F470103

General Info

Members Datasets Scaffolds Average Seq Length
622 261 1034 188

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10100425|Ga0207693_101004252
Length 204
Sequence MFLLESFKEGGWGMYPILILAAITIFIAIDRFLYVQKSKVDVDKLMSLLKSQIVSGNIQGAVNTCMASPAPVTKIIAAGLRKAGGSEHDVQQAMDEEALRELPRLEKRTGYLAMLGNLAAGVDPSMKATMLSKGISEAMNCTAFGLGTGIVGLATYAILNGQTQHVLDGINQASVETLNLVVTGRQGGGPGAVLEAIGDGQRAQ

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
166 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.46
Metatranscriptomes 12.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.02
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10100425 3300025915 Unclassified 2268
2 Ga0006767J43181_102084 3300002868 Bacteria 2639
3 Ga0006763J43179_103374 3300002870 Bacteria 2177
4 Ga0006762J43184_103412 3300002872 Bacteria 2657
5 Ga0006760J45825_103176 3300003158 Bacteria 1602
6 Ga0006765J45826_109285 3300003161 Bacteria 2594
7 Ga0006778J45830_1038748 3300003162 Bacteria 1602
8 Ga0006759J45824_1005829 3300003163 Bacteria 2777
9 Ga0006759J45824_1044890 3300003163 Bacteria 1123
10 Ga0006759J45824_1051285 3300003163 Bacteria 1522
11 Ga0006759J45824_1096018 3300003163 Unclassified 1665
12 Ga0006758J48902_1007242 3300003300 Bacteria 2613
13 Ga0006770J48903_1021571 3300003305 Bacteria 2305
14 Ga0007417J51691_1022390 3300003544 Bacteria 1911
15 Ga0007417J51691_1053478 3300003544 Bacteria 763
16 Ga0007410J51695_1061257 3300003574 Bacteria 1083
17 Ga0007409J51694_1020578 3300003575 Bacteria 1400
18 Ga0007409J51694_1060095 3300003575 Unclassified 1835
19 Ga0007416J51690_1034982 3300003577 Bacteria 808
20 Ga0007416J51690_1094289 3300003577 Unclassified 717
21 Ga0032354_1003399 3300003693 Bacteria 2662
22 Ga0032354_1080788 3300003693 Bacteria 1446
23 Ga0058859_10010442 3300004798 Unclassified 3074
24 Ga0058859_10084052 3300004798 Bacteria 1883
25 Ga0058863_10036104 3300004799 Bacteria 2184
26 Ga0058863_10037321 3300004799 Bacteria 1201
27 Ga0058863_10071324 3300004799 Bacteria 2201
28 Ga0058861_10060570 3300004800 Bacteria 983
29 Ga0058860_10090439 3300004801 Bacteria 1069
30 Ga0058860_10106978 3300004801 Bacteria 1572
31 Ga0058860_10200896 3300004801 Bacteria 2669
32 Ga0058860_12117425 3300004801 Bacteria 823
33 Ga0058860_12143662 3300004801 Bacteria 1404
34 Ga0058860_12204739 3300004801 Bacteria 990
35 Ga0058862_10001581 3300004803 Bacteria 1464
36 Ga0065712_10149515 3300005290 Bacteria 1381
37 Ga0065715_10050972 3300005293 Bacteria 1124
38 Ga0070658_10002043 3300005327 Bacteria 16926
39 Ga0070676_10592525 3300005328 Bacteria 798
40 Ga0070683_100003329 3300005329 Bacteria 12996
41 Ga0070683_100309279 3300005329 Bacteria 1503
42 Ga0070683_100378125 3300005329 Bacteria 1349
43 Ga0070690_100024771 3300005330 Bacteria 3692
44 Ga0070690_100047932 3300005330 Bacteria 2719
45 Ga0070670_100068781 3300005331 Bacteria 3039
46 Ga0070670_100226313 3300005331 Bacteria 1627
47 Ga0068869_100125356 3300005334 Bacteria 1969
48 Ga0070666_10083945 3300005335 Bacteria 2179
49 Ga0070666_10182691 3300005335 Bacteria 1471
50 Ga0070680_100011471 3300005336 Bacteria 6856
51 Ga0070680_100509757 3300005336 Bacteria 1030
52 Ga0070682_100088064 3300005337 Bacteria 2025
53 Ga0070682_100147497 3300005337 Bacteria 1610
54 Ga0070682_100172448 3300005337 Bacteria 1504
55 Ga0070682_100395540 3300005337 Bacteria 1043
56 Ga0068868_100058849 3300005338 Bacteria 3038
57 Ga0068868_100214796 3300005338 Bacteria 1608
58 Ga0070689_100000002 3300005340 Bacteria 695141
59 Ga0070689_100152299 3300005340 Bacteria 1865
60 Ga0070689_100153952 3300005340 Bacteria 1855
61 Ga0070689_100381586 3300005340 Bacteria 1188
62 Ga0070689_100566160 3300005340 Bacteria 980
63 Ga0070687_100009784 3300005343 Bacteria 4119
64 Ga0070687_100083671 3300005343 Bacteria 1747
65 Ga0070668_100009923 3300005347 Bacteria 7052
66 Ga0070669_100799475 3300005353 Bacteria 801
67 Ga0070675_100069561 3300005354 Bacteria 2916
68 Ga0070671_100230569 3300005355 Bacteria 1571
69 Ga0070674_100005777 3300005356 Bacteria 7180
70 Ga0070674_100101455 3300005356 Unclassified 2098
71 Ga0070673_100034290 3300005364 Bacteria 3839
72 Ga0070688_100199996 3300005365 Bacteria 1397
73 Ga0070667_100453040 3300005367 Bacteria 1173
74 Ga0070703_10162853 3300005406 Unclassified 848
75 Ga0070709_10090879 3300005434 Bacteria 2014
76 Ga0070713_100067850 3300005436 Bacteria 3004
77 Ga0070713_100289600 3300005436 Bacteria 1505
78 Ga0070711_100313587 3300005439 Bacteria 1251
79 Ga0070711_100450252 3300005439 Bacteria 1054
80 Ga0070700_100004122 3300005441 Bacteria 7575
81 Ga0070694_100410806 3300005444 Bacteria 1062
82 Ga0070708_100726973 3300005445 Bacteria 934
83 Ga0070678_100210285 3300005456 Bacteria 1611
84 Ga0070662_100030004 3300005457 Bacteria 3800
