222_13721 451
412 3300042532 Ga0450893_0004099 Ga0450893_0004099_856_2235 451
413 3300048912 Ga0496109_0038751 Ga0496109_0038751_601_2079 451
414 3300049130 Ga0501310_000422 Ga0501310_000422_2008_3381 451
415 3300049658 Ga0501211_000098 Ga0501211_000098_3598_4971 451
416 3300049663 Ga0501223_006978 Ga0501223_006978_831_2204 451
417 3300049704 Ga0501221_001202 Ga0501221_001202_1331_2704 451
418 3300049764 Ga0501267_000375 Ga0501267_000375_1015_2388 451
419 3300050496 nmdc:mga07m45_3456_c1 nmdc:mga07m45_3456_c1_1995_3368 451
420 iso_pu_bacteria 2643221644 2644247780 451
421 3300003316 rootH1_10001187 rootH1_100011872 452
422 3300003322 rootL2_10069657 rootL2_100696573 452
423 3300003794 Ga0055531_10000330 Ga0055531_1000033012 452
424 3300005344 Ga0070661_100140469 Ga0070661_1001404691 452
425 3300014325 Ga0163163_10198094 Ga0163163_101980942 452
426 3300015690 Ga0183363_1015 Ga0183363_101549 452
427 3300025298 Ga0209050_1003116 Ga0209050_10031163 452
428 3300025304 Ga0209257_1000032 Ga0209257_1000032357 452
429 3300025304 Ga0209257_1012510 Ga0209257_10125102 452
430 3300026078 Ga0207702_10251827 Ga0207702_102518271 452
431 3300028794 Ga0307515_10007649 Ga0307515_1000764920 452
432 3300028794 Ga0307515_10143864 Ga0307515_101438642 452
433 3300031251 Ga0265327_10001820 Ga0265327_100018203 452
434 3300035114 Ga0373939_0000004 Ga0373939_0000004_58312_59688 452
435 3300035121 Ga0373960_0001935 Ga0373960_0001935_2420_3796 452
436 3300037471 Ga0395905_0000117 Ga0395905_0000117_75045_76643 452
437 3300042876 Ga0451577_0002719 Ga0451577_0002719_10233_11600 452
438 3300045051 Ga0451576_0004176 Ga0451576_0004176_3874_5241 452
439 3300045051 Ga0451576_0132700 Ga0451576_0132700_534_1910 452
440 3300047472 Ga0495686_0040601 Ga0495686_0040601_336_1721 452
441 iso_pu_bacteria 2643221654 2644305647 452
442 3300003322 rootL2_10026577 rootL2_100265772 453
443 3300003322 rootL2_10057017 rootL2_100570173 453
444 3300003323 rootH1_10048416 rootH1_100484162 453
445 3300005364 Ga0070673_100090375 Ga0070673_1000903752 453
446 3300006237 Ga0097621_100084865 Ga0097621_1000848652 453
447 3300013297 Ga0157378_10041080 Ga0157378_100410803 453
448 3300025925 Ga0207650_10030324 Ga0207650_100303242 453
449 3300025945 Ga0207679_10037210 Ga0207679_100372102 453
450 3300028786 Ga0307517_10076967 Ga0307517_100769672 453
451 3300028794 Ga0307515_10053868 Ga0307515_100538683 453
452 3300031730 Ga0307516_10029199 Ga0307516_100291992 453
453 3300037471 Ga0395905_0001029 Ga0395905_0001029_5204_6583 453
454 3300046660 Ga0495625_0002387 Ga0495625_0002387_16292_17815 453
455 3300050493 nmdc:mga0k408_206_c1 nmdc:mga0k408_206_c1_9164_10693 453
456 3300005459 Ga0068867_100000104 Ga0068867_10000010443 454
457 3300006195 Ga0075366_10010043 Ga0075366_100100432 454
458 3300009148 Ga0105243_10028774 Ga0105243_100287742 454
459 3300014745 Ga0157377_10000010 Ga0157377_10000010360 454
460 3300025935 Ga0207709_10003711 Ga0207709_100037113 454
461 3300026089 Ga0207648_10000002 Ga0207648_10000002296 454
462 3300028794 Ga0307515_10000013 Ga0307515_1000001351 454
463 3300028794 Ga0307515_10011224 Ga0307515_1001122411 454
464 3300031456 Ga0307513_10004611 Ga0307513_100046116 454
465 3300031456 Ga0307513_10013254 Ga0307513_100132547 454
466 3300042876 Ga0451577_0085649 Ga0451577_0085649_774_2330 454
467 3300044712 Ga0453684_0017908 Ga0453684_0017908_3472_5025 454
468 3300045051 Ga0451576_0006080 Ga0451576_0006080_9473_11029 454
469 3300046512 Ga0495610_0014665 Ga0495610_0014665_1230_2780 454