85 Ga0070681_10165296 3300005458 Bacteria 2136
86 Ga0068867_100007590 3300005459 Bacteria 7674
87 Ga0070685_10070079 3300005466 Bacteria 2075
88 Ga0070698_100648694 3300005471 Bacteria 997
89 Ga0070698_100684016 3300005471 Bacteria 968
90 Ga0070679_100009440 3300005530 Bacteria 9228
91 Ga0070679_100095387 3300005530 Bacteria 2962
92 Ga0070684_100002919 3300005535 Bacteria 12711
93 Ga0070684_100198813 3300005535 Bacteria 1825
94 Ga0070684_100222859 3300005535 Bacteria 1720
95 Ga0070684_100307488 3300005535 Bacteria 1455
96 Ga0070684_100633971 3300005535 Bacteria 994
97 Ga0070697_100757615 3300005536 Bacteria 858
98 Ga0068853_100001166 3300005539 Bacteria 18689
99 Ga0068853_101229077 3300005539 Bacteria 724
100 Ga0070672_100064398 3300005543 Bacteria 2896
101 Ga0070672_100650641 3300005543 Bacteria 920
102 Ga0070686_100016193 3300005544 Bacteria 4334
103 Ga0070686_100022940 3300005544 Bacteria 3723
104 Ga0070686_100142060 3300005544 Bacteria 1672
105 Ga0070693_100333806 3300005547 Bacteria 1033
106 Ga0070665_100352314 3300005548 Bacteria 1478
107 Ga0070665_100412582 3300005548 Bacteria 1359
108 Ga0068855_100022245 3300005563 Bacteria 7597
109 Ga0068855_100090365 3300005563 Bacteria 3534
110 Ga0068857_100229785 3300005577 Bacteria 1696
111 Ga0068854_100039864 3300005578 Bacteria 3311
112 Ga0068856_100072417 3300005614 Bacteria 3411
113 Ga0068856_100628406 3300005614 Bacteria 1095
114 Ga0070702_100232111 3300005615 Bacteria 1240
115 Ga0068852_100199305 3300005616 Bacteria 1894
116 Ga0068852_100427262 3300005616 Bacteria 1308
117 Ga0068852_100920713 3300005616 Bacteria 892
118 Ga0068859_100268634 3300005617 Bacteria 1797
119 Ga0068861_100124005 3300005719 Bacteria 2088
120 Ga0068861_100583438 3300005719 Bacteria 1023
121 Ga0068861_100788814 3300005719 Bacteria 890
122 Ga0068863_100787704 3300005841 Bacteria 948
123 Ga0068862_100039416 3300005844 Bacteria 4012
124 Ga0068862_100372012 3300005844 Bacteria 1330
125 Ga0068862_100397843 3300005844 Bacteria 1288
126 Ga0081455_10293168 3300005937 Bacteria 1170
127 Ga0070717_10387081 3300006028 Bacteria 1255
128 Ga0070715_10158231 3300006163 Bacteria 1117
129 Ga0075430_100496991 3300006846 Bacteria 1007
130 Ga0068865_100004463 3300006881 Bacteria 8441
131 Ga0097620_100268643 3300006931 Bacteria 1797
132 Ga0075435_100616007 3300007076 Bacteria 942
133 Ga0105240_10019733 3300009093 Bacteria 9005
134 Ga0105240_10133027 3300009093 Bacteria 2981
135 Ga0111539_10057409 3300009094 Bacteria 4623
136 Ga0105247_10232034 3300009101 Bacteria 1254
137 Ga0105241_10086201 3300009174 Bacteria 2469
138 Ga0105237_10000101 3300009545 Bacteria 119322
139 Ga0105237_10059574 3300009545 Bacteria 3819
140 Ga0105237_10130211 3300009545 Bacteria 2511
141 Ga0105238_10005442 3300009551 Bacteria 12576
142 Ga0105238_10015301 3300009551 Bacteria 7771
143 Ga0105238_10279772 3300009551 Bacteria 1650
144 Ga0105239_10070238 3300010375 Bacteria 3846
145 Ga0105239_10747656 3300010375 Bacteria 1119
146 Ga0154014_103114 3300013052 Bacteria 727
147 Ga0157374_10118914 3300013296 Bacteria 2549
148 Ga0157374_10173761 3300013296 Bacteria 2102
149 Ga0157374_10521719 3300013296 Bacteria 1194
150 Ga0157378_10053951 3300013297 Bacteria 3580
151 Ga0157378_10317426 3300013297 Bacteria 1513
152 Ga0157378_10436964 3300013297 Bacteria 1296
153 Ga0163162_10554616 3300013306 Unclassified 1277
154 Ga0157375_10572172 3300013308 Bacteria 1290
155 Ga0157375_11304111 3300013308 Bacteria 854
156 Ga0163163_10341316 3300014325 Bacteria 1553
157 Ga0157380_10862438 3300014326 Bacteria 928
158 Ga0157377_10559000 3300014745 Bacteria 810
159 Ga0157377_10687683 3300014745 Bacteria 741
160 Ga0157379_10098819 3300014968 Unclassified 2620
161 Ga0157376_10044156 3300014969 Bacteria 3662
162 Ga0157376_10882599 3300014969 Bacteria 911
163 Ga0197907_10703562 3300020069 Bacteria 1445
164 Ga0206356_10520761 3300020070 Unclassified 1221
165 Ga0206356_10639141 3300020070 Bacteria 896
166 Ga0206356_10705176 3300020070 Bacteria 3725
167 Ga0206355_1661710 3300020076 Bacteria 1782
168 Ga0206351_10717000 3300020077 Bacteria 1027
169 Ga0206351_10732164 3300020077 Bacteria 772
170 Ga0206352_10117762 3300020078 Unclassified 1219
171 Ga0206352_10541931 3300020078 Bacteria 2100
172 Ga0206352_10809002 3300020078 Unclassified 1275
173 Ga0206352_10920700 3300020078 Bacteria 2606
174 Ga0206352_10961159 3300020078 Bacteria 1632
175 Ga0206352_11254508 3300020078 Bacteria 1040
176 Ga0206350_11419771 3300020080 Bacteria 871
177 Ga0206353_10788314 3300020082 Bacteria 1140
178 Ga0224712_10128615 3300022467 Bacteria 1104
179 Ga0207666_1002356 3300025271 Bacteria 2273
180 Ga0207697_10012087 3300025315 Bacteria 3634
181 Ga0207682_10117945 3300025893 Bacteria 1175
182 Ga0207692_10098724 3300025898 Bacteria 1599
183 Ga0207642_10085805 3300025899 Bacteria 1541
184 Ga0207688_10056336 3300025901 Bacteria 2208
185 Ga0207680_10055895 3300025903 Bacteria 2381
186 Ga0207645_10005842 3300025907 Bacteria 8872
187 Ga0207643_10087210 3300025908 Bacteria 1815
188 Ga0207705_10024553 3300025909 Bacteria 4301
189 Ga0207654_10260160 3300025911 Bacteria 1166
190 Ga0207707_10337812 3300025912 Bacteria 1299
191 Ga0207707_10515446 3300025912 Bacteria 1019
192 Ga0207707_10747445 3300025912 Archaea 818
193 Ga0207695_10287527 3300025913 Bacteria 1537
194 Ga0207671_10000194 3300025914 Bacteria 94161
195 Ga0207671_10070424 3300025914 Bacteria 2607
196 Ga0207671_10097210 3300025914 Bacteria 2226
197 Ga0207663_10296656 3300025916 Bacteria 1206
198 Ga0207663_10473720 3300025916 Bacteria 969
199 Ga0207660_10052352 3300025917 Bacteria 2906
200 Ga0207662_10016475 3300025918 Bacteria 4172
201 Ga0207662_10069189 3300025918 Bacteria 2133
202 Ga0207657_10146920 3300025919 Bacteria 1922
203 Ga0207657_10208267 3300025919 Bacteria 1570
204 Ga0207652_10000539 3300025921 Bacteria 38450
205 Ga0207652_10002124 3300025921 Bacteria 17010
206 Ga0207652_10118452 3300025921 Bacteria 2353
207 Ga0207652_10554735 3300025921 Bacteria 1032
208 Ga0207681_10031379 3300025923 Bacteria 3469
209 Ga0207694_10011339 3300025924 Bacteria 6728
210 Ga0207694_10028606 3300025924 Bacteria 4249
211 Ga0207694_10236473 3300025924 Bacteria 1492
212 Ga0207650_10040703 3300025925 Unclassified 3402
213 Ga0207659_10020827 3300025926 Bacteria 4341
214 Ga0207690_10129865 3300025932 Bacteria 1843
215 Ga0207706_10032740 3300025933 Bacteria 4627
216 Ga0207670_10000001 3300025936 Bacteria 949312
217 Ga0207670_10203859 3300025936 Bacteria 1504
218 Ga0207704_10015218 3300025938 Bacteria 3913
219 Ga0207691_10029757 3300025940 Bacteria 5108
220 Ga0207691_10030668 3300025940 Bacteria 5022
221 Ga0207711_10451897 3300025941 Bacteria 1196
222 Ga0207689_10052088 3300025942 Bacteria 3373
223 Ga0207661_10009654 3300025944 Bacteria 6929
224 Ga0207661_10012626 3300025944 Bacteria 6148
225 Ga0207661_10038579 3300025944 Bacteria 3745
226 Ga0207661_10319924 3300025944 Bacteria 1394
227 Ga0207667_10056393 3300025949 Bacteria 4127
228 Ga0207667_10611039 3300025949 Bacteria 1099
229 Ga0207667_10640128 3300025949 Bacteria 1070
230 Ga0207651_10033027 3300025960 Bacteria 3332
231 Ga0207651_10101616 3300025960 Bacteria 2135
232 Ga0207712_10503281 3300025961 Bacteria 1036
233 Ga0207668_10114062 3300025972 Bacteria 2033
234 Ga0207640_10057369 3300025981 Bacteria 2561
235 Ga0207640_11152830 3300025981 Bacteria 687
236 Ga0207658_10299391 3300025986 Bacteria 1385
237 Ga0207658_10460273 3300025986 Bacteria 1127
238 Ga0207658_10708831 3300025986 Bacteria 910
239 Ga0207677_10597419 3300026023 Bacteria 968
240 Ga0207703_10448119 3300026035 Bacteria 1205
241 Ga0207639_10004131 3300026041 Bacteria 9780
242 Ga0207708_10034461 3300026075 Bacteria 3851
243 Ga0207708_10375809 3300026075 Bacteria 1171
244 Ga0207702_10472389 3300026078 Bacteria 1219
245 Ga0207702_11181529 3300026078 Bacteria 759
246 Ga0207641_10123983 3300026088 Bacteria 2310
247 Ga0207648_10017329 3300026089 Bacteria 6559
248 Ga0207648_10593100 3300026089 Bacteria 1021
249 Ga0207676_10481992 3300026095 Bacteria 1175
250 Ga0207674_10316458 3300026116 Bacteria 1510
251 Ga0207674_10571973 3300026116 Bacteria 1092
252 Ga0207675_100106104 3300026118 Bacteria 2648
253 Ga0207675_100922019 3300026118 Bacteria 890
254 Ga0207675_100992839 3300026118 Unclassified 858
255 Ga0207683_10068984 3300026121 Bacteria 3122
256 Ga0207698_10286749 3300026142 Bacteria 1525
257 Ga0207698_10554272 3300026142 Bacteria 1127
258 Ga0209998_10021647 3300027717 Bacteria 1382
259 Ga0209974_10033917 3300027876 Bacteria 1695
260 Ga0207428_10011767 3300027907 Bacteria 7715
261 Ga0268265_10084624 3300028380 Bacteria 2514
262 Ga0268265_10139213 3300028380 Bacteria 2029
263 Ga0268265_10572441 3300028380 Bacteria 1075
264 Ga0268264_10294845 3300028381 Bacteria 1524
265 Ga0268264_10323000 3300028381 Bacteria 1460
266 Ga0265337_1010165 3300028556 Unclassified 3310
267 Ga0265337_1011787 3300028556 Bacteria 3000
268 Ga0265326_10001959 3300028558 Bacteria 7052
269 Ga0265326_10016794 3300028558 Bacteria 2114
270 Ga0265326_10047154 3300028558 Bacteria 1222
271 Ga0265319_1013336 3300028563 Unclassified 3275
272 Ga0265319_1097754 3300028563 Bacteria 923
273 Ga0265334_10017912 3300028573 Bacteria 2921
274 Ga0265334_10021838 3300028573 Bacteria 2612
275 Ga0265334_10099159 3300028573 Bacteria 1056
276 Ga0265318_10000049 3300028577 Bacteria 119684
277 Ga0265318_10000271 3300028577 Bacteria 43928
278 Ga0265318_10017059 3300028577 Bacteria 2987