470 3300048913 Ga0496110_0089314 Ga0496110_0089314_1086_2693 454
471 3300050493 nmdc:mga0k408_19148_c1 nmdc:mga0k408_19148_c1_1357_2904 454
472 3300053134 Ga0500658_0017066 Ga0500658_0017066_1048_2598 454
473 3300028794 Ga0307515_10000123 Ga0307515_1000012331 455
474 3300030522 Ga0307512_10022819 Ga0307512_100228193 455
475 3300030522 Ga0307512_10070486 Ga0307512_100704861 455
476 3300031548 Ga0307408_100032935 Ga0307408_1000329351 455
477 3300031616 Ga0307508_10000134 Ga0307508_1000013420 455
478 3300046683 Ga0495658_0027845 Ga0495658_0027845_1269_2822 455
479 3300048913 Ga0496110_0045911 Ga0496110_0045911_875_2398 455
480 3300005331 Ga0070670_100023816 Ga0070670_1000238163 456
481 3300005331 Ga0070670_100168566 Ga0070670_1001685661 456
482 3300005355 Ga0070671_100002176 Ga0070671_1000021766 456
483 3300005445 Ga0070708_100163057 Ga0070708_1001630572 456
484 3300005543 Ga0070672_100017706 Ga0070672_1000177063 456
485 3300005844 Ga0068862_100188068 Ga0068862_1001880682 456
486 3300006237 Ga0097621_100024443 Ga0097621_1000244433 456
487 3300006358 Ga0068871_100009407 Ga0068871_1000094073 456
488 3300009148 Ga0105243_10095312 Ga0105243_100953122 456
489 3300009176 Ga0105242_10004451 Ga0105242_100044516 456
490 3300009177 Ga0105248_10017921 Ga0105248_100179212 456
491 3300025925 Ga0207650_10035438 Ga0207650_100354382 456
492 3300025931 Ga0207644_10003061 Ga0207644_100030612 456
493 3300025934 Ga0207686_10013295 Ga0207686_100132953 456
494 3300025940 Ga0207691_10023893 Ga0207691_100238934 456
495 3300025941 Ga0207711_10005291 Ga0207711_100052914 456
496 3300026142 Ga0207698_10021579 Ga0207698_100215793 456
497 3300037471 Ga0395905_0014246 Ga0395905_0014246_2187_3740 456
498 3300048911 Ga0496108_0066961 Ga0496108_0066961_278_1831 456
499 3300050493 nmdc:mga0k408_67551_c1 nmdc:mga0k408_67551_c1_343_1896 456
500 3300031456 Ga0307513_10056384 Ga0307513_100563842 457
501 3300028794 Ga0307515_10054206 Ga0307515_100542063 458
502 3300028563 Ga0265319_1024086 Ga0265319_10240862 459
503 3300031344 Ga0265316_10000668 Ga0265316_100006683 459
504 3300031824 Ga0307413_10066872 Ga0307413_100668722 460
505 3300032004 Ga0307414_10058803 Ga0307414_100588032 460
506 3300032005 Ga0307411_10040292 Ga0307411_100402922 460
507 3300046453 Ga0495627_011912 Ga0495627_011912_1485_2966 460
508 3300053079 Ga0500610_0000519 Ga0500610_0000519_2177_3652 460
509 3300053079 Ga0500610_0000524 Ga0500610_0000524_2177_3652 460
510 3300053117 Ga0500593_000637 Ga0500593_000637_2797_4272 460
511 3300053121 Ga0500607_000025 Ga0500607_000025_54386_55861 460
512 3300053158 Ga0500627_0000836 Ga0500627_0000836_2788_4269 460
513 3300053161 Ga0500634_0000599 Ga0500634_0000599_2832_4307 460
514 3300042015 Ga0439462_0000640 Ga0439462_0000640_447_1856 461
515 3300028380 Ga0268265_10243245 Ga0268265_102432451 465
516 3300046810 Ga0495660_0073756 Ga0495660_0073756_50_1525 465
517 3300025940 Ga0207691_10106302 Ga0207691_101063024 469
518 iso_pu_bacteria 2547132374 2548501838 469
519 iso_pu_bacteria 2643221609 2644060026 469
520 iso_pu_bacteria 2643221611 2644072630 469
521 iso_pu_bacteria 2643221717 2644646436 469
522 iso_pu_bacteria 2738543012 2739245654 469
523 iso_pu_bacteria 2816332133 2816470442 469
524 iso_pu_bacteria 2721755523 2722883036 470
525 iso_pu_bacteria 2839138175 2839143834 470
526 3300027614 Ga0209970_1000371 Ga0209970_10003713 472
527 iso_pu_bacteria 2643221570 2643864049 472
528 iso_pu_bacteria 2643221596 2643992359 472
529 iso_pu_bacteria 2643221652 2644292294 472
530 iso_pu_bacteria 2990710928 2990714580 472