279 Ga0265318_10169843 3300028577 Bacteria 799
280 Ga0265323_10000457 3300028653 Bacteria 23167
281 Ga0265323_10004912 3300028653 Bacteria 5712
282 Ga0265323_10006588 3300028653 Bacteria 4873
283 Ga0265323_10013732 3300028653 Bacteria 3222
284 Ga0265323_10035047 3300028653 Bacteria 1851
285 Ga0265323_10056954 3300028653 Bacteria 1369
286 Ga0265322_10027161 3300028654 Bacteria 1636
287 Ga0265322_10075553 3300028654 Bacteria 956
288 Ga0265336_10076191 3300028666 Bacteria 1002
289 Ga0265338_10003104 3300028800 Bacteria 23782
290 Ga0265338_10012015 3300028800 Bacteria 9912
291 Ga0265338_10025456 3300028800 Bacteria 6002
292 Ga0265338_10122518 3300028800 Bacteria 2069
293 Ga0265338_10180998 3300028800 Bacteria 1607
294 Ga0265324_10000445 3300029957 Bacteria 29408
295 Ga0265330_10000361 3300031235 Bacteria 32081
296 Ga0265330_10000963 3300031235 Bacteria 17708
297 Ga0265330_10001049 3300031235 Bacteria 16694
298 Ga0265330_10001401 3300031235 Bacteria 14100
299 Ga0265330_10001405 3300031235 Bacteria 14091
300 Ga0265330_10002511 3300031235 Bacteria 9973
301 Ga0265330_10003613 3300031235 Bacteria 8052
302 Ga0265330_10006348 3300031235 Bacteria 5847
303 Ga0265330_10012190 3300031235 Bacteria 4023
304 Ga0265330_10098338 3300031235 Bacteria 1253
305 Ga0265332_10000857 3300031238 Bacteria 18430
306 Ga0265332_10017458 3300031238 Bacteria 3167
307 Ga0265332_10028192 3300031238 Bacteria 2459
308 Ga0265332_10072358 3300031238 Bacteria 1468
309 Ga0265332_10102379 3300031238 Bacteria 1207
310 Ga0265328_10000581 3300031239 Bacteria 16927
311 Ga0265328_10001623 3300031239 Bacteria 10353
312 Ga0265328_10002018 3300031239 Bacteria 9203
313 Ga0265328_10194924 3300031239 Unclassified 768
314 Ga0265320_10000055 3300031240 Bacteria 109446
315 Ga0265320_10004439 3300031240 Bacteria 9193
316 Ga0265320_10031847 3300031240 Bacteria 2705
317 Ga0265320_10049610 3300031240 Bacteria 2043
318 Ga0265325_10027696 3300031241 Bacteria 3061
319 Ga0265325_10050828 3300031241 Unclassified 2133
320 Ga0265329_10000342 3300031242 Bacteria 24518
321 Ga0265329_10000698 3300031242 Bacteria 17117
322 Ga0265329_10001284 3300031242 Bacteria 12237
323 Ga0265329_10008991 3300031242 Bacteria 3755
324 Ga0265329_10017433 3300031242 Unclassified 2471
325 Ga0265329_10031288 3300031242 Bacteria 1730
326 Ga0265340_10000062 3300031247 Bacteria 49902
327 Ga0265340_10031173 3300031247 Bacteria 2668
328 Ga0265340_10212643 3300031247 Bacteria 868
329 Ga0265340_10252488 3300031247 Bacteria 786
330 Ga0265339_10000545 3300031249 Bacteria 29434
331 Ga0265339_10002896 3300031249 Bacteria 12148
332 Ga0265339_10029249 3300031249 Bacteria 3127
333 Ga0265339_10058525 3300031249 Bacteria 2080
334 Ga0265339_10063786 3300031249 Bacteria 1978
335 Ga0265339_10111668 3300031249 Bacteria 1413
336 Ga0265331_10000043 3300031250 Bacteria 189515
337 Ga0265331_10000619 3300031250 Bacteria 30921
338 Ga0265331_10035396 3300031250 Bacteria 2457
339 Ga0265331_10094912 3300031250 Bacteria 1376
340 Ga0265316_10000162 3300031344 Bacteria 75324
341 Ga0265316_10000322 3300031344 Bacteria 53085
342 Ga0265316_10003380 3300031344 Bacteria 16168
343 Ga0265316_10009290 3300031344 Bacteria 9058
344 Ga0265316_10018135 3300031344 Bacteria 6058
345 Ga0265316_10024742 3300031344 Bacteria 5020
346 Ga0265316_10027463 3300031344 Bacteria 4711
347 Ga0265316_10093197 3300031344 Bacteria 2295
348 Ga0265316_10093848 3300031344 Unclassified 2286
349 Ga0265316_10166657 3300031344 Unclassified 1645
350 Ga0265316_10226448 3300031344 Bacteria 1378
351 Ga0265316_10255326 3300031344 Bacteria 1286
352 Ga0265316_10256781 3300031344 Bacteria 1282
353 Ga0265316_10404355 3300031344 Bacteria 983
354 Ga0265313_10000036 3300031595 Bacteria 124141
355 Ga0265313_10025903 3300031595 Bacteria 3099
356 Ga0265313_10045162 3300031595 Bacteria 2146
357 Ga0265313_10067634 3300031595 Bacteria 1652
358 Ga0316575_10102266 3300031665 Bacteria 1166
359 Ga0265314_10000007 3300031711 Bacteria 491737
360 Ga0265314_10002449 3300031711 Bacteria 18984
361 Ga0265314_10002859 3300031711 Bacteria 17171
362 Ga0265314_10015469 3300031711 Bacteria 6054
363 Ga0265314_10035058 3300031711 Bacteria 3660
364 Ga0265314_10053431 3300031711 Bacteria 2801
365 Ga0265314_10104073 3300031711 Unclassified 1818
366 Ga0265342_10000925 3300031712 Bacteria 29147
367 Ga0265342_10000990 3300031712 Bacteria 27988
368 Ga0265342_10001364 3300031712 Bacteria 22839
369 Ga0265342_10001431 3300031712 Bacteria 22255
370 Ga0265342_10001835 3300031712 Bacteria 19241
371 Ga0265342_10005003 3300031712 Bacteria 10233
372 Ga0265342_10007277 3300031712 Bacteria 8126
373 Ga0265342_10018859 3300031712 Bacteria 4460
374 Ga0265342_10020491 3300031712 Bacteria 4239
375 Ga0265342_10026103 3300031712 Bacteria 3664
376 Ga0265342_10054127 3300031712 Bacteria 2386
377 Ga0265342_10112268 3300031712 Bacteria 1541
378 Ga0316576_10037391 3300031727 Unclassified 3475
379 Ga0316578_10131224 3300031728 Bacteria 1507
380 Ga0316592_1010006 3300033524 Unclassified 1905
381 Ga0316592_1025896 3300033524 Bacteria 1265
382 Ga0316592_1079484 3300033524 Bacteria 745
383 Ga0316588_1004211 3300033528 Bacteria 2702
384 Ga0316588_1004727 3300033528 Bacteria 2601
385 Ga0316588_1042513 3300033528 Unclassified 1089
386 Ga0316587_1001456 3300033529 Bacteria 2923
387 Ga0373950_0000005 3300034818 Bacteria 404272
388 Ga0373950_0000041 3300034818 Bacteria 113513
389 Ga0373923_0119037 3300035111 Bacteria 1179
390 Ga0373923_0350098 3300035111 Bacteria 705
391 Ga0373945_0076900 3300035116 Unclassified 1273
392 Ga0373954_0009176 3300035118 Bacteria 4350
393 Ga0373954_0038474 3300035118 Bacteria 2225
394 Ga0373954_0078840 3300035118 Bacteria 1572
395 Ga0373956_0039014 3300035119 Bacteria 2104
396 Ga0373956_0082169 3300035119 Bacteria 1479
397 Ga0373957_0039776 3300035120 Unclassified 1765
398 Ga0373957_0040701 3300035120 Unclassified 1748
399 Ga0373957_0152729 3300035120 Bacteria 948
400 Ga0373955_0002906 3300035172 Bacteria 7519
401 Ga0373955_0114118 3300035172 Bacteria 1564
402 Ga0373955_0150988 3300035172 Bacteria 1367
403 Ga0373955_0199461 3300035172 Bacteria 1191
404 Ga0373924_0053241 3300035410 Bacteria 1681
405 Ga0373924_0058581 3300035410 Bacteria 1608
406 Ga0373935_0229174 3300035692 Bacteria 1293
407 Ga0373935_0299103 3300035692 Bacteria 1137
408 Ga0373927_0250549 3300035695 Bacteria 1164
409 Ga0373933_0000130 3300035724 Bacteria 47543
410 Ga0373933_0018190 3300035724 Bacteria 3949
411 Ga0373933_0078548 3300035724 Unclassified 2019
412 Ga0373933_0108900 3300035724 Bacteria 1726
413 Ga0373937_0106638 3300036401 Bacteria 2604
414 Ga0373937_0238916 3300036401 Bacteria 1711
415 Ga0373937_0256869 3300036401 Bacteria 1647
416 Ga0373937_0413512 3300036401 Bacteria 1280
417 Ga0373937_0603954 3300036401 Bacteria 1041
418 Ga0373925_0781656 3300037068 Bacteria 787
419 Ga0436365_0442970 3300039437 Bacteria 1894
420 Ga0436365_0678640 3300039437 Bacteria 1055
421 Ga0436365_0810467 3300039437 Bacteria 809
422 Ga0436362_0938429 3300039453 Bacteria 982
423 Ga0451577_0012336 3300042876 Bacteria 8026
424 Ga0451577_0055417 3300042876 Bacteria 3538
425 Ga0451577_1093335 3300042876 Unclassified 714
426 Ga0453684_0000257 3300044712 Bacteria 228854
427 Ga0453684_0035935 3300044712 Bacteria 6837
428 Ga0453684_0066277 3300044712 Bacteria 4599
429 Ga0453684_0378749 3300044712 Bacteria 1589
430 Ga0453684_0386919 3300044712 Bacteria 1569
431 Ga0453684_0812663 3300044712 Bacteria 1007
432 Ga0466957_0164449 3300044842 Bacteria 1443
433 Ga0451576_0325189 3300045051 Bacteria 1609
434 Ga0495592_0283513 3300046454 Bacteria 1083
435 Ga0495630_0131434 3300046517 Unclassified 1901
436 Ga0495587_0152375 3300046536 Bacteria 1317
437 Ga0495667_0122501 3300046559 Bacteria 1679
438 Ga0495667_0259180 3300046559 Unclassified 1106
439 Ga0495634_0430581 3300046642 Bacteria 780
440 Ga0495657_0091564 3300046675 Bacteria 1950
441 Ga0495624_0243244 3300046690 Unclassified 1089
442 Ga0495674_0003255 3300047319 Bacteria 15773
443 Ga0495680_0179490 3300047322 Unclassified 1529
444 Ga0495602_0263662 3300048088 Unclassified 1277
445 Ga0496100_0149656 3300048903 Bacteria 1663
446 Ga0496100_0285336 3300048903 Bacteria 1232
447 Ga0496101_0019868 3300048904 Bacteria 4594
448 Ga0496104_0082856 3300048907 Bacteria 3059
449 Ga0496104_0548222 3300048907 Bacteria 1067
450 Ga0496104_0680623 3300048907 Unclassified 937
451 Ga0496105_0153075 3300048908 Bacteria 1895
452 Ga0496106_0121692 3300048909 Bacteria 2040
453 Ga0496107_0119604 3300048910 Bacteria 1940
454 Ga0496108_0038402 3300048911 Bacteria 3989
455 Ga0496108_0211046 3300048911 Bacteria 1686
456 Ga0496109_0287207 3300048912 Bacteria 1551
457 Ga0496109_0381598 3300048912 Bacteria 1331
458 Ga0496109_1088281 3300048912 Unclassified 736
459 Ga0496113_0687075 3300048916 Bacteria 817
460 Ga0496114_0002464 3300048917 Bacteria 14128
461 Ga0496114_0003551 3300048917 Bacteria 11969
462 Ga0496114_0031070 3300048917 Bacteria 4393
463 Ga0496114_0032116 3300048917 Bacteria 4320
464 Ga0496115_0042676 3300048918 Bacteria 3614
465 Ga0496115_0268170 3300048918 Bacteria 1403
466 Ga0496115_0795856 3300048918 Bacteria 736
467 Ga0501311_043606 3300049527 Bacteria 686
468 Ga0501034_0000288 3300049571 Bacteria 90090
469 Ga0501043_0053186 3300049579 Bacteria 3180
470 Ga0501046_0000336 3300049580 Bacteria 47389
471 Ga0501047_0000004 3300049581 Bacteria 463872
472 Ga0501048_0012343 3300049582 Bacteria 6356
473 Ga0501067_0000040 3300049583 Bacteria 78950
474 Ga0501068_0030612 3300049584 Bacteria 3193