531 3300006178 Ga0075367_10095764 Ga0075367_100957641 473
532 3300009176 Ga0105242_10002719 Ga0105242_100027192 473
533 3300049763 Ga0501266_000571 Ga0501266_000571_2750_4201 473
534 3300006946 Ga0079104_1000026 Ga0079104_1000026219 474
535 3300009092 Ga0105250_10011713 Ga0105250_100117132 474
536 3300025711 Ga0207696_1018588 Ga0207696_10185882 474
537 3300025935 Ga0207709_10000079 Ga0207709_1000007914 474
538 3300027111 Ga0209281_1000067 Ga0209281_1000067277 474
539 3300027876 Ga0209974_10003224 Ga0209974_100032247 477
540 3300028794 Ga0307515_10068407 Ga0307515_100684075 477
541 3300031238 Ga0265332_10000006 Ga0265332_10000006143 477
542 3300031456 Ga0307513_10104709 Ga0307513_101047092 477
543 3300031548 Ga0307408_100000298 Ga0307408_10000029827 477
544 3300031548 Ga0307408_100000298 Ga0307408_10000029829 477
545 3300031901 Ga0307406_10000234 Ga0307406_1000023419 477
546 3300031901 Ga0307406_10000234 Ga0307406_1000023421 477
547 3300042876 Ga0451577_0012040 Ga0451577_0012040_6530_7987 477
548 3300044673 Ga0453683_0058409 Ga0453683_0058409_901_2358 477
549 3300044712 Ga0453684_0115348 Ga0453684_0115348_1478_2935 477
550 3300044712 Ga0453684_0272682 Ga0453684_0272682_152_1609 477
551 3300045051 Ga0451576_0069102 Ga0451576_0069102_1361_2818 477
552 3300025937 Ga0207669_10023996 Ga0207669_100239962 478
553 3300026121 Ga0207683_10085729 Ga0207683_100857292 478
554 iso_pu_bacteria 2904541872 2904544978 478
555 iso_pu_bacteria 2929160207 2929163350 478
556 3300048926 Ga0496123_0057100 Ga0496123_0057100_743_2212 479
557 iso_pu_bacteria 2945984333 2945985688 479
558 iso_pu_bacteria 2738541277 2738717832 481
559 iso_pu_bacteria 2738543019 2739278518 481
560 iso_pu_bacteria 2599185214 2599623835 482
561 iso_pu_bacteria 2599185226 2599671546 482
562 iso_pu_bacteria 2599185227 2599681441 482
563 iso_pu_bacteria 2599185229 2599693156 482
564 iso_pu_bacteria 2643221672 2644400394 482
565 iso_pu_bacteria 2831265667 2831266440 482
566 iso_pu_bacteria 2838054893 2838057438 482
567 iso_pu_bacteria 2885198086 2885204576 482
568 iso_pu_bacteria 2885211737 2885218229 482
569 iso_pu_bacteria 2928084124 2928084448 482
570 3300003187 JGI25151J46595_10000507 JGI25151J46595_1000050729 483
571 3300005563 Ga0068855_100135831 Ga0068855_1001358313 483
572 3300005577 Ga0068857_100069422 Ga0068857_1000694222 483
573 3300005616 Ga0068852_100065174 Ga0068852_1000651744 483
574 3300006195 Ga0075366_10006014 Ga0075366_100060147 483
575 3300006353 Ga0075370_10002530 Ga0075370_100025308 483
576 3300010375 Ga0105239_10094985 Ga0105239_100949852 483
577 3300013104 Ga0157370_10004596 Ga0157370_100045969 483
578 3300013105 Ga0157369_10005047 Ga0157369_100050477 483
579 3300014497 Ga0182008_10010462 Ga0182008_100104624 483
580 3300025258 Ga0209129_1004819 Ga0209129_10048192 483
581 3300025294 Ga0209025_1000104 Ga0209025_1000104154 483
582 3300025949 Ga0207667_10110980 Ga0207667_101109802 483
583 3300026142 Ga0207698_10016734 Ga0207698_100167342 483
584 3300050496 nmdc:mga07m45_63535_c1 nmdc:mga07m45_63535_c1_278_1753 483
585 3300046557 Ga0495622_0071767 Ga0495622_0071767_20_1501 485
586 3300048904 Ga0496101_0063906 Ga0496101_0063906_260_1717 485
587 3300053136 Ga0500559_0009307 Ga0500559_0009307_2243_3703 485
588 3300003791 Ga0055530_10005653 Ga0055530_100056536 486
589 3300003792 Ga0055540_1000365 Ga0055540_100036516 486
590 3300003794 Ga0055531_10000454 Ga0055531_1000045426 486
591 3300017792 Ga0163161_10013846 Ga0163161_100138465 486
592 3300025291 Ga0209675_1001875 Ga0209675_10018753 486