475 Ga0501068_0034588 3300049584 Bacteria 3013
476 Ga0501069_0009205 3300049585 Bacteria 5211
477 Ga0501070_0000294 3300049586 Bacteria 46585
478 Ga0501070_0073713 3300049586 Bacteria 2824
479 Ga0501072_0002490 3300049588 Bacteria 13795
480 Ga0501073_0000862 3300049589 Bacteria 21672
481 Ga0501073_0002869 3300049589 Bacteria 12909
482 Ga0501073_0004191 3300049589 Bacteria 10816
483 Ga0501073_0034145 3300049589 Bacteria 3621
484 Ga0501073_0040763 3300049589 Bacteria 3284
485 Ga0501073_0353611 3300049589 Bacteria 1014
486 Ga0501074_0103277 3300049590 Bacteria 2040
487 Ga0501074_0135086 3300049590 Bacteria 1764
488 Ga0501077_0314034 3300049593 Bacteria 999
489 Ga0501079_0002318 3300049741 Bacteria 13792
490 Ga0501080_0014742 3300049742 Bacteria 7197
491 Ga0501080_0092638 3300049742 Bacteria 2806
492 Ga0501081_0208541 3300049743 Bacteria 1419
493 Ga0501083_0000230 3300049744 Bacteria 35835
494 Ga0501083_0016232 3300049744 Bacteria 5215
495 nmdc:mga05p37_764911_c1 3300050507 Bacteria 1062
496 nmdc:mga08y16_1723_c1 3300050511 Bacteria 22203
497 Ga0495601_0389765 3300053077 Bacteria 904
498 Ga0495595_0129241 3300053084 Unclassified 1234
499 Ga0495619_0201225 3300053085 Bacteria 1379
500 Ga0495619_0214018 3300053085 Unclassified 1335
501 Ga0501084_0000001 3300054114 Bacteria 346664
502 Ga0501084_0214380 3300054114 Bacteria 1624
503 Ga0501084_0367030 3300054114 Bacteria 1216
504 Ga0587093_026644 3300059478 Unclassified 809
505 Ga0587085_007108 3300059506 Bacteria 1385
506 Ga0587085_007278 3300059506 Bacteria 1375
507 Ga0587101_039820 3300059623 Bacteria 770
508 Ga0587109_022572 3300059624 Bacteria 1134
509 Ga0587109_029052 3300059624 Bacteria 1039
510 Ga0587109_064073 3300059624 Unclassified 781
511 Ga0587062_046648 3300059639 Bacteria 721
512 Ga0587068_036043 3300059641 Unclassified 879
513 Ga0587079_076682 3300059647 Bacteria 756
514 Ga0587111_0050884 3300060346 Bacteria 914
515 Ga0587111_0110559 3300060346 Bacteria 696
516 Ga0501082_0025333 3300060353 Bacteria 5111
517 Ga0501082_0179858 3300060353 Bacteria 1839
518 Ga0207693_10100425
519 Ga0006767J43181_102084
520 Ga0006763J43179_103374
521 Ga0006762J43184_103412
522 Ga0006760J45825_103176
523 Ga0006765J45826_109285
524 Ga0006778J45830_1038748
525 Ga0006759J45824_1005829
526 Ga0006759J45824_1044890
527 Ga0006759J45824_1051285
528 Ga0006759J45824_1096018
529 Ga0006758J48902_1007242
530 Ga0006770J48903_1021571
531 Ga0007417J51691_1022390
532 Ga0007417J51691_1053478
533 Ga0007410J51695_1061257
534 Ga0007409J51694_1020578
535 Ga0007409J51694_1060095
536 Ga0007416J51690_1034982
537 Ga0007416J51690_1094289
538 Ga0032354_1003399
539 Ga0032354_1080788
540 Ga0058859_10010442
541 Ga0058859_10084052
542 Ga0058863_10036104
543 Ga0058863_10037321
544 Ga0058863_10071324
545 Ga0058861_10060570
546 Ga0058860_10090439
547 Ga0058860_10106978
548 Ga0058860_10200896
549 Ga0058860_12117425
550 Ga0058860_12143662
551 Ga0058860_12204739
552 Ga0058862_10001581
553 Ga0065712_10149515
554 Ga0065715_10050972
555 Ga0070658_10002043
556 Ga0070676_10592525
557 Ga0070683_100003329
558 Ga0070683_100309279
559 Ga0070683_100378125
560 Ga0070690_100024771
561 Ga0070690_100047932
562 Ga0070670_100068781
563 Ga0070670_100226313
564 Ga0068869_100125356
565 Ga0070666_10083945
566 Ga0070666_10182691
567 Ga0070680_100011471
568 Ga0070680_100509757
569 Ga0070682_100088064
570 Ga0070682_100147497
571 Ga0070682_100172448
572 Ga0070682_100395540
573 Ga0068868_100058849
574 Ga0068868_100214796
575 Ga0070689_100000002
576 Ga0070689_100152299
577 Ga0070689_100153952
578 Ga0070689_100381586
579 Ga0070689_100566160
580 Ga0070687_100009784
581 Ga0070687_100083671
582 Ga0070668_100009923
583 Ga0070669_100799475
584 Ga0070675_100069561
585 Ga0070671_100230569
586 Ga0070674_100005777
587 Ga0070674_100101455
588 Ga0070673_100034290
589 Ga0070688_100199996
590 Ga0070667_100453040
591 Ga0070703_10162853
592 Ga0070709_10090879
593 Ga0070713_100067850
594 Ga0070713_100289600
595 Ga0070711_100313587
596 Ga0070711_100450252
597 Ga0070700_100004122
598 Ga0070694_100410806
599 Ga0070708_100726973
600 Ga0070678_100210285
601 Ga0070662_100030004
602 Ga0070681_10165296
603 Ga0068867_100007590
604 Ga0070685_10070079
605 Ga0070698_100648694
606 Ga0070698_100684016
607 Ga0070679_100009440
608 Ga0070679_100095387
609 Ga0070684_100002919
610 Ga0070684_100198813
611 Ga0070684_100222859
612 Ga0070684_100307488
613 Ga0070684_100633971
614 Ga0070697_100757615
615 Ga0068853_100001166
616 Ga0068853_101229077
617 Ga0070672_100064398
618 Ga0070672_100650641
619 Ga0070686_100016193
620 Ga0070686_100022940
621 Ga0070686_100142060
622 Ga0070693_100333806
623 Ga0070665_100352314
624 Ga0070665_100412582
625 Ga0068855_100022245
626 Ga0068855_100090365
627 Ga0068857_100229785
628 Ga0068854_100039864
629 Ga0068856_100072417
630 Ga0068856_100628406
631 Ga0070702_100232111
632 Ga0068852_100199305
633 Ga0068852_100427262
634 Ga0068852_100920713
635 Ga0068859_100268634
636 Ga0068861_100124005
637 Ga0068861_100583438
638 Ga0068861_100788814
639 Ga0068863_100787704
640 Ga0068862_100039416
641 Ga0068862_100372012
642 Ga0068862_100397843
643 Ga0081455_10293168
644 Ga0070717_10387081
645 Ga0070715_10158231
646 Ga0075430_100496991
647 Ga0068865_100004463
648 Ga0097620_100268643
649 Ga0075435_100616007
650 Ga0105240_10019733
651 Ga0105240_10133027
652 Ga0111539_10057409
653 Ga0105247_10232034
654 Ga0105241_10086201
655 Ga0105237_10000101
656 Ga0105237_10059574
657 Ga0105237_10130211
658 Ga0105238_10005442
659 Ga0105238_10015301
660 Ga0105238_10279772
661 Ga0105239_10070238
662 Ga0105239_10747656
663 Ga0154014_103114
664 Ga0157374_10118914
665 Ga0157374_10173761
666 Ga0157374_10521719
667 Ga0157378_10053951
668 Ga0157378_10317426
669 Ga0157378_10436964
670 Ga0163162_10554616
671 Ga0157375_10572172
672 Ga0157375_11304111
673 Ga0163163_10341316
674 Ga0157380_10862438
675 Ga0157377_10559000
676 Ga0157377_10687683
677 Ga0157379_10098819
678 Ga0157376_10044156
679 Ga0157376_10882599
680 Ga0197907_10703562
681 Ga0206356_10520761
682 Ga0206356_10639141
683 Ga0206356_10705176
684 Ga0206355_1661710
685 Ga0206351_10717000
686 Ga0206351_10732164
687 Ga0206352_10117762
688 Ga0206352_10541931
689 Ga0206352_10809002
690 Ga0206352_10920700
691 Ga0206352_10961159
692 Ga0206352_11254508
693 Ga0206350_11419771
694 Ga0206353_10788314
695 Ga0224712_10128615
696 Ga0207666_1002356
697 Ga0207697_10012087
698 Ga0207682_10117945
699 Ga0207692_10098724
700 Ga0207642_10085805
701 Ga0207688_10056336
702 Ga0207680_10055895
703 Ga0207645_10005842
704 Ga0207643_10087210
705 Ga0207705_10024553
706 Ga0207654_10260160
707 Ga0207707_10337812
708 Ga0207707_10515446
709 Ga0207707_10747445
710 Ga0207695_10287527
711 Ga0207671_10000194
712 Ga0207671_10070424
713 Ga0207671_10097210
714 Ga0207663_10296656
715 Ga0207663_10473720
716 Ga0207660_10052352
717 Ga0207662_10016475
718 Ga0207662_10069189
719 Ga0207657_10146920
720 Ga0207657_10208267
721 Ga0207652_10000539
722 Ga0207652_10002124
723 Ga0207652_10118452
724 Ga0207652_10554735
725 Ga0207681_10031379
726 Ga0207694_10011339
727 Ga0207694_10028606
728 Ga0207694_10236473
729 Ga0207650_10040703
730 Ga0207659_10020827
731 Ga0207690_10129865
732 Ga0207706_10032740
733 Ga0207670_10000001
734 Ga0207670_10203859
735 Ga0207704_10015218
736 Ga0207691_10029757
737 Ga0207691_10030668
738 Ga0207711_10451897
739 Ga0207689_10052088
740 Ga0207661_10009654
741 Ga0207661_10012626
742 Ga0207661_10038579
743 Ga0207661_10319924
744 Ga0207667_10056393
745 Ga0207667_10611039
746 Ga0207667_10640128
747 Ga0207651_10033027
748 Ga0207651_10101616
749 Ga0207712_10503281
750 Ga0207668_10114062
751 Ga0207640_10057369
752 Ga0207640_11152830
753 Ga0207658_10299391
754 Ga0207658_10460273
755 Ga0207658_10708831
756 Ga0207677_10597419
757 Ga0207703_10448119
758 Ga0207639_10004131
759 Ga0207708_10034461
760 Ga0207708_10375809
761 Ga0207702_10472389
762 Ga0207702_11181529
763 Ga0207641_10123983
764 Ga0207648_10017329
765 Ga0207648_10593100
766 Ga0207676_10481992
767 Ga0207674_10316458
768 Ga0207674_10571973
769 Ga0207675_100106104
770 Ga0207675_100922019
771 Ga0207675_100992839
772 Ga0207683_10068984
773 Ga0207698_10286749
774 Ga0207698_10554272
775 Ga0209998_10021647
776 Ga0209974_10033917
777 Ga0207428_10011767
778 Ga0268265_10084624
779 Ga0268265_10139213
780 Ga0268265_10572441
781 Ga0268264_10294845
782 Ga0268264_10323000
783 Ga0265337_1010165
784 Ga0265337_1011787
785 Ga0265326_10001959
786 Ga0265326_10016794
787 Ga0265326_10047154
788 Ga0265319_1013336
789 Ga0265319_1097754
790 Ga0265334_10017912
791 Ga0265334_10021838
792 Ga0265334_10099159
793 Ga0265318_10000049
794 Ga0265318_10000271
795 Ga0265318_10017059
796 Ga0265318_10169843
797 Ga0265323_10000457
798 Ga0265323_10004912
799 Ga0265323_10006588
800 Ga0265323_10013732
801 Ga0265323_10035047
802 Ga0265323_10056954
803 Ga0265322_10027161
804 Ga0265322_10075553
805 Ga0265336_10076191
806 Ga0265338_10003104
807 Ga0265338_10012015
808 Ga0265338_10025456
809 Ga0265338_10122518
810 Ga0265338_10180998
811 Ga0265324_10000445
812 Ga0265330_10000361
813 Ga0265330_10000963
814 Ga0265330_10001049
815 Ga0265330_10001401
816 Ga0265330_10001405
817 Ga0265330_10002511
818 Ga0265330_10003613
819 Ga0265330_10006348
820 Ga0265330_10012190
821 Ga0265330_10098338
822 Ga0265332_10000857
823 Ga0265332_10017458
824 Ga0265332_10028192
825 Ga0265332_10072358
826 Ga0265332_10102379
827 Ga0265328_10000581
828 Ga0265328_10001623
829 Ga0265328_10002018
830 Ga0265328_10194924
831 Ga0265320_10000055
832 Ga0265320_10004439
833 Ga0265320_10031847
834 Ga0265320_10049610
835 Ga0265325_10027696
836 Ga0265325_10050828
837 Ga0265329_10000342
838 Ga0265329_10000698
839 Ga0265329_10001284
840 Ga0265329_10008991
841 Ga0265329_10017433
842 Ga0265329_10031288
843 Ga0265340_10000062
844 Ga0265340_10031173
845 Ga0265340_10212643
846 Ga0265340_10252488
847 Ga0265339_10000545
848 Ga0265339_10002896
849 Ga0265339_10029249
850 Ga0265339_10058525
851 Ga0265339_10063786
852 Ga0265339_10111668
853 Ga0265331_10000043
854 Ga0265331_10000619
855 Ga0265331_10035396
856 Ga0265331_10094912
857 Ga0265316_10000162
858 Ga0265316_10000322
859 Ga0265316_10003380
860 Ga0265316_10009290
861 Ga0265316_10018135
862 Ga0265316_10024742
863 Ga0265316_10027463
864 Ga0265316_10093197
865 Ga0265316_10093848
866 Ga0265316_10166657
867 Ga0265316_10226448
868 Ga0265316_10255326
869 Ga0265316_10256781
870 Ga0265316_10404355
871 Ga0265313_10000036
872 Ga0265313_10025903
873 Ga0265313_10045162
874 Ga0265313_10067634
875 Ga0316575_10102266
876 Ga0265314_10000007
877 Ga0265314_10002449
878 Ga0265314_10002859
879 Ga0265314_10015469
880 Ga0265314_10035058
881 Ga0265314_10053431
882 Ga0265314_10104073
883 Ga0265342_10000925
884 Ga0265342_10000990
885 Ga0265342_10001364
886 Ga0265342_10001431
887 Ga0265342_10001835
888 Ga0265342_10005003
889 Ga0265342_10007277
890 Ga0265342_10018859
891 Ga0265342_10020491
892 Ga0265342_10026103
893 Ga0265342_10054127
894 Ga0265342_10112268
895 Ga0316576_10037391
896 Ga0316578_10131224
897 Ga0316592_1010006
898 Ga0316592_1025896
899 Ga0316592_1079484
900 Ga0316588_1004211
901 Ga0316588_1004727
902 Ga0316588_1042513
903 Ga0316587_1001456
904 Ga0373950_0000005
905 Ga0373950_0000041
906 Ga0373923_0119037
907 Ga0373923_0350098
908 Ga0373945_0076900
909 Ga0373954_0009176
910 Ga0373954_0038474
911 Ga0373954_0078840
912 Ga0373956_0039014
913 Ga0373956_0082169
914 Ga0373957_0039776
915 Ga0373957_0040701
916 Ga0373957_0152729
917 Ga0373955_0002906
918 Ga0373955_0114118
919 Ga0373955_0150988
920 Ga0373955_0199461
921 Ga0373924_0053241
922 Ga0373924_0058581
923 Ga0373935_0229174
924 Ga0373935_0299103
925 Ga0373927_0250549
926 Ga0373933_0000130
927 Ga0373933_0018190
928 Ga0373933_0078548
929 Ga0373933_0108900
930 Ga0373937_0106638
931 Ga0373937_0238916
932 Ga0373937_0256869
933 Ga0373937_0413512
934 Ga0373937_0603954
935 Ga0373925_0781656
936 Ga0436365_0442970
937 Ga0436365_0678640
938 Ga0436365_0810467
939 Ga0436362_0938429
940 Ga0451577_0012336
941 Ga0451577_0055417
942 Ga0451577_1093335
943 Ga0453684_0000257
944 Ga0453684_0035935
945 Ga0453684_0066277
946 Ga0453684_0378749
947 Ga0453684_0386919
948 Ga0453684_0812663
949 Ga0466957_0164449
950 Ga0451576_0325189
951 Ga0495592_0283513
952 Ga0495630_0131434
953 Ga0495587_0152375
954 Ga0495667_0122501
955 Ga0495667_0259180
956 Ga0495634_0430581
957 Ga0495657_0091564
958 Ga0495624_0243244
959 Ga0495674_0003255
960 Ga0495680_0179490
961 Ga0495602_0263662
962 Ga0496100_0149656
963 Ga0496100_0285336
964 Ga0496101_0019868
965 Ga0496104_0082856
966 Ga0496104_0548222
967 Ga0496104_0680623
968 Ga0496105_0153075
969 Ga0496106_0121692
970 Ga0496107_0119604
971 Ga0496108_0038402
972 Ga0496108_0211046
973 Ga0496109_0287207
974 Ga0496109_0381598
975 Ga0496109_1088281
976 Ga0496113_0687075
977 Ga0496114_0002464
978 Ga0496114_0003551
979 Ga0496114_0031070
980 Ga0496114_0032116
981 Ga0496115_0042676
982 Ga0496115_0268170
983 Ga0496115_0795856
984 Ga0501311_043606
985 Ga0501034_0000288
986 Ga0501043_0053186
987 Ga0501046_0000336
988 Ga0501047_0000004
989 Ga0501048_0012343
990 Ga0501067_0000040
991 Ga0501068_0030612
992 Ga0501068_0034588
993 Ga0501069_0009205
994 Ga0501070_0000294
995 Ga0501070_0073713
996 Ga0501072_0002490
997 Ga0501073_0000862
998 Ga0501073_0002869
999 Ga0501073_0004191
1000 Ga0501073_0034145
1001 Ga0501073_0040763
1002 Ga0501073_0353611
1003 Ga0501074_0103277
1004 Ga0501074_0135086
1005 Ga0501077_0314034
1006 Ga0501079_0002318
1007 Ga0501080_0014742
1008 Ga0501080_0092638
1009 Ga0501081_0208541
1010 Ga0501083_0000230
1011 Ga0501083_0016232
1012 nmdc:mga05p37_764911_c1
1013 nmdc:mga08y16_1723_c1
1014 Ga0495601_0389765
1015 Ga0495595_0129241
1016 Ga0495619_0201225
1017 Ga0495619_0214018
1018 Ga0501084_0000001
1019 Ga0501084_0214380
1020 Ga0501084_0367030
1021 Ga0587093_026644
1022 Ga0587085_007108
1023 Ga0587085_007278
1024 Ga0587101_039820
1025 Ga0587109_022572
1026 Ga0587109_029052
1027 Ga0587109_064073
1028 Ga0587062_046648
1029 Ga0587068_036043
1030 Ga0587079_076682
1031 Ga0587111_0050884
1032 Ga0587111_0110559
1033 Ga0501082_0025333
1034 Ga0501082_0179858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

122

172

0.89

Map