593 3300025292 Ga0209676_1000383 Ga0209676_100038350 486
594 3300025294 Ga0209025_1019246 Ga0209025_10192462 486
595 3300025298 Ga0209050_1000952 Ga0209050_10009526 486
596 3300025303 Ga0209051_1000259 Ga0209051_100025951 486
597 3300025304 Ga0209257_1000116 Ga0209257_1000116175 486
598 3300025933 Ga0207706_10018657 Ga0207706_100186574 486
599 3300046513 Ga0495616_0028134 Ga0495616_0028134_566_2032 486
600 3300046518 Ga0495631_0000408 Ga0495631_0000408_14805_16271 486
601 3300046539 Ga0495621_0001025 Ga0495621_0001025_1103_2569 486
602 3300046683 Ga0495658_0055156 Ga0495658_0055156_83_1549 486
603 3300047673 Ga0495593_0003185 Ga0495593_0003185_734_2200 486
604 3300048089 Ga0495614_0003925 Ga0495614_0003925_560_2026 486
605 3300048919 Ga0496116_0023363 Ga0496116_0023363_501_1961 486
606 3300048920 Ga0496117_0019331 Ga0496117_0019331_2199_3659 486
607 3300048924 Ga0496121_0066366 Ga0496121_0066366_751_2211 486
608 3300048926 Ga0496123_0016544 Ga0496123_0016544_2471_3931 486
609 3300048926 Ga0496123_0016684 Ga0496123_0016684_2859_4325 486
610 3300053093 Ga0500651_0000015 Ga0500651_0000015_23597_25063 486
611 3300053110 Ga0500571_000017 Ga0500571_000017_39575_41041 486
612 3300053121 Ga0500607_005461 Ga0500607_005461_4479_5939 486
613 3300053133 Ga0500655_000069 Ga0500655_000069_15685_17151 486
614 3300053134 Ga0500658_0000054 Ga0500658_0000054_43251_44717 486
615 3300053134 Ga0500658_0000248 Ga0500658_0000248_321_1787 486
616 3300053138 Ga0500564_012408 Ga0500564_012408_1193_2659 486
617 3300053139 Ga0500568_0001431 Ga0500568_0001431_8482_9948 486
618 3300053153 Ga0500616_0013029 Ga0500616_0013029_1787_3253 486
619 3300053177 Ga0500636_0013941 Ga0500636_0013941_2913_4379 486
620 3300053729 Ga0500625_022389 Ga0500625_022389_870_2330 486
621 3300001979 JGI24740J21852_10007769 JGI24740J21852_100077693 487
622 3300048928 Ga0496125_0020270 Ga0496125_0020270_2770_4233 487

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

357

525

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g4g-assembly3.cif.gz_C full length ectodomain of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) including the smb domains but with a partially disordered active site structure 0.7496 296 375
4gtz-assembly1.cif.gz_A crystal structure of mouse enpp1 in complex with cmp 0.7406 295 380
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.7258 317 380
6c01-assembly2.cif.gz_B human ectonucleotide pyrophosphatase / phosphodiesterase 3 (enpp3, npp3, cd203c) 0.722 295 379
6f2y-assembly2.cif.gz_B crystal structure of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) in complex with ap4a 0.7127 295 379
ID Description Score Start End Superfamily
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6518 299 380 3.40.720.10
2zktA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5716 50 401 3.40.720.10
af_P75785_205_504_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5567 50 459 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5474 51 399 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5407 51 399 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A257H587-F1-model_v4 Tat pathway signal protein 0.9665 117 487
AF-A0A257H587-F1-model_v4 Tat pathway signal protein 0.9639 117 487
AF-A0A1V6EPF6-F1-model_v4 Tat pathway signal protein 0.962 99 487
AF-A0A3C0KHH6-F1-model_v4 Tat pathway signal protein 0.9595 255 436
AF-A0A1V6EPF6-F1-model_v4 Tat pathway signal protein 0.9571 99 487

Feature Viewer

pLDDT pTM Quality
87.84 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